SimulationCraft 1007-01

for World of Warcraft 10.0.7.48865 Live (hotfix 2023-04-01/48865, git build 25e75ca002)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 44109 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
44108.6 44108.6 49.6 / 0.112% 8440.6 / 19.1% 3495.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.6 Runic Power 2.88% 53.9 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 44109
Abomination Limb 0 (513) 0.0% (1.2%) 3.0 120.48sec 50918 41374

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2308 0.0000 0.00 0.00 0.00% 41374.31 41374.31

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [e]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [f]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 513 1.2% 38.3 6.91sec 3984 0 Direct 38.3 3119 6288 3984 27.3% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.25 38.25 0.00 0.00 0.00 0.0000 0.0000 152381.59 152381.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.72% 27.82 14 38 3118.90 2211 5185 3119.25 2569 3698 86756 86756 0.00%
crit 27.28% 10.44 1 24 6288.28 4422 10370 6291.90 4727 8032 65625 65625 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2588 5.9% 193.2 1.81sec 4016 2230 Direct 193.2 3599 7239 4016 27.6% 16.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.16 193.16 0.00 0.00 0.00 1.8014 0.0000 775801.65 1108316.33 30.00% 2229.60 2229.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.00% 108.17 64 154 3598.67 2435 6700 3598.63 3348 3895 389269 556112 30.00%
crit 27.64% 53.40 25 85 7239.07 4870 12889 7235.57 6470 8090 386533 552204 30.00%
miss 16.36% 31.60 12 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1259 2.9% 188.7 1.81sec 2000 1111 Direct 188.7 1799 3621 2000 27.6% 16.8%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 188.66 188.66 0.00 0.00 0.00 1.8011 0.0000 377398.41 539154.33 30.00% 1110.71 1110.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.64% 104.98 60 150 1798.77 1217 3350 1798.59 1662 1963 188829 269762 30.00%
crit 27.60% 52.08 24 87 3620.96 2435 6539 3618.95 3281 4049 188570 269392 30.00%
miss 16.75% 31.60 14 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 94 0.2% 2.0 179.80sec 13878 0 Direct 2.0 10919 22094 13878 26.5% 0.0%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 27759.63 27759.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.52% 1.47 0 3 10918.98 9342 18578 10142.61 0 17603 16057 16057 0.00%
crit 26.48% 0.53 0 2 22093.64 18685 36534 10153.00 0 36480 11703 11703 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}
Breath of Sindragosa 0 (9582) 0.0% (21.7%) 2.9 120.50sec 971904 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [i]:2.95
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 9582 21.7% 132.5 2.02sec 21607 0 Direct 132.5 16909 33887 21607 27.7% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 132.53 132.53 0.00 0.00 0.00 0.0000 0.0000 2863609.58 2863609.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.33% 95.86 43 148 16909.04 8588 34521 16923.25 14856 19214 1620849 1620849 0.00%
crit 27.67% 36.67 12 66 33887.08 17175 66259 33912.62 28611 39882 1242761 1242761 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 671 1.5% 2.8 120.03sec 71806 0 Direct 2.6 59558 119721 76340 27.9% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.82 2.65 0.00 0.00 0.00 0.0000 0.0000 202233.65 202233.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.10% 1.91 0 3 59557.56 22015 68019 57022.87 0 68019 113752 113752 0.00%
crit 27.90% 0.74 0 3 119720.77 44029 136038 69150.16 0 136038 88481 88481 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 11 0.0% 0.6 82.01sec 5224 4044 Direct 6.2 407 820 520 27.4% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.62 6.18 0.00 0.00 0.00 1.2920 0.0000 3214.82 3214.82 0.00% 4043.79 4043.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.62% 4.49 0 31 407.33 295 741 187.22 0 704 1828 1828 0.00%
crit 27.38% 1.69 0 16 819.64 589 1429 367.40 0 1429 1387 1387 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [W]:0.62
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 1286 2.9% 9.0 30.17sec 42504 0 Direct 9.0 33423 67187 42537 27.0% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.96 8.96 0.00 0.00 0.00 0.0000 0.0000 380957.07 544238.26 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.01% 6.54 1 9 33423.25 33171 34163 33422.90 33171 34163 218532 312196 30.00%
crit 26.99% 2.42 0 8 67186.69 66341 68326 63158.21 0 68326 162425 232042 28.21%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2138 4.9% 61.3 4.87sec 10460 0 Periodic 98.7 5087 10201 6499 27.6% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.33 0.00 98.72 98.72 60.32 0.0000 2.9999 641545.79 641545.79 0.00% 2166.33 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 72.39% 71.47 44 98 5086.98 63 10666 5085.84 4647 5571 363553 363553 0.00%
crit 27.61% 27.25 10 48 10200.90 814 22283 10197.89 8496 12227 277993 277993 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.11
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 2218 (3326) 5.1% (7.6%) 43.9 4.97sec 22836 17178 Direct 43.9 (87.8) 11913 23882 15223 27.7% (27.7%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.91 43.91 0.00 0.00 0.00 1.3294 0.0000 668492.34 668492.34 0.00% 17177.91 17177.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.35% 31.77 12 61 11913.27 7212 24103 11891.67 10249 13470 378485 378485 0.00%
crit 27.65% 12.14 1 29 23882.06 14424 47360 23807.46 19332 29166 290007 290007 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [H]:2.77
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [l]:28.32
  • if_expr:buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
    single_target
    [o]:4.21
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [s]:8.61
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 1109 2.5% 43.9 4.97sec 7613 0 Direct 43.9 5955 11952 7613 27.7% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.91 43.91 0.00 0.00 0.00 0.0000 0.0000 334319.51 334319.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.35% 31.77 13 57 5954.62 3606 11967 5944.23 5208 6795 189174 189174 0.00%
crit 27.65% 12.14 2 30 11951.90 7356 24103 11914.08 9621 14418 145146 145146 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 6021 (7283) 13.6% (16.5%) 61.3 4.87sec 35548 29528 Direct 61.3 (122.7) 23003 46136 29389 27.6% (27.6%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.33 61.33 0.00 0.00 0.00 1.2039 0.0000 1802398.80 1802398.80 0.00% 29528.01 29528.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.40% 44.40 20 68 23003.44 5361 48457 23000.52 20492 26238 1021391 1021391 0.00%
crit 27.60% 16.93 4 34 46136.18 10096 95284 46136.50 36837 59999 781008 781008 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [S]:37.28
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [X]:0.23
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [Z]:0.58
  • if_expr:buff.rime.react
    single_target
    [n]:23.24
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1262 2.9% 61.3 4.87sec 6160 0 Direct 61.3 4823 9668 6160 27.6% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.33 61.33 0.00 0.00 0.00 0.0000 0.0000 377801.77 377801.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.39% 44.40 23 65 4822.52 2542 10217 4822.19 4267 5385 214101 214101 0.00%
crit 27.61% 16.93 5 32 9667.62 5083 19899 9665.61 7524 11845 163701 163701 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1286 (8946) 2.9% (20.3%) 54.7 5.40sec 48994 20890 Direct 54.7 (211.3) 5508 11083 7039 27.5% (62.4%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.74 54.74 0.00 0.00 0.00 2.3454 0.0000 385288.34 550425.94 30.00% 20889.69 20889.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.55% 39.71 19 66 5508.19 3548 10197 5511.36 4854 6221 218736 312488 30.00%
crit 27.45% 15.03 3 31 11083.25 7097 19530 11080.75 8882 13911 166552 237938 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [U]:20.67
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [V]:32.79
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Y]:7.08
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [m]:24.21
  • if_expr:buff.killing_machine.react
    single_target
    [p]:20.89
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 643 1.5% 54.7 5.40sec 3520 0 Direct 54.7 2753 5547 3520 27.4% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.74 54.74 0.00 0.00 0.00 0.0000 0.0000 192665.87 275243.97 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.56% 39.72 17 64 2753.13 1774 5093 2754.66 2440 3147 109347 156214 30.00%
crit 27.44% 15.02 3 32 5546.75 3548 10197 5544.62 4271 7368 83319 119030 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 4678 10.6% 50.9 5.80sec 27553 0 Direct 50.9 0 27553 27553 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.91 50.91 0.00 0.00 0.00 0.0000 0.0000 1402590.24 1402590.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 50.91 26 78 27553.20 14730 58165 27515.29 24552 30671 1402590 1402590 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2339 5.3% 50.9 5.80sec 13776 0 Direct 50.9 0 13777 13777 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.91 50.91 0.00 0.00 0.00 0.0000 0.0000 701295.12 701295.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 50.91 26 78 13776.60 7365 29082 13757.64 12276 15336 701295 701295 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (5047) 0.0% (11.4%) 15.1 20.45sec 100007 79982

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.12 0.00 0.00 0.00 0.00 1.2504 0.0000 0.00 0.00 0.00% 79982.50 79982.50

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [R]:6.06
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [k]:9.06
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5047 11.4% 239.0 1.25sec 6328 0 Direct 239.0 4949 9947 6328 27.6% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 239.02 239.02 0.00 0.00 0.00 0.0000 0.0000 1512469.06 1512469.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.41% 173.07 118 232 4948.73 1038 13357 4948.93 4157 5720 856459 856459 0.00%
crit 27.59% 65.95 32 105 9947.46 2077 26015 9947.25 7605 12261 656010 656010 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 201 0.5% 20.4 14.34sec 2960 0 Direct 20.4 2314 4651 2960 27.7% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.37 20.37 0.00 0.00 0.00 0.0000 0.0000 60283.97 86122.16 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.34% 14.73 3 34 2313.79 2296 2365 2313.79 2296 2365 34087 48698 30.00%
crit 27.66% 5.63 0 17 4650.65 4593 4730 4637.41 0 4730 26197 37425 29.92%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 201 0.5% 20.4 14.32sec 2958 0 Direct 20.4 2314 4651 2958 27.6% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.36 20.36 0.00 0.00 0.00 0.0000 0.0000 60229.85 86044.83 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.45% 14.75 2 29 2313.68 2296 2365 2313.73 2296 2365 34135 48765 30.00%
crit 27.55% 5.61 0 15 4650.71 4593 4730 4626.93 0 4730 26095 37280 29.85%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 1766 / 964
Claw 581 0.7% 52.9 5.32sec 1795 1795 Direct 52.9 1406 2812 1795 27.7% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.90 52.90 0.00 0.00 0.00 1.0000 0.0000 94941.58 135634.29 30.00% 1794.84 1794.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.31% 38.25 16 52 1405.51 883 2537 1406.41 1266 1603 53764 76808 30.00%
crit 27.69% 14.65 3 29 2811.63 1766 5074 2814.06 2356 3366 41178 58827 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.90
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.67sec 60 60 Direct 2.9 47 94 60 26.9% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.00 1.0000 0.0000 175.20 250.29 30.00% 59.88 59.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.12% 2.14 0 3 47.20 33 66 46.18 0 63 101 144 29.32%
crit 26.88% 0.79 0 3 94.33 66 128 56.56 0 128 74 106 17.99%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.93
main_hand 1184 1.5% 96.1 2.88sec 2014 1313 Direct 96.1 1578 3156 2014 27.6% 0.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.15 96.15 0.00 0.00 0.00 1.5339 0.0000 193678.26 276690.29 30.00% 1313.22 1313.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.36% 69.57 40 92 1578.31 981 2819 1579.60 1434 1751 109810 156876 30.00%
crit 27.64% 26.57 8 48 3156.12 1995 5638 3159.47 2684 3648 83868 119814 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Anti-Magic Shell 7.4 43.22sec

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 7.43 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [G]:7.43
  • if_expr:runic_power.deficit>40
Arcane Torrent 2.0 143.84sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.03 0.00 0.00 0.00 0.00 1.2621 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [a]:0.97
  • if_expr:runic_power<60
    single_target
    [r]:1.06
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 4.0 82.85sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [c]:0.28
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [d]:3.67
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.1 74.39sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.06 0.00 0.00 0.00 0.00 1.1782 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [T]:3.13
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [q]:0.94
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 8.4 37.50sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.36 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [g]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [h]:8.03
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.4 303.68sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [b]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.67sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [j]:2.98
Unholy Strength 20.4 14.25sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.37 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5sec 120.5sec 11.8sec 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 122.4s
  • trigger_min/max:120.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 7.4 0.0 43.1sec 43.2sec 6.9sec 17.15% 0.00% 0.0 (0.0) 7.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 93.3s
  • trigger_min/max:40.0s / 93.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s

Stack Uptimes

  • antimagic_shell_1:17.15%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 12.6 38.3 24.2sec 5.8sec 18.7sec 78.46% 0.00% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.3s / 68.5s
  • trigger_min/max:0.9s / 53.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.2s

Stack Uptimes

  • bonegrinder_crit_1:22.43%
  • bonegrinder_crit_2:18.27%
  • bonegrinder_crit_3:14.94%
  • bonegrinder_crit_4:12.39%
  • bonegrinder_crit_5:10.42%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 5.6 0.0 49.2sec 49.2sec 9.8sec 18.25% 0.00% 0.0 (0.0) 5.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 271.5s
  • trigger_min/max:9.0s / 271.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bonegrinder_frost_1:18.25%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.8 13.9 120.9sec 15.0sec 19.4sec 18.19% 0.00% 1.8 (1.8) 2.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 147.7s
  • trigger_min/max:0.0s / 134.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.84%
  • bound_by_fire_and_blaze_2:4.18%
  • bound_by_fire_and_blaze_3:4.02%
  • bound_by_fire_and_blaze_4:3.48%
  • bound_by_fire_and_blaze_5:2.58%
  • bound_by_fire_and_blaze_6:3.09%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.5sec 120.5sec 44.9sec 44.28% 0.00% 132.2 (132.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 126.8s
  • trigger_min/max:120.0s / 126.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 117.0s

Stack Uptimes

  • breath_of_sindragosa_1:44.28%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Dragon Games Equipment 3.0 0.0 120.5sec 120.5sec 0.8sec 0.83% 0.00% 9.0 (9.0) 3.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.83
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 122.4s
  • trigger_min/max:120.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s

Stack Uptimes

  • dragon_games_equipment_1:0.83%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.2sec 99.2sec 57.8sec 25.13% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 340.2s

Stack Uptimes

  • elemental_chaos_air_1:25.13%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:Grants Haste and movement speed is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 122.4sec 98.7sec 57.7sec 24.61% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:24.61%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:Grants Mastery and damage taken reduced.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 125.9sec 100.2sec 58.5sec 24.91% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 342.2s

Stack Uptimes

  • elemental_chaos_fire_1:24.91%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:Grants Critical Strike and damage dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.3sec 100.1sec 58.2sec 25.35% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.4s

Stack Uptimes

  • elemental_chaos_frost_1:25.35%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:Grants Versatility and healing dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 303.6sec 303.6sec 27.2sec 12.90% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.8s
  • trigger_min/max:300.0s / 328.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.90%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 83.0sec 82.8sec 19.6sec 25.89% 0.00% 11.6 (11.6) 3.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 289.9s
  • trigger_min/max:0.0s / 289.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.8s

Stack Uptimes

  • empower_rune_weapon_1:25.89%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 8.0 0.0 37.5sec 37.5sec 12.3sec 32.82% 0.00% 0.0 (0.0) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.0s / 57.0s
  • trigger_min/max:26.0s / 57.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • enduring_strength_1:32.82%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.2 18.5 37.9sec 10.9sec 9.7sec 26.53% 98.43% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:22.1s / 126.4s
  • trigger_min/max:0.9s / 126.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:10.29%
  • enduring_strength_builder_2:8.27%
  • enduring_strength_builder_3:4.82%
  • enduring_strength_builder_4:2.11%
  • enduring_strength_builder_5:0.77%
  • enduring_strength_builder_6:0.23%
  • enduring_strength_builder_7:0.05%
  • enduring_strength_builder_8:0.01%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 12.7 122.8 24.5sec 2.2sec 15.8sec 66.83% 86.84% 71.0 (112.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.1s / 104.3s
  • trigger_min/max:0.9s / 41.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 96.1s

Stack Uptimes

  • gathering_storm_1:2.41%
  • gathering_storm_2:5.53%
  • gathering_storm_3:4.87%
  • gathering_storm_4:3.83%
  • gathering_storm_5:5.18%
  • gathering_storm_6:3.70%
  • gathering_storm_7:3.63%
  • gathering_storm_8:2.85%
  • gathering_storm_9:2.23%
  • gathering_storm_10:32.59%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.0 175.1 145.1sec 1.7sec 289.8sec 97.78% 0.00% 173.1 (173.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:115.5s / 243.2s
  • trigger_min/max:1.0s / 13.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 353.9s

Stack Uptimes

  • icy_talons_1:0.34%
  • icy_talons_2:0.34%
  • icy_talons_3:97.10%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 41.9 19.8 7.1sec 5.7sec 2.2sec 30.78% 48.18% 1.1 (1.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 54.3s
  • trigger_min/max:0.0s / 51.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.2s

Stack Uptimes

  • killing_machine_1:26.76%
  • killing_machine_2:4.02%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.4 0.0 37.5sec 37.5sec 11.8sec 32.82% 35.03% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.0s / 57.0s
  • trigger_min/max:26.0s / 57.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:32.82%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.3 56.1 37.5sec 4.5sec 11.5sec 31.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.7s / 57.0s
  • trigger_min/max:0.9s / 45.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:2.11%
  • pillar_of_frost_bonus_2:2.97%
  • pillar_of_frost_bonus_3:3.36%
  • pillar_of_frost_bonus_4:2.81%
  • pillar_of_frost_bonus_5:3.12%
  • pillar_of_frost_bonus_6:3.15%
  • pillar_of_frost_bonus_7:2.77%
  • pillar_of_frost_bonus_8:2.53%
  • pillar_of_frost_bonus_9:1.89%
  • pillar_of_frost_bonus_10:1.35%
  • pillar_of_frost_bonus_11:1.18%
  • pillar_of_frost_bonus_12:1.06%
  • pillar_of_frost_bonus_13:0.93%
  • pillar_of_frost_bonus_14:0.83%
  • pillar_of_frost_bonus_15:0.59%
  • pillar_of_frost_bonus_16:0.39%
  • pillar_of_frost_bonus_17:0.27%
  • pillar_of_frost_bonus_18:0.20%
  • pillar_of_frost_bonus_19:0.17%
  • pillar_of_frost_bonus_20:0.13%
  • pillar_of_frost_bonus_21:0.06%
  • pillar_of_frost_bonus_22:0.02%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 12.8 2.3 24.4sec 20.5sec 17.5sec 74.74% 0.00% 219.5 (219.5) 12.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 102.6s
  • trigger_min/max:20.0s / 27.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 97.1s

Stack Uptimes

  • remorseless_winter_1:74.74%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 61.7 10.4 4.9sec 4.2sec 1.9sec 39.59% 100.00% 10.4 (10.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 59.1s
  • trigger_min/max:0.0s / 59.1s
  • trigger_pct:63.10%
  • duration_min/max:0.0s / 32.3s

Stack Uptimes

  • rime_1:39.59%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.4 14.0 22.5sec 10.7sec 11.8sec 52.54% 0.00% 14.0 (14.0) 12.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 133.4s
  • trigger_min/max:0.9s / 133.4s
  • trigger_pct:14.98%
  • duration_min/max:0.0s / 86.5s

Stack Uptimes

  • rune_mastery_1:52.54%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.6 23.3sec 14.3sec 10.2sec 43.69% 42.93% 7.6 (7.6) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 84.1s
  • trigger_min/max:0.0s / 59.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.7s

Stack Uptimes

  • rune_of_hysteria_1:43.69%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Ground 0.6 0.1 125.2sec 78.5sec 10.6sec 1.95% 0.00% 0.1 (0.1) 0.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.5s / 262.0s
  • trigger_min/max:1.1s / 260.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 234.5s

Stack Uptimes

  • unholy_ground_1:1.95%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 11.9 35.9sec 14.3sec 23.7sec 66.60% 0.00% 11.9 (11.9) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 182.9s
  • trigger_min/max:0.0s / 60.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.2s

Stack Uptimes

  • unholy_strength_1:66.60%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.0 175.1 145.1sec 1.7sec 289.8sec 97.78% 0.00% 173.1 (173.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:115.5s / 243.2s
  • trigger_min/max:1.0s / 13.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 353.9s

Stack Uptimes

  • unleashed_frenzy_1:0.34%
  • unleashed_frenzy_2:0.34%
  • unleashed_frenzy_3:97.10%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 27.0 10.0 51.0 10.8s 1.3s 153.7s
windfury_totem_extra_attack_oh 22.5 5.0 41.0 12.9s 1.3s 149.7s
Killing Machine spent on Obliterate 50.9 26.0 78.0 5.8s 0.9s 53.2s
Killing Machine: Critical auto attacks 51.3 26.0 78.0 6.1s 1.3s 51.6s
Killing Machine wasted: Critical auto attacks 1.1 0.0 8.0 67.1s 1.3s 331.2s
Rune ready 223.3 162.0 282.0 1.5s 0.0s 13.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.93% 0.00% 9.90% 0.7s 0.0s 9.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Remorseless Winter0.4890.0007.0597.4032.23218.314
Horn of Winter26.9890.000218.961128.45060.200268.024
Death and Decay121.3330.000318.483282.563145.032359.920
Empower Rune Weapon1.4590.00093.9775.7664.002100.193
Abomination Limb0.3110.0002.4270.9330.0004.139
Pillar of Frost1.8960.00014.77915.8616.51135.482
Breath of Sindragosa2.2130.0006.8096.5224.03212.718
Raise Dead0.7850.0002.8592.3411.3005.484

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=438013)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0751.384 / 1.0883.78828.024
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
20.70643.29180.804 / 78.909124.399208.697

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Breath of SindragosaRune11.1310.754.81%0.970.383.43%
Empower Rune WeaponRunic Power19.2088.962.35%4.637.067.35%
Empower Rune WeaponRune19.2019.078.54%0.990.130.68%
Frost FeverRunic Power32.28153.124.05%4.748.265.12%
Horn of WinterRunic Power4.06101.592.69%25.000.000.00%
Horn of WinterRune8.138.133.64%1.000.000.00%
Murderous EfficiencyRune25.4525.4511.40%1.000.000.00%
Rage of the Frozen ChampionRunic Power61.33482.5412.75%7.878.091.65%
Rune RegenerationRune86.5286.5238.75%1.000.000.00%
Rune of HysteriaRunic Power160.18329.118.70%2.0529.158.14%
Runic AttenuationRunic Power71.94346.749.16%4.8212.973.60%
Runic EmpowermentRune73.9273.3532.85%0.990.570.77%
Arcane TorrentRunic Power2.0340.501.07%20.000.000.00%
Death and DecayRunic Power0.626.160.16%10.000.000.00%
Howling BlastRunic Power61.330.010.00%0.000.000.00%
ObliterateRunic Power105.642089.6155.23%19.7823.281.10%
Remorseless WinterRunic Power15.12145.003.83%9.596.244.12%
pet - ghoul
energy_regenEnergy1108.331947.38100.00%1.76171.618.10%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 132.212379.7018.0017.961203.35
Death and DecayRune 0.620.621.001.005222.94
Frost StrikeRunic Power 43.911317.4030.0030.00761.21
Howling BlastRune 61.330.000.000.002044210556.93
ObliterateRune 105.64211.292.003.8612692.75
Remorseless WinterRune 15.1215.121.001.00100007.32
pet - ghoul
ClawEnergy 52.902115.9540.0040.0044.87
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 12.61 12.32 95.1 86.2 0.2 124.0
Rune 6.0 0.74 0.76 0.0 2.2 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 44108.65
Minimum 36413.13
Maximum 53011.28
Spread ( max - min ) 16598.15
Range [ ( max - min ) / 2 * 100% ] 18.82%
Standard Deviation 2190.6163
5th Percentile 40599.84
95th Percentile 47825.79
( 95th Percentile - 5th Percentile ) 7225.96
Mean Distribution
Standard Deviation 25.2967
95.00% Confidence Interval ( 44059.07 - 44158.23 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9476
0.1 Scale Factor Error with Delta=300 40966
0.05 Scale Factor Error with Delta=300 163862
0.01 Scale Factor Error with Delta=300 4096532
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 44108.65
Minimum 36413.13
Maximum 53011.28
Spread ( max - min ) 16598.15
Range [ ( max - min ) / 2 * 100% ] 18.82%
Standard Deviation 2190.6163
5th Percentile 40599.84
95th Percentile 47825.79
( 95th Percentile - 5th Percentile ) 7225.96
Mean Distribution
Standard Deviation 25.2967
95.00% Confidence Interval ( 44059.07 - 44158.23 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9476
0.1 Scale Factor Error with Delta=300 40966
0.05 Scale Factor Error with Delta=300 163862
0.01 Scale Factor Error with Delta=300 4096532
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 44108.65
Minimum 36413.13
Maximum 53011.28
Spread ( max - min ) 16598.15
Range [ ( max - min ) / 2 * 100% ] 18.82%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 12922737.03
Minimum 8890086.72
Maximum 16677019.68
Spread ( max - min ) 7786932.95
Range [ ( max - min ) / 2 * 100% ] 30.13%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
B 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
C 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
D 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
E 0.00 variable,name=2h_check,value=main_hand.2h
Default action list Executed every time the actor is available.
# count action,conditions
F 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=3,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
G 7.43 antimagic_shell,if=runic_power.deficit>40
0.00 antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up&cooldown.empower_rune_weapon.charges<2|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up)
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
H 2.77 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
I 0.00 call_action_list,name=trinkets
Choose Action list to run
J 0.00 call_action_list,name=cooldowns
K 0.00 call_action_list,name=racials
L 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
M 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
N 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
O 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
P 0.00 call_action_list,name=aoe,if=active_enemies>=2
Q 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
R 6.06 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
S 37.28 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
T 3.13 horn_of_winter,if=rune<2&runic_power.deficit>25
U 20.67 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
V 32.79 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
W 0.62 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
X 0.23 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
Y 7.08 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
Z 0.58 howling_blast,if=buff.rime.react
a 0.97 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
b 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
c 0.28 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
d 3.67 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
e 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
f 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
g 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
h 8.03 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
i 2.95 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
j 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
k 9.06 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
l 28.32 frost_strike,if=buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
m 24.21 obliterate,if=buff.killing_machine.react
n 23.24 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
o 4.21 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
p 20.89 obliterate,if=!variable.pooling_runes
q 0.94 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
r 1.06 arcane_torrent,if=runic_power.deficit>20
s 8.61 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
t 2.82 use_item,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
u 2.99 use_item,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABCDEFGufjknmmidhbSVSVSVSVVSUSVSYStURSYSYYSUYTYSYYSYYRhGUSdVVSUSUUUSVYVRSUSUUSVVUYYSYhSURGSUSTUUVSWmnppnHkormlmlnplmlnlufjmklihSSUSGUSSUSUSpnpknHqmlmlnmlplhtplmklmlmlGnplnlmlplsksmnosmnmhomlmlmlkmlnlpnlGmmlnmlsmknlphlnplnplmufjmlniRSUUUSSYSGVSVSTYhVRVdVUSUSVSVStcUUSVSRVSVSVVUSGVSgU

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat B trinket_1_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat C trinket_2_manual PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat D rw_buffs PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat E 2h_check PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
0:00.000 default F auto_attack Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
0:00.000 default G antimagic_shell PR_Death_Knight_Frost 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, elemental_chaos_earth
0:00.000 trinkets u use_item_dragon_games_equipment Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, elemental_chaos_earth
0:00.000 cooldowns f abomination_limb Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, dragon_games_equipment, elemental_chaos_earth
0:01.035 cooldowns j raise_dead Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, abomination_limb, rime, elemental_chaos_earth
0:01.035 single_target k remorseless_winter Fluffy_Pillow 0.0/124: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, abomination_limb, rime, elemental_chaos_earth
0:02.071 single_target n howling_blast Fluffy_Pillow 15.0/124: 12% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, abomination_limb, killing_machine, remorseless_winter, rime, rune_of_hysteria, elemental_chaos_earth
0:03.107 single_target m obliterate Fluffy_Pillow 24.9/124: 20% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, abomination_limb, gathering_storm, killing_machine, remorseless_winter, rune_of_hysteria, elemental_chaos_earth
0:04.145 single_target m obliterate Fluffy_Pillow 55.9/124: 45% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, abomination_limb, gathering_storm(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, rune_of_hysteria, elemental_chaos_earth
0:05.182 cooldowns i breath_of_sindragosa Fluffy_Pillow 80.7/124: 65% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), rune_of_hysteria, elemental_chaos_earth
0:05.182 cooldowns d empower_rune_weapon Fluffy_Pillow 80.7/124: 65% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), rune_of_hysteria, elemental_chaos_earth
0:05.182 cooldowns h pillar_of_frost Fluffy_Pillow 86.9/124: 70% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), rune_of_hysteria, elemental_chaos_earth
0:05.182 cooldowns b potion Fluffy_Pillow 86.9/124: 70% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), rune_of_hysteria, elemental_chaos_earth
0:05.182 breath S howling_blast Fluffy_Pillow 86.9/124: 70% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.084 breath V obliterate Fluffy_Pillow 103.0/124: 83% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, empower_rune_weapon, breath_of_sindragosa, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, bonegrinder_crit(2), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.986 breath S howling_blast Fluffy_Pillow 112.2/124: 90% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons, breath_of_sindragosa, gathering_storm(8), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.888 breath V obliterate Fluffy_Pillow 104.1/124: 84% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(2), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(2), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.789 breath S howling_blast Fluffy_Pillow 112.2/124: 90% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.689 breath V obliterate Fluffy_Pillow 104.1/124: 84% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.590 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.490 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.391 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.291 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.192 breath U obliterate Fluffy_Pillow 106.0/124: 85% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.093 breath S howling_blast Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.996 breath V obliterate Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.896 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(20), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.795 Waiting     0.403 sec 110.3/124: 89% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.198 breath Y obliterate Fluffy_Pillow 92.3/124: 74% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.098 breath S howling_blast Fluffy_Pillow 117.1/124: 94% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.998 Waiting     0.089 sec 106.0/124: 85% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.087 trinkets t use_item_blazebinders_hoof Fluffy_Pillow 112.2/124: 90% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.087 Waiting     0.584 sec 112.2/124: 90% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.671 breath U obliterate Fluffy_Pillow 100.4/124: 81% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.572 breath R remorseless_winter Fluffy_Pillow 112.2/124: 90% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.471 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.371 breath Y obliterate Fluffy_Pillow 96.0/124: 77% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.272 breath S howling_blast Fluffy_Pillow 102.8/124: 83% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.170 Waiting     1.018 sec 112.7/124: 91% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.188 breath Y obliterate Fluffy_Pillow 89.1/124: 72% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.225 breath Y obliterate Fluffy_Pillow 95.9/124: 77% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.259 breath S howling_blast Fluffy_Pillow 102.7/124: 83% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.295 breath U obliterate Fluffy_Pillow 100.8/124: 81% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.331 Waiting     0.861 sec 106.0/124: 85% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:31.192 breath Y obliterate Fluffy_Pillow 88.0/124: 71% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:32.227 breath T horn_of_winter Fluffy_Pillow 95.0/124: 77% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:33.261 Waiting     0.922 sec 106.0/124: 85% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:34.183 breath Y obliterate Fluffy_Pillow 88.0/124: 71% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:35.218 breath S howling_blast Fluffy_Pillow 90.0/124: 73% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth
0:36.254 breath Y obliterate Fluffy_Pillow 85.0/124: 69% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth
0:37.289 breath Y obliterate Fluffy_Pillow 87.0/124: 70% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth
0:38.325 breath S howling_blast Fluffy_Pillow 89.0/124: 72% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth
0:39.363 breath Y obliterate Fluffy_Pillow 84.0/124: 68% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth
0:40.397 breath Y obliterate Fluffy_Pillow 86.0/124: 69% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
0:41.742 breath R remorseless_winter Fluffy_Pillow 94.2/124: 76% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:43.087 cooldowns h pillar_of_frost Fluffy_Pillow 88.6/124: 71% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:43.182 default G antimagic_shell PR_Death_Knight_Frost 70.6/124: 57% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:43.182 Waiting     0.970 sec 70.6/124: 57% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:44.152 breath U obliterate Fluffy_Pillow 76.8/124: 62% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:45.498 breath S howling_blast Fluffy_Pillow 71.8/124: 58% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:46.204 cooldowns d empower_rune_weapon Fluffy_Pillow 63.7/124: 51% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:46.841 breath V obliterate Fluffy_Pillow 76.1/124: 61% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:48.012 breath V obliterate Fluffy_Pillow 89.1/124: 72% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:49.183 breath S howling_blast Fluffy_Pillow 77.9/124: 63% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:50.354 breath U obliterate Fluffy_Pillow 76.0/124: 61% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:51.525 breath S howling_blast Fluffy_Pillow 87.8/124: 71% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth
0:52.696 breath U obliterate Fluffy_Pillow 82.8/124: 67% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth
0:53.867 Waiting     0.405 sec 94.8/124: 76% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_earth
0:54.272 breath U obliterate Fluffy_Pillow 76.8/124: 62% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_earth
0:55.443 Waiting     0.785 sec 83.8/124: 68% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
0:56.228 breath U obliterate Fluffy_Pillow 75.8/124: 61% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
0:57.398 breath S howling_blast Fluffy_Pillow 82.8/124: 67% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:58.568 breath V obliterate Fluffy_Pillow 81.0/124: 65% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:59.738 Waiting     0.203 sec 87.8/124: 71% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:59.941 breath Y obliterate Fluffy_Pillow 87.8/124: 71% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:01.112 Waiting     0.102 sec 94.6/124: 76% runic_power
1.0/6: 17% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:01.214 breath V obliterate Fluffy_Pillow 82.8/124: 67% runic_power
3.0/6: 50% rune
unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:02.345 breath R remorseless_winter Fluffy_Pillow 95.8/124: 77% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:03.476 breath S howling_blast Fluffy_Pillow 90.2/124: 73% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:04.608 breath U obliterate Fluffy_Pillow 82.1/124: 66% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:05.739 breath S howling_blast Fluffy_Pillow 88.9/124: 72% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:06.869 breath U obliterate Fluffy_Pillow 87.0/124: 70% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:08.170 breath U obliterate Fluffy_Pillow 100.0/124: 81% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:09.470 breath S howling_blast Fluffy_Pillow 88.0/124: 71% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:10.770 breath V obliterate Fluffy_Pillow 79.9/124: 64% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:12.070 Waiting     0.114 sec 99.1/124: 80% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_air
1:12.184 breath V obliterate Fluffy_Pillow 81.1/124: 65% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_air
1:13.482 breath U obliterate Fluffy_Pillow 83.1/124: 67% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_air
1:14.782 breath Y obliterate Fluffy_Pillow 91.3/124: 74% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:16.083 breath Y obliterate Fluffy_Pillow 98.1/124: 79% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:17.383 breath S howling_blast Fluffy_Pillow 86.9/124: 70% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:18.684 breath Y obliterate Fluffy_Pillow 85.0/124: 69% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:19.984 cooldowns h pillar_of_frost Fluffy_Pillow 91.8/124: 74% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:19.984 breath S howling_blast Fluffy_Pillow 91.8/124: 74% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:21.284 breath U obliterate Fluffy_Pillow 72.0/124: 58% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:22.585 breath R remorseless_winter Fluffy_Pillow 83.8/124: 68% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_air
1:23.886 default G antimagic_shell PR_Death_Knight_Frost 75.8/124: 61% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_air
1:23.886 breath S howling_blast Fluffy_Pillow 75.8/124: 61% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_air
1:25.185 breath U obliterate Fluffy_Pillow 52.8/124: 43% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_air
1:26.485 breath S howling_blast Fluffy_Pillow 54.8/124: 44% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_air
1:27.785 breath T horn_of_winter Fluffy_Pillow 44.8/124: 36% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_air
1:29.087 breath U obliterate Fluffy_Pillow 51.8/124: 42% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_air
1:30.388 breath U obliterate Fluffy_Pillow 35.8/124: 29% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_air
1:31.689 breath V obliterate Fluffy_Pillow 37.8/124: 30% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), elemental_chaos_air
1:32.990 breath S howling_blast Fluffy_Pillow 44.8/124: 36% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:34.291 breath W death_and_decay Fluffy_Pillow 21.8/124: 18% runic_power
1.0/6: 17% rune
icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:35.592 single_target m obliterate Fluffy_Pillow 13.8/124: 11% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:36.829 single_target n howling_blast Fluffy_Pillow 33.8/124: 27% runic_power
1.0/6: 17% rune
unholy_ground, icy_talons(3), gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:38.067 single_target p obliterate Fluffy_Pillow 41.8/124: 34% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:39.306 single_target p obliterate Fluffy_Pillow 72.8/124: 59% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:40.546 single_target n howling_blast Fluffy_Pillow 97.6/124: 79% runic_power
0.0/6: 0% rune
unholy_ground, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:41.786 default H frost_strike Fluffy_Pillow 113.7/124: 92% runic_power
0.0/6: 0% rune
unholy_ground, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:43.024 single_target k remorseless_winter Fluffy_Pillow 89.9/124: 72% runic_power
1.0/6: 17% rune
unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:44.263 single_target o frost_strike Fluffy_Pillow 102.3/124: 82% runic_power
0.0/6: 0% rune
unholy_ground, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:45.502 single_target r arcane_torrent Fluffy_Pillow 72.3/124: 58% runic_power
1.0/6: 17% rune
unholy_ground, icy_talons(3), killing_machine(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_air
1:46.740 single_target m obliterate Fluffy_Pillow 92.3/124: 74% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), killing_machine(2), remorseless_winter, unleashed_frenzy(3), elemental_chaos_air
1:47.978 single_target l frost_strike Fluffy_Pillow 112.3/124: 91% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_air
1:49.217 single_target m obliterate Fluffy_Pillow 87.3/124: 70% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), gathering_storm(2), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_air
1:50.456 single_target l frost_strike Fluffy_Pillow 118.5/124: 96% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:51.695 single_target n howling_blast Fluffy_Pillow 88.5/124: 71% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(4), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:52.933 single_target p obliterate Fluffy_Pillow 98.4/124: 79% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:54.171 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(7), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:55.409 single_target m obliterate Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:56.646 single_target l frost_strike Fluffy_Pillow 118.8/124: 96% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:57.884 single_target n howling_blast Fluffy_Pillow 95.0/124: 77% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
1:59.123 single_target l frost_strike Fluffy_Pillow 114.9/124: 93% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_air
2:00.360 trinkets u use_item_dragon_games_equipment Fluffy_Pillow 84.9/124: 68% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_fire
2:00.360 cooldowns f abomination_limb Fluffy_Pillow 84.9/124: 68% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), dragon_games_equipment, elemental_chaos_fire
2:01.641 cooldowns j raise_dead Fluffy_Pillow 89.9/124: 73% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_fire
2:01.641 single_target m obliterate Fluffy_Pillow 89.9/124: 73% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_fire
2:02.923 single_target k remorseless_winter Fluffy_Pillow 114.9/124: 93% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
2:04.306 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
2:05.588 cooldowns i breath_of_sindragosa Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
2:05.588 cooldowns h pillar_of_frost Fluffy_Pillow 94.0/124: 76% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
2:05.588 breath S howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
2:06.871 breath S howling_blast Fluffy_Pillow 89.0/124: 72% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine(2), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
2:08.153 breath U obliterate Fluffy_Pillow 84.0/124: 68% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(2), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_fire
2:09.434 breath S howling_blast Fluffy_Pillow 91.0/124: 73% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_fire
2:10.715 default G antimagic_shell PR_Death_Knight_Frost 63.0/124: 51% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_fire
2:10.715 breath U obliterate Fluffy_Pillow 63.0/124: 51% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_fire
2:11.998 breath S howling_blast Fluffy_Pillow 70.0/124: 56% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(7), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_fire
2:13.281 breath S howling_blast Fluffy_Pillow 60.0/124: 48% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_fire
2:14.562 breath U obliterate Fluffy_Pillow 55.0/124: 44% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(9), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_fire
2:15.844 breath S howling_blast Fluffy_Pillow 39.0/124: 31% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_fire
2:17.126 breath U obliterate Fluffy_Pillow 39.0/124: 31% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_fire
2:18.407 breath S howling_blast Fluffy_Pillow 41.0/124: 33% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), breath_of_sindragosa, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
2:19.689 single_target p obliterate Fluffy_Pillow 13.0/124: 10% runic_power
6.0/6: 100% rune
unholy_ground, icy_talons(3), bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
2:20.969 single_target n howling_blast Fluffy_Pillow 33.0/124: 27% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
2:22.251 single_target p obliterate Fluffy_Pillow 41.0/124: 33% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
2:23.533 single_target k remorseless_winter Fluffy_Pillow 61.0/124: 49% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:24.813 single_target n howling_blast Fluffy_Pillow 73.4/124: 59% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:26.093 default H frost_strike Fluffy_Pillow 95.7/124: 77% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm, killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:27.376 single_target q horn_of_winter Fluffy_Pillow 65.7/124: 53% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm, killing_machine(2), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:28.654 single_target m obliterate Fluffy_Pillow 96.7/124: 78% runic_power
5.0/6: 83% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm, killing_machine(2), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:29.935 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:31.215 single_target m obliterate Fluffy_Pillow 100.2/124: 81% runic_power
6.0/6: 100% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:32.497 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
5.0/6: 83% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:33.779 single_target n howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
5.0/6: 83% rune
unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:35.059 single_target m obliterate Fluffy_Pillow 103.9/124: 84% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:36.340 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:37.622 single_target p obliterate Fluffy_Pillow 94.0/124: 76% runic_power
5.0/6: 83% rune
unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:38.903 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:40.183 cooldowns h pillar_of_frost Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:40.183 trinkets t use_item_blazebinders_hoof Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:40.183 single_target p obliterate Fluffy_Pillow 94.0/124: 76% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_fire
2:41.465 single_target l frost_strike Fluffy_Pillow 118.8/124: 96% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_fire
2:42.746 single_target m obliterate Fluffy_Pillow 88.8/124: 72% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_fire
2:44.028 single_target k remorseless_winter Fluffy_Pillow 113.8/124: 92% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_fire
2:45.309 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_fire
2:46.592 single_target m obliterate Fluffy_Pillow 94.0/124: 76% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_fire
2:47.872 single_target l frost_strike Fluffy_Pillow 119.0/124: 96% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
2:49.154 single_target m obliterate Fluffy_Pillow 89.0/124: 72% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
2:50.436 single_target l frost_strike Fluffy_Pillow 113.8/124: 92% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
2:51.718 default G antimagic_shell PR_Death_Knight_Frost 83.8/124: 68% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
2:51.718 single_target n howling_blast Fluffy_Pillow 83.8/124: 68% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_ground, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
2:53.000 single_target p obliterate Fluffy_Pillow 93.7/124: 76% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
2:54.281 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), gathering_storm(7), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
2:55.563 single_target n howling_blast Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), killing_machine, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
2:56.844 single_target l frost_strike Fluffy_Pillow 110.1/124: 89% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
2:58.124 single_target m obliterate Fluffy_Pillow 86.3/124: 70% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
2:59.406 single_target l frost_strike Fluffy_Pillow 117.3/124: 95% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
3:00.688 single_target p obliterate Fluffy_Pillow 87.3/124: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:01.968 single_target l frost_strike Fluffy_Pillow 112.3/124: 91% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:03.250 single_target s frost_strike Fluffy_Pillow 92.3/124: 74% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:04.529 single_target k remorseless_winter Fluffy_Pillow 62.3/124: 50% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:05.812 single_target s frost_strike Fluffy_Pillow 77.3/124: 62% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:07.095 single_target m obliterate Fluffy_Pillow 53.5/124: 43% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:08.375 single_target n howling_blast Fluffy_Pillow 84.5/124: 68% runic_power
0.0/6: 0% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:09.655 single_target o frost_strike Fluffy_Pillow 100.6/124: 81% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:10.936 single_target s frost_strike Fluffy_Pillow 70.6/124: 57% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:12.218 single_target m obliterate Fluffy_Pillow 40.6/124: 33% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:13.500 single_target n howling_blast Fluffy_Pillow 65.4/124: 53% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:14.782 single_target m obliterate Fluffy_Pillow 81.6/124: 66% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(6), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:16.064 cooldowns h pillar_of_frost Fluffy_Pillow 112.6/124: 91% runic_power
1.0/6: 17% rune
unholy_ground, icy_talons(3), gathering_storm(8), killing_machine(2), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:16.064 single_target o frost_strike Fluffy_Pillow 112.6/124: 91% runic_power
1.0/6: 17% rune
unholy_ground, icy_talons(3), gathering_storm(8), killing_machine(2), pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:17.346 single_target m obliterate Fluffy_Pillow 88.8/124: 72% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), killing_machine(2), pillar_of_frost, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:18.627 single_target l frost_strike Fluffy_Pillow 113.6/124: 92% runic_power
1.0/6: 17% rune
unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:19.909 single_target m obliterate Fluffy_Pillow 83.6/124: 67% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:21.191 single_target l frost_strike Fluffy_Pillow 108.4/124: 87% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:22.472 single_target m obliterate Fluffy_Pillow 84.6/124: 68% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:23.753 single_target l frost_strike Fluffy_Pillow 109.4/124: 88% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:25.034 single_target k remorseless_winter Fluffy_Pillow 79.4/124: 64% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:26.316 single_target m obliterate Fluffy_Pillow 98.0/124: 79% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:27.596 single_target l frost_strike Fluffy_Pillow 122.8/124: 99% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:28.877 single_target n howling_blast Fluffy_Pillow 92.8/124: 75% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:30.157 single_target l frost_strike Fluffy_Pillow 108.9/124: 88% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:31.437 single_target p obliterate Fluffy_Pillow 83.9/124: 68% runic_power
5.0/6: 83% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:32.717 single_target n howling_blast Fluffy_Pillow 103.9/124: 84% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:33.998 single_target l frost_strike Fluffy_Pillow 111.9/124: 90% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(6), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:35.282 default G antimagic_shell PR_Death_Knight_Frost 81.9/124: 66% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, icy_talons(3), gathering_storm(6), killing_machine(2), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:35.282 single_target m obliterate Fluffy_Pillow 81.9/124: 66% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), gathering_storm(6), killing_machine(2), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:36.564 single_target m obliterate Fluffy_Pillow 106.9/124: 86% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), gathering_storm(8), killing_machine(2), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:37.845 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:39.126 single_target n howling_blast Fluffy_Pillow 99.0/124: 80% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), killing_machine(2), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:40.407 single_target m obliterate Fluffy_Pillow 112.0/124: 90% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), killing_machine(2), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:41.688 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
3:42.970 single_target s frost_strike Fluffy_Pillow 99.0/124: 80% runic_power
1.0/6: 17% rune
unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_fire
3:44.251 single_target m obliterate Fluffy_Pillow 69.0/124: 56% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_fire
3:45.531 single_target k remorseless_winter Fluffy_Pillow 89.0/124: 72% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), rime, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_fire
3:46.814 single_target n howling_blast Fluffy_Pillow 104.0/124: 84% runic_power
1.0/6: 17% rune
unholy_ground, icy_talons(3), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_fire
3:48.095 single_target l frost_strike Fluffy_Pillow 122.0/124: 98% runic_power
1.0/6: 17% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_fire
3:49.377 single_target p obliterate Fluffy_Pillow 92.0/124: 74% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_fire
3:50.658 cooldowns h pillar_of_frost Fluffy_Pillow 112.0/124: 90% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(3), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_fire
3:50.658 single_target l frost_strike Fluffy_Pillow 112.0/124: 90% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_fire
3:51.939 single_target n howling_blast Fluffy_Pillow 82.0/124: 66% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_fire
3:53.222 single_target p obliterate Fluffy_Pillow 90.0/124: 73% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(4), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_fire
3:54.502 single_target l frost_strike Fluffy_Pillow 116.2/124: 94% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:55.783 single_target n howling_blast Fluffy_Pillow 86.2/124: 70% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:57.066 single_target p obliterate Fluffy_Pillow 96.1/124: 78% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:58.346 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:59.629 single_target m obliterate Fluffy_Pillow 94.0/124: 76% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(6), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:00.912 trinkets u use_item_dragon_games_equipment Fluffy_Pillow 118.8/124: 96% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:00.912 cooldowns f abomination_limb Fluffy_Pillow 118.8/124: 96% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, elemental_chaos_frost
4:02.195 cooldowns j raise_dead Fluffy_Pillow 118.8/124: 96% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:02.195 single_target m obliterate Fluffy_Pillow 118.8/124: 96% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine(2), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:03.476 single_target l frost_strike Fluffy_Pillow 124.0/124: 100% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:04.759 single_target n howling_blast Fluffy_Pillow 100.2/124: 81% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:06.042 cooldowns i breath_of_sindragosa Fluffy_Pillow 115.1/124: 93% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
4:06.042 breath R remorseless_winter Fluffy_Pillow 115.1/124: 93% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
4:07.324 breath S howling_blast Fluffy_Pillow 106.0/124: 85% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
4:08.607 breath U obliterate Fluffy_Pillow 101.0/124: 81% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm, killing_machine(2), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
4:09.888 breath U obliterate Fluffy_Pillow 103.0/124: 83% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
4:11.171 breath U obliterate Fluffy_Pillow 93.2/124: 75% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:12.453 breath S howling_blast Fluffy_Pillow 106.2/124: 86% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, abomination_limb, icy_talons(3), breath_of_sindragosa, gathering_storm(7), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:13.736 breath S howling_blast Fluffy_Pillow 98.1/124: 79% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:15.016 breath Y obliterate Fluffy_Pillow 96.2/124: 78% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(9), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:16.299 breath S howling_blast Fluffy_Pillow 91.2/124: 74% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:17.581 default G antimagic_shell PR_Death_Knight_Frost 83.2/124: 67% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:17.581 breath V obliterate Fluffy_Pillow 83.2/124: 67% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:18.861 breath S howling_blast Fluffy_Pillow 90.0/124: 73% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:20.142 breath V obliterate Fluffy_Pillow 76.3/124: 62% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:21.424 breath S howling_blast Fluffy_Pillow 83.1/124: 67% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:22.705 breath T horn_of_winter Fluffy_Pillow 75.0/124: 60% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:23.986 breath Y obliterate Fluffy_Pillow 88.0/124: 71% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_frost
4:25.267 cooldowns h pillar_of_frost Fluffy_Pillow 72.0/124: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, killing_machine, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:25.267 breath V obliterate Fluffy_Pillow 72.0/124: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, killing_machine, pillar_of_frost, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:26.548 breath R remorseless_winter Fluffy_Pillow 85.0/124: 69% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:27.829 breath V obliterate Fluffy_Pillow 79.4/124: 64% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), breath_of_sindragosa, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:29.112 Waiting     0.997 sec 74.4/124: 60% runic_power
0.0/6: 0% rune
unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:30.109 cooldowns d empower_rune_weapon Fluffy_Pillow 56.4/124: 45% runic_power
1.0/6: 17% rune
unholy_ground, icy_talons(3), breath_of_sindragosa, gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:30.109 breath V obliterate Fluffy_Pillow 62.6/124: 50% runic_power
2.0/6: 33% rune
unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:31.223 Waiting     0.888 sec 75.6/124: 61% runic_power
1.0/6: 17% rune
unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:32.111 breath U obliterate Fluffy_Pillow 57.6/124: 46% runic_power
2.0/6: 33% rune
unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(4), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost
4:33.224 breath S howling_blast Fluffy_Pillow 64.6/124: 52% runic_power
2.0/6: 33% rune
unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), elemental_chaos_frost
4:34.339 breath U obliterate Fluffy_Pillow 54.6/124: 44% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(7), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), elemental_chaos_frost
4:35.452 breath S howling_blast Fluffy_Pillow 61.6/124: 50% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(9), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), elemental_chaos_frost
4:36.566 breath V obliterate Fluffy_Pillow 51.6/124: 42% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), elemental_chaos_frost
4:37.682 breath S howling_blast Fluffy_Pillow 59.8/124: 48% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:38.798 breath V obliterate Fluffy_Pillow 51.7/124: 42% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:39.912 breath S howling_blast Fluffy_Pillow 58.5/124: 47% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:41.026 trinkets t use_item_blazebinders_hoof Fluffy_Pillow 56.6/124: 46% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
4:41.026 cooldowns c empower_rune_weapon Fluffy_Pillow 56.6/124: 46% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost
4:41.026 breath U obliterate Fluffy_Pillow 62.8/124: 51% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine(2), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost
4:42.138 breath U obliterate Fluffy_Pillow 51.6/124: 42% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost
4:43.253 breath S howling_blast Fluffy_Pillow 58.4/124: 47% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost
4:44.367 breath V obliterate Fluffy_Pillow 50.4/124: 41% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost
4:45.482 breath S howling_blast Fluffy_Pillow 67.2/124: 54% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_frost
4:46.594 breath R remorseless_winter Fluffy_Pillow 57.2/124: 46% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_frost
4:47.707 breath V obliterate Fluffy_Pillow 59.2/124: 48% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost
4:48.822 breath S howling_blast Fluffy_Pillow 72.2/124: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost
4:49.934 breath V obliterate Fluffy_Pillow 64.1/124: 52% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost
4:51.049 breath S howling_blast Fluffy_Pillow 71.5/124: 58% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_frost
4:52.163 breath V obliterate Fluffy_Pillow 63.4/124: 51% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(6), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_frost
4:53.277 breath V obliterate Fluffy_Pillow 70.2/124: 57% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(8), remorseless_winter, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_frost
4:54.392 Waiting     0.782 sec 83.2/124: 67% runic_power
0.0/6: 0% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_frost
4:55.174 breath U obliterate Fluffy_Pillow 70.2/124: 57% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_frost
4:56.289 breath S howling_blast Fluffy_Pillow 77.2/124: 62% runic_power
1.0/6: 17% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_frost
4:57.404 default G antimagic_shell PR_Death_Knight_Frost 72.2/124: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_frost
4:57.581 breath V obliterate Fluffy_Pillow 72.2/124: 58% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_frost
4:58.694 breath S howling_blast Fluffy_Pillow 79.2/124: 64% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_frost
4:59.809 cooldowns g pillar_of_frost Fluffy_Pillow 69.2/124: 56% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_frost
4:59.809 breath U obliterate Fluffy_Pillow 69.2/124: 56% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), breath_of_sindragosa, gathering_storm(10), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_frost

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5770 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3463 0 13076 12453 6915
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 261520 249060 0
Runic Power 124 124 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 28.26% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 6058 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +687 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +89 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +386 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAkIJJkISEhIJhQiIRECIhkIJJJJJplAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=3,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=runic_power.deficit>40
actions+=/antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up&cooldown.empower_rune_weapon.charges<2|!talent.breath_of_sindragosa&!buff.pillar_of_frost.up)
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<3&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(talent.obliteration&(buff.pillar_of_frost.up&!buff.killing_machine.react|!buff.pillar_of_frost.up)|talent.breath_of_sindragosa&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up)|!talent.breath_of_sindragosa&!talent.obliteration)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5&buff.pillar_of_frost.remains<11|!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>10|fight_remains<11)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/howling_blast,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&buff.rime.react
actions.obliteration+=/frost_strike,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd
actions.obliteration+=/glacial_advance,if=buff.killing_machine.stack<2&buff.pillar_of_frost.remains<gcd&!death_and_decay.ticking
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!death_knight.runeforge.razorice&!buff.killing_machine.react&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(rune<2|variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frost_strike,if=buff.killing_machine.stack<2&runic_power.deficit<20&!variable.2h_check
actions.single_target+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

actions.trinkets=use_item,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=6915
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 46565 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
46565.0 46565.0 45.8 / 0.098% 7383.5 / 15.9% 2714.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.9 8.0 Runic Power 2.04% 54.9 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 46565
Apocalypse 208 0.4% 6.9 45.94sec 9084 7590 Direct 6.9 7827 15711 9084 15.9%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.00 1.1968 0.0000 62510.84 62510.84 0.00% 7589.95 7589.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.06% 5.78 1 8 7827.11 6139 10788 7822.18 6686 8906 45275 45275 0.00%
crit 15.94% 1.10 0 5 15710.75 12523 21033 11059.89 0 20207 17236 17236 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [R]:5.88
  • if_expr:variable.st_planning&debuff.festering_wound.stack>=4
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [V]:1.00
  • if_expr:debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
auto_attack_mh 2826 6.1% 156.0 2.31sec 5430 2363 Direct 156.0 4661 9373 5430 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 156.02 156.02 0.00 0.00 0.00 2.2979 0.0000 847160.76 1210260.52 30.00% 2362.96 2362.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.68% 130.55 91 171 4660.80 3725 6659 4660.17 4450 4884 608487 869290 30.00%
crit 16.32% 25.46 8 46 9373.31 7451 13319 9370.92 8492 10565 238674 340971 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Draw 90 0.2% 2.0 179.81sec 13253 0 Direct 2.0 11335 22801 13253 16.7%

Stats Details: Blood Draw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 26510.48 26510.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.27% 1.67 0 2 11334.60 10112 15071 11017.47 0 15071 18879 18879 0.00%
crit 16.73% 0.33 0 2 22801.06 20224 30141 7005.47 0 30141 7632 7632 0.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies. Can only occur every {$374609d=180 seconds}.}
Clawing Shadows 4309 9.3% 74.1 3.92sec 17431 15436 Direct 74.1 14981 30101 17431 16.2%

Stats Details: Clawing Shadows

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 74.08 74.08 0.00 0.00 0.00 1.1293 0.0000 1291380.83 1291380.83 0.00% 15435.88 15435.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.80% 62.08 40 86 14981.19 7664 28316 14996.31 13094 17245 930010 930010 0.00%
crit 16.20% 12.01 2 25 30101.12 15836 55829 30129.32 19769 45239 361371 361371 0.00%

Action Details: Clawing Shadows

  • id:207311
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207311
  • name:Clawing Shadows
  • school:shadow
  • tooltip:
  • description:Deals {$s2=0} Shadow damage and causes 1 Festering Wound to burst.

Action Priority List

    generic
    [e]:74.08
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
Dark Transformation 195 0.4% 7.0 45.90sec 8393 6667 Direct 7.0 7204 14465 8393 16.4%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 1.2589 0.0000 58555.53 58555.53 0.00% 6666.92 6666.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.64% 5.84 1 8 7204.29 5701 9796 7196.74 6182 8167 42039 42039 0.00%
crit 16.36% 1.14 0 6 14465.07 11963 18971 10231.84 0 18625 16516 16516 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [Q]:5.98
  • if_expr:cooldown.apocalypse.remains<5
    garg_setup
    [Z]:1.00
  • if_expr:talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
Death and Decay 240 0.5% 8.5 36.88sec 8482 7707 Direct 92.0 673 1352 784 16.3%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.50 92.01 0.00 0.00 0.00 1.1006 0.0000 72090.01 72090.01 0.00% 7706.86 7706.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.71% 77.02 49 107 672.90 442 1073 673.49 612 741 51824 51824 0.00%
crit 16.29% 14.99 2 32 1351.71 929 2147 1352.93 1100 1710 20266 20266 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    garg_setup
    [a]:1.00
  • if_expr:!death_and_decay.ticking&debuff.festering_wound.stack>0
    generic
    [d]:7.50
  • if_expr:!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
Death Coil 4632 (5997) 10.0% (12.9%) 100.4 2.96sec 17897 15604 Direct 100.3 (237.2) 11879 23856 13828 16.3% (16.3%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 100.37 100.31 0.00 0.00 0.00 1.1469 0.0000 1387149.18 1387149.18 0.00% 15604.20 15604.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.72% 83.98 58 115 11878.63 7653 19701 11887.12 11132 12695 997602 997602 0.00%
crit 16.28% 16.33 4 35 23855.94 15586 39030 23868.69 19463 28573 389547 389547 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    generic
    [c]:93.40
  • if_expr:!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
    high_prio_actions
    [i]:6.96
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
    Coil of Devastation 1366 2.9% 0.0 0.00sec 0 0 Periodic 136.9 2988 0 2988 0.0% 91.3%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 136.91 136.91 85.75 0.0000 2.0000 409081.65 409081.65 0.00% 1493.99 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 136.91 105 172 2987.95 1148 13908 2993.27 2539 3682 409082 409082 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 897 1.9% 6.9 29.08sec 39197 0 Direct 6.9 33623 67609 39230 16.5%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.88 6.87 0.00 0.00 0.00 0.0000 0.0000 269648.54 385222.02 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.50% 5.74 1 9 33622.68 33373 34365 33621.97 33373 34365 192988 275704 30.00%
crit 16.50% 1.13 0 6 67609.32 66746 68730 46729.34 0 68730 76661 109518 20.74%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1070 2.3% 25.1 11.99sec 12817 10779 Direct 25.1 11003 22128 12817 16.3%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.06 25.06 0.00 0.00 0.00 1.1891 0.0000 321167.61 458822.58 30.00% 10778.88 10778.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.70% 20.97 8 34 11003.20 8211 17872 10994.47 9831 12116 230782 329697 30.00%
crit 16.30% 4.08 0 12 22128.32 16421 35220 21853.70 0 30940 90386 129126 29.65%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [b]:1.00
  • if_expr:debuff.festering_wound.stack=0|!talent.apocalypse
    generic
    [f]:24.06
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1724 3.7% 101.6 3.63sec 5088 0 Direct 101.6 4371 8779 5088 16.3%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 101.61 101.61 0.00 0.00 0.00 0.0000 0.0000 516987.78 516987.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.74% 85.09 56 120 4371.14 3050 7607 4371.77 4074 4657 371920 371920 0.00%
crit 16.26% 16.52 2 35 8778.96 6222 15161 8780.10 7289 10993 145068 145068 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 79 0.2% 11.6 27.00sec 2045 1756 Direct 11.6 1755 3528 2045 16.3%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.1647 0.0000 23773.16 23773.16 0.00% 1755.90 1755.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.65% 9.72 3 14 1755.16 1325 2895 1755.64 1478 2031 17068 17068 0.00%
crit 16.35% 1.90 0 8 3528.25 2674 5789 3070.49 0 5789 6705 6705 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    high_prio_actions
    [j]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
Soul Reaper 489 (2835) 1.1% (6.1%) 15.8 6.80sec 54034 44799 Direct 15.8 (31.5) 7993 16072 9307 16.3% (16.3%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.76 15.76 0.00 0.00 0.00 1.2062 0.0000 146658.84 146658.84 0.00% 44799.16 44799.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.73% 13.19 5 19 7992.53 5001 11923 8007.79 6961 9082 105452 105452 0.00%
crit 16.27% 2.56 0 9 16071.82 10002 23875 15028.78 0 23088 41207 41207 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [U]:15.76
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
    Soul Reaper (_execute) 2347 5.1% 15.8 6.80sec 44737 0 Direct 15.8 38389 77185 44737 16.4%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.75 15.75 0.00 0.00 0.00 0.0000 0.0000 704794.01 704794.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.64% 13.18 6 19 38389.06 27722 54326 38443.58 34401 43330 505824 505824 0.00%
crit 16.36% 2.58 0 10 77184.52 60385 108651 72315.14 0 107111 198970 198970 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 191 0.4% 3.6 91.53sec 15738 13559 Direct 3.6 13535 27288 15739 16.0%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.65 3.65 0.00 0.00 0.00 1.1608 0.0000 57379.83 57379.83 0.00% 13558.56 13558.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.98% 3.06 0 4 13535.48 11318 16955 13513.34 0 16955 41446 41446 0.00%
crit 16.02% 0.58 0 4 27287.59 22636 33911 12801.01 0 33911 15934 15934 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [T]:3.32
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
    garg_setup
    [Y]:0.33
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=21
Virulent Plague 839 1.8% 11.6 27.00sec 21644 0 Periodic 99.5 2172 4365 2529 16.3% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.50 99.50 10.62 0.0000 3.0000 251609.42 251609.42 0.00% 842.94 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.73% 83.31 56 110 2172.06 1535 3880 2172.27 2036 2299 180957 180957 0.00%
crit 16.27% 16.19 4 36 4365.06 3192 7656 4364.99 3760 5098 70652 70652 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 5868 / 5868
Claw 298 0.6% 37.8 7.86sec 2375 2365 Direct 37.8 2044 4083 2375 16.2%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.77 37.77 0.00 0.00 0.00 1.0045 0.0000 89720.48 128175.38 30.00% 2364.55 2364.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.76% 31.64 17 47 2043.99 1654 7183 2041.71 1872 2248 64673 92392 30.00%
crit 16.24% 6.13 0 16 4083.06 3308 13263 4075.15 0 5833 25048 35783 29.97%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:37.77
  • if_expr:energy>70
Gnaw 0 0.0% 0.3 90.12sec 83 82 Direct 0.3 72 143 83 16.1%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.31 0.31 0.00 0.00 0.00 1.0178 0.0000 26.14 37.35 30.00% 81.96 81.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.88% 0.26 0 3 71.71 58 225 14.75 0 150 19 27 6.17%
crit 16.12% 0.05 0 2 142.87 117 172 6.84 0 172 7 10 1.44%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:0.31
main_hand 4199 9.0% 196.4 1.52sec 6399 4221 Direct 196.4 5506 10989 6399 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 196.37 196.37 0.00 0.00 0.00 1.5159 0.0000 1256592.26 1795177.57 30.00% 4221.21 4221.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.71% 164.38 120 214 5505.61 1838 12800 5515.73 4977 6173 904993 1292880 30.00%
crit 16.29% 31.99 13 59 10989.09 3676 25256 11013.59 7369 14825 351599 502297 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Monstrous Blow 29 0.1% 3.4 91.36sec 2574 2563 Direct 3.4 2217 4436 2574 16.1%

Stats Details: Monstrous Blow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.35 3.35 0.00 0.00 0.00 1.0045 0.0000 8627.54 12325.37 30.00% 2563.14 2563.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.90% 2.81 0 4 2217.38 1842 2787 2206.45 0 2778 6235 8907 29.81%
crit 16.10% 0.54 0 4 4435.56 3685 5557 1939.48 0 5557 2393 3418 13.11%

Action Details: Monstrous Blow

  • id:91797
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91797
  • name:Monstrous Blow
  • school:physical
  • tooltip:Stunned.
  • description:Strike an enemy with a smashing attack, dealing {$s2=0} Physical damage and stunning for {$d=2 seconds}.

Action Priority List

    default
    [ ]:3.35
Sweeping Claws 1341 2.9% 70.3 4.17sec 5707 5681 Direct 70.3 4912 9804 5707 16.2%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 70.27 70.27 0.00 0.00 0.00 1.0045 0.0000 401031.40 401031.40 0.00% 5681.46 5681.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.76% 58.86 40 79 4912.43 3545 8229 4915.99 4507 5286 289130 289130 0.00%
crit 16.24% 11.41 2 27 9804.07 7090 16236 9818.49 8011 12968 111901 111901 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:70.27
pet - gargoyle 32659 / 5512
Gargoyle Strike 32659 11.7% 41.3 5.08sec 39563 37814 Direct 41.3 34015 68079 39562 16.3%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.28 41.28 0.00 0.00 0.00 1.0463 0.0000 1632972.62 1632972.62 0.00% 37814.30 37814.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.71% 34.55 25 41 34014.63 7853 76817 34014.78 27997 41275 1175316 1175316 0.00%
crit 16.29% 6.72 0 16 68079.43 15707 154337 68103.04 0 132026 457657 457657 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.

Action Priority List

    default
    [ ]:43.28
pet - army_ghoul 25264 / 5588
Claw 4031 1.9% 218.4 0.98sec 1209 1209 Direct 218.4 1040 2079 1209 16.2%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 218.38 218.38 0.00 0.00 0.00 1.0000 0.0000 264051.15 377225.54 30.00% 1209.16 1209.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.75% 182.89 151 210 1040.43 482 1511 1040.29 890 1122 190285 271843 30.00%
crit 16.25% 35.48 14 59 2078.88 964 3023 2079.52 1676 2399 73766 105383 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:27.30
    default
    [ ]:27.29
    default
    [ ]:27.30
    default
    [ ]:27.30
    default
    [ ]:27.30
    default
    [ ]:27.32
    default
    [ ]:27.28
    default
    [ ]:27.28
main_hand 21232 10.0% 366.6 0.59sec 3794 3521 Direct 366.6 3263 6519 3794 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 366.57 366.57 0.00 0.00 0.00 1.0775 0.0000 1390685.84 1986744.71 30.00% 3521.08 3521.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.69% 306.80 250 344 3262.86 1443 4523 3262.21 2771 3501 1001030 1430080 30.00%
crit 16.31% 59.77 29 92 6518.93 2886 9046 6521.45 5201 7302 389655 556665 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - magus_of_the_dead 7855 / 3989
Frostbolt 1499 1.6% 28.0 10.69sec 8116 5699 Direct 28.0 6985 13969 8119 16.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.01 28.00 0.00 0.00 0.00 1.4242 0.0000 227340.32 227340.32 0.00% 5698.90 5698.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.75% 23.45 14 32 6984.65 3694 11107 6986.72 6226 7708 163797 163797 0.00%
crit 16.25% 4.55 0 13 13969.13 7387 22215 13906.27 0 21589 63543 63543 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:14.09
    default
    [ ]:14.02
Shadow Bolt 6356 6.9% 114.4 2.54sec 8404 6691 Direct 114.4 7232 14448 8407 16.3%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 114.43 114.40 0.00 0.00 0.00 1.2560 0.0000 961710.64 961710.64 0.00% 6691.37 6691.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.73% 95.78 71 124 7232.36 3474 10886 7236.81 6605 7868 692734 692734 0.00%
crit 16.27% 18.62 6 36 14448.13 6947 21696 14463.05 11963 17459 268977 268977 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:61.72
    default
    [ ]:61.49
pet - apoc_ghoul 9241 / 4106
Claw 1715 1.6% 204.8 1.37sec 1113 1113 Direct 204.8 958 1915 1114 16.2%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 204.79 204.79 0.00 0.00 0.00 1.0000 0.0000 228025.90 325759.60 30.00% 1113.49 1113.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.76% 171.54 121 224 958.19 537 1511 959.57 872 1043 164363 234811 30.00%
crit 16.24% 33.25 11 60 1914.70 1074 3023 1917.57 1662 2245 63662 90949 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:51.20
    default
    [ ]:51.19
    default
    [ ]:51.19
    default
    [ ]:51.20
main_hand 7526 7.2% 293.6 0.95sec 3408 2545 Direct 293.6 2933 5858 3408 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 293.58 293.58 0.00 0.00 0.00 1.3391 0.0000 1000500.79 1429323.28 30.00% 2545.03 2545.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.75% 245.87 176 318 2932.53 1607 4523 2936.83 2649 3199 721024 1030061 30.00%
crit 16.25% 47.71 19 82 5858.20 3214 9046 5867.82 5144 6762 279476 399262 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 183.20sec

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.2383 1.2383 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
Anti-Magic Shell 7.1 44.32sec

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 7.11 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [E]:7.11
  • if_expr:runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
Army of the Dead 2.0 175.69sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6566 0.4688 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    high_prio_actions
    [h]:1.00
  • if_expr:talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 183.81sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [k]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 169.26sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.39 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [S]:2.06
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
    garg_setup
    [X]:0.33
  • if_expr:pet.gargoyle.active&pet.gargoyle.remains<=21
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    high_prio_actions
    [g]:1.50
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Summon Gargoyle 2.0 184.38sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [P]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead
    garg_setup
    [W]:1.00
  • if_expr:buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
Unholy Strength 22.1 13.28sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 22.08 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 183.8sec 183.8sec 20.0sec 13.52% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3273.11
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3273.11

Trigger Details

  • interval_min/max:181.3s / 188.2s
  • trigger_min/max:181.3s / 188.2s
  • trigger_pct:100.00%
  • duration_min/max:20.0s / 20.0s

Stack Uptimes

  • algethar_puzzle_1:13.52%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 7.1 0.0 44.3sec 44.3sec 6.9sec 16.47% 0.00% 0.0 (0.0) 7.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 109.0s
  • trigger_min/max:40.0s / 109.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s

Stack Uptimes

  • antimagic_shell_1:16.47%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 183.8sec 183.8sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 188.8s
  • trigger_min/max:180.0s / 188.8s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Commander of the Dead 7.0 0.0 45.9sec 45.9sec 28.6sec 66.56% 93.90% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 57.5s
  • trigger_min/max:45.0s / 57.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:66.56%

Spelldata

  • id:390260
  • name:Commander of the Dead
  • tooltip:Your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead ghouls deal {$390264s1=35}% increased damage.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dark Transformation 7.0 0.0 45.9sec 45.9sec 22.6sec 52.65% 59.70% 0.0 (0.0) 6.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 57.5s
  • trigger_min/max:45.0s / 57.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.0s

Stack Uptimes

  • dark_transformation_1:52.65%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.0sec 120.0sec 0.7sec 0.68% 0.00% 6.9 (6.9) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.85
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.2s
  • trigger_min/max:120.0s / 120.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 0.8s

Stack Uptimes

  • dragon_games_equipment_1:0.68%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 121.2sec 96.7sec 57.9sec 25.10% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 340.4s

Stack Uptimes

  • elemental_chaos_air_1:25.10%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:Grants Haste and movement speed is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.3sec 99.2sec 58.0sec 24.94% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:24.94%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:Grants Mastery and damage taken reduced.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 123.0sec 98.7sec 58.1sec 25.03% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 306.3s

Stack Uptimes

  • elemental_chaos_fire_1:25.03%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:Grants Critical Strike and damage dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 125.5sec 100.4sec 58.0sec 24.94% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 337.2s

Stack Uptimes

  • elemental_chaos_frost_1:24.94%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:Grants Versatility and healing dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 300.5sec 0.0sec 27.5sec 13.46% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 330.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.46%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 169.2sec 169.2sec 19.3sec 15.28% 0.00% 6.9 (6.9) 2.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 189.6s
  • trigger_min/max:120.0s / 189.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.28%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.2 67.7 23.0sec 3.6sec 19.3sec 84.96% 0.00% 0.0 (0.0) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 42.0s
  • trigger_min/max:0.8s / 27.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:7.57%
  • festermight_2:8.04%
  • festermight_3:8.65%
  • festermight_4:16.09%
  • festermight_5:10.89%
  • festermight_6:10.25%
  • festermight_7:8.11%
  • festermight_8:5.73%
  • festermight_9:4.23%
  • festermight_10:2.59%
  • festermight_11:1.28%
  • festermight_12:0.72%
  • festermight_13:0.47%
  • festermight_14:0.27%
  • festermight_15:0.06%
  • festermight_16:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 100.4 157.8sec 3.0sec 297.8sec 100.00% 0.00% 98.3 (98.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.7s / 334.7s
  • trigger_min/max:0.8s / 15.0s
  • trigger_pct:100.00%
  • duration_min/max:1.8s / 360.0s

Stack Uptimes

  • icy_talons_1:1.36%
  • icy_talons_2:0.33%
  • icy_talons_3:98.30%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 12.2 8.4 24.5sec 14.1sec 10.7sec 43.22% 0.00% 8.4 (8.4) 11.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 159.0s
  • trigger_min/max:0.8s / 159.0s
  • trigger_pct:14.99%
  • duration_min/max:0.0s / 64.5s

Stack Uptimes

  • rune_mastery_1:43.22%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 42.3 5.9 7.0sec 6.1sec 2.6sec 36.23% 0.00% 5.9 (5.9) 41.9

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 61.7s
  • trigger_min/max:0.8s / 61.7s
  • trigger_pct:47.51%
  • duration_min/max:0.0s / 21.1s

Stack Uptimes

  • runic_corruption_1:36.23%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 21.3 0.2 13.7sec 13.6sec 1.0sec 6.77% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.3s / 55.9s
  • trigger_min/max:1.3s / 55.9s
  • trigger_pct:14.20%
  • duration_min/max:0.0s / 7.1s

Stack Uptimes

  • sudden_doom_1:6.77%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.5sec 91.5sec 19.5sec 23.74% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 98.9s
  • trigger_min/max:90.0s / 98.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • unholy_assault_1:23.74%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Ground 8.1 0.4 39.2sec 36.9sec 10.9sec 29.18% 0.00% 0.4 (0.4) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:10.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.5s / 101.9s
  • trigger_min/max:10.0s / 96.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.3s

Stack Uptimes

  • unholy_ground_1:29.18%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 13.6 36.1sec 13.3sec 24.8sec 69.93% 0.00% 13.6 (13.6) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 210.0s
  • trigger_min/max:0.0s / 57.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 194.1s

Stack Uptimes

  • unholy_strength_1:69.93%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 183.4sec 183.4sec 24.5sec 98.06% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 190.7s
  • trigger_min/max:180.8s / 190.7s
  • trigger_pct:100.00%
  • duration_min/max:20.8s / 25.0s

Stack Uptimes

  • dark_empowerment_1:98.06%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 25.9 9.0 49.0 11.3s 1.3s 142.7s
Rune ready 159.2 120.0 205.0 1.9s 0.0s 13.3s
Runic Corruption from Runic Power Spent 48.2 24.0 73.0 6.1s 0.8s 61.7s
Festering Wound from Festering Strike 62.7 41.0 91.0 12.0s 1.1s 72.3s
Festering Wound from Infected Claws 32.4 13.0 54.0 9.1s 1.0s 101.8s
Festering Wound from Unholy Assault 14.6 12.0 16.0 91.5s 90.0s 98.9s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.80% 0.00% 16.76% 2.0s 0.0s 20.9s
ghoul - Energy Cap 0.56% 0.18% 1.60% 0.2s 0.0s 1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Raise Dead0.0000.0000.000300.000240.008359.984
Army of the Dead3.9040.000141.3077.8100.000141.307
Summon Gargoyle3.7141.7309.0767.4284.79012.136
Apocalypse1.9250.00011.74713.2948.17725.514
Unholy Assault3.3200.0008.91012.1077.24718.145
Dark Transformation1.2140.00012.5198.4794.04121.090
Empower Rune Weapon31.9530.00069.56776.26969.247100.096
Death and Decay6.6450.00060.76158.32433.539124.129
Soul Reaper12.8950.000233.312205.534162.104251.856

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=311206)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0971.914 / 1.0336.67725.757
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
34.56856.38679.408 / 78.243106.529156.692

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
ApocalypseRune13.7612.567.89%0.911.208.72%
Empower Rune WeaponRunic Power11.4456.882.37%4.970.340.60%
Empower Rune WeaponRune11.4410.136.36%0.891.3111.47%
Festering WoundRunic Power101.61297.7712.42%2.937.052.31%
Rune RegenerationRune136.48136.4885.74%1.000.000.00%
Runic AttenuationRunic Power76.20371.1315.48%4.879.862.59%
Army of the DeadRunic Power2.0019.850.83%9.930.150.74%
Clawing ShadowsRunic Power74.08725.9130.27%9.8014.932.02%
Death and DecayRunic Power8.5083.703.49%9.851.301.53%
Festering StrikeRunic Power25.06485.1120.23%19.3616.073.21%
OutbreakRunic Power11.62113.034.71%9.723.222.77%
Soul ReaperRunic Power15.76150.926.29%9.586.654.22%
Summon GargoyleRunic Power2.0093.623.90%46.816.386.38%
pet - ghoul
Dark TransformationEnergy6.98353.708.31%50.69344.0149.31%
energy_regenEnergy1352.783900.9591.69%2.8856.891.44%
pet - army_ghoul
energy_regenEnergy920.867426.15100.00%8.06940.1511.24%
pet - apoc_ghoul
energy_regenEnergy752.115886.58100.00%7.831785.7623.28%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.001.000.00
Clawing ShadowsRune 74.0874.081.001.0017431.37
Death and DecayRune 8.508.501.001.008481.38
Death CoilRunic Power 100.372372.4323.6423.64757.13
Festering StrikeRune 25.0650.122.002.006408.25
OutbreakRune 11.6211.621.001.002045.03
Soul ReaperRune 15.7615.761.001.0054033.86
pet - ghoul
ClawEnergy 37.771510.9640.0040.0059.38
Sweeping ClawsEnergy 70.272810.8640.0040.00142.67
pet - army_ghoul
ClawEnergy 218.388735.0240.0040.0030.23
pet - apoc_ghoul
ClawEnergy 204.798191.4640.0040.0027.84
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 8.0 7.99 7.91 66.0 23.5 0.0 65.0
Rune 5.0 0.53 0.54 0.0 3.1 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 46564.99
Minimum 41025.20
Maximum 53143.57
Spread ( max - min ) 12118.37
Range [ ( max - min ) / 2 * 100% ] 13.01%
Standard Deviation 2025.6206
5th Percentile 43613.93
95th Percentile 50136.32
( 95th Percentile - 5th Percentile ) 6522.39
Mean Distribution
Standard Deviation 23.3914
95.00% Confidence Interval ( 46519.14 - 46610.83 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7270
0.1 Scale Factor Error with Delta=300 35027
0.05 Scale Factor Error with Delta=300 140108
0.01 Scale Factor Error with Delta=300 3502676
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 46564.99
Minimum 41025.20
Maximum 53143.57
Spread ( max - min ) 12118.37
Range [ ( max - min ) / 2 * 100% ] 13.01%
Standard Deviation 2025.6206
5th Percentile 43613.93
95th Percentile 50136.32
( 95th Percentile - 5th Percentile ) 6522.39
Mean Distribution
Standard Deviation 23.3914
95.00% Confidence Interval ( 46519.14 - 46610.83 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7270
0.1 Scale Factor Error with Delta=300 35027
0.05 Scale Factor Error with Delta=300 140108
0.01 Scale Factor Error with Delta=300 3502676
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 46564.99
Minimum 41025.20
Maximum 53143.57
Spread ( max - min ) 12118.37
Range [ ( max - min ) / 2 * 100% ] 13.01%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 6446458.47
Minimum 4817680.70
Maximum 8142872.03
Spread ( max - min ) 3325191.33
Range [ ( max - min ) / 2 * 100% ] 25.79%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
D 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
E 7.11 antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
0.00 variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
Variables
0.00 variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle|time>20
0.00 variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
0.00 variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4)|fight_remains<5&debuff.festering_wound.stack>=1
0.00 variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=20|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))|fight_remains<=21
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
F 0.00 call_action_list,name=high_prio_actions
Call Action Lists
G 0.00 run_action_list,name=garg_setup,if=variable.garg_setup=0
H 0.00 call_action_list,name=cooldowns,if=variable.st_planning
I 0.00 call_action_list,name=aoe_cooldowns,if=variable.adds_remain
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=racials
L 0.00 call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
M 0.00 call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
N 0.00 call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
O 0.00 call_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
P 1.00 summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
ST/Cleave Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
Q 5.98 dark_transformation,if=cooldown.apocalypse.remains<5
R 5.88 apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
S 2.06 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 abomination_limb,if=rune<3&variable.st_planning
T 3.32 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
U 15.76 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.garg_setup
# count action,conditions
V 1.00 apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
Garg Setup
0.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
W 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
X 0.33 empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=21
Y 0.33 unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=21
0.00 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
Z 1.00 dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
a 1.00 any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>0
b 1.00 festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse
0.00 death_coil,if=rune<=1
actions.generic
# count action,conditions
c 93.40 death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
Generic
0.00 epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
d 7.50 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
e 74.08 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
f 24.06 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.high_prio_actions
# count action,conditions
g 1.50 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Priority Actions
h 1.00 army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
i 6.96 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
j 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
k 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
l 2.00 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
m 2.75 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

Sample Sequence

012456789ABCDgjbaZWiiEiVSTlccecdceeckeecfcjeceececefccemceeefccceeecfccEjfQccRdeecfcececefcccjeeceefceceEccfceQcfRTjdceceeeecefcccecefcecefEjcceefcccQecRdefcmceeejccceeccfceceecfccfcjhcQPiiiRlSTUcccEcdUkceeceeUcccjecUececUeeceUfccfQUccjERUdeccUeceeUfcccUecejUcemecUeceEQUccTRUdecjeUcceccfec

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 5 army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat C trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
0:00.000 default D auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
0:00.000 high_prio_actions g potion Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, icy_talons, elemental_chaos_earth
0:00.000 high_prio_actions j outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, icy_talons, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:01.021 garg_setup b festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, icy_talons, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.043 garg_setup a death_and_decay Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.062 garg_setup Z dark_transformation Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.062 garg_setup W summon_gargoyle Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons, dark_transformation, commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.034 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons, dark_transformation, commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.007 high_prio_actions i death_coil Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(2), dark_transformation, commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.979 default E antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.979 high_prio_actions i death_coil Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.952 Waiting     0.178 sec 15.0/100: 15% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.130 garg_setup V apocalypse Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.101 cooldowns S empower_rune_weapon Fluffy_Pillow 27.0/100: 27% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.101 cooldowns T unholy_assault Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, festermight(4), commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.101 trinkets l use_item_algethar_puzzle_box Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.040 generic c death_coil Fluffy_Pillow 37.0/100: 37% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.794 generic c death_coil Fluffy_Pillow 12.0/100: 12% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.549 generic e clawing_shadows Fluffy_Pillow 12.0/100: 12% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.304 generic c death_coil Fluffy_Pillow 25.0/100: 25% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.061 generic d death_and_decay Fluffy_Pillow 25.0/100: 25% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.815 generic c death_coil Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
bloodlust, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.569 generic e clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.324 generic e clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.079 generic c death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.833 racials k berserking Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.833 generic e clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.588 generic e clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.343 generic c death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.098 generic f festering_strike Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.854 generic c death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.607 high_prio_actions j outbreak Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.360 generic e clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.114 generic c death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.870 generic e clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.624 generic e clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.378 generic c death_coil Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.131 generic e clawing_shadows Fluffy_Pillow 16.0/100: 16% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.886 generic c death_coil Fluffy_Pillow 34.0/100: 34% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.640 generic e clawing_shadows Fluffy_Pillow 4.0/100: 4% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.395 generic f festering_strike Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.149 generic c death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.905 generic c death_coil Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.660 generic e clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.102 trinkets m use_item_dragon_games_equipment Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.681 generic c death_coil Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, festermight, commander_of_the_dead, dragon_games_equipment, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.703 generic e clawing_shadows Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, elemental_chaos_earth
0:31.724 generic e clawing_shadows Fluffy_Pillow 58.0/100: 58% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2), commander_of_the_dead, elemental_chaos_earth
0:32.744 generic e clawing_shadows Fluffy_Pillow 71.0/100: 71% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(3), commander_of_the_dead, elemental_chaos_earth
0:33.764 generic f festering_strike Fluffy_Pillow 84.0/100: 84% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), elemental_chaos_earth
0:34.783 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
0:35.803 generic c death_coil Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(4), elemental_chaos_earth
0:36.823 generic c death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_earth
0:37.844 generic e clawing_shadows Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_earth
0:38.865 generic e clawing_shadows Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(5), elemental_chaos_earth
0:39.885 generic e clawing_shadows Fluffy_Pillow 76.0/100: 76% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
0:40.906 generic c death_coil Fluffy_Pillow 89.0/100: 89% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), elemental_chaos_earth
0:42.230 generic f festering_strike Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), elemental_chaos_earth
0:43.556 generic c death_coil Fluffy_Pillow 84.0/100: 84% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(7), elemental_chaos_earth
0:44.882 generic c death_coil Fluffy_Pillow 54.0/100: 54% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(7), elemental_chaos_earth
0:46.208 default E antimagic_shell PR_Death_Knight_Unholy 24.0/100: 24% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight(7), elemental_chaos_earth
0:46.208 high_prio_actions j outbreak Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), runic_corruption, festermight(7), elemental_chaos_earth
0:47.533 generic f festering_strike Fluffy_Pillow 34.0/100: 34% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), festermight(7), elemental_chaos_earth
0:48.858 cooldowns Q dark_transformation Fluffy_Pillow 54.0/100: 54% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), elemental_chaos_earth
0:50.184 generic c death_coil Fluffy_Pillow 59.0/100: 59% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, elemental_chaos_earth
0:51.509 generic c death_coil Fluffy_Pillow 59.0/100: 59% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, elemental_chaos_earth
0:52.835 cooldowns R apocalypse Fluffy_Pillow 34.0/100: 34% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_earth
0:54.160 generic d death_and_decay Fluffy_Pillow 46.0/100: 46% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, elemental_chaos_earth
0:55.484 generic e clawing_shadows Fluffy_Pillow 56.0/100: 56% runic_power
4.0/6: 67% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, elemental_chaos_earth
0:56.746 generic e clawing_shadows Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, elemental_chaos_earth
0:58.008 generic c death_coil Fluffy_Pillow 82.0/100: 82% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, elemental_chaos_earth
0:59.270 generic f festering_strike Fluffy_Pillow 82.0/100: 82% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, elemental_chaos_earth
1:00.533 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, elemental_chaos_air
1:01.754 generic e clawing_shadows Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, elemental_chaos_air
1:02.977 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, elemental_chaos_air
1:04.197 generic e clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(7), commander_of_the_dead, elemental_chaos_air
1:05.420 generic c death_coil Fluffy_Pillow 83.0/100: 83% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, elemental_chaos_air
1:06.704 generic e clawing_shadows Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, elemental_chaos_air
1:07.987 generic f festering_strike Fluffy_Pillow 66.0/100: 66% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, elemental_chaos_air
1:09.271 generic c death_coil Fluffy_Pillow 86.0/100: 86% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, elemental_chaos_air
1:10.556 generic c death_coil Fluffy_Pillow 56.0/100: 56% runic_power
1.0/6: 17% rune
icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, elemental_chaos_air
1:11.839 generic c death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, runic_corruption, festermight(9), commander_of_the_dead, elemental_chaos_air
1:13.119 high_prio_actions j outbreak Fluffy_Pillow 1.0/100: 1% runic_power
4.0/6: 67% rune
icy_talons(3), runic_corruption, commander_of_the_dead, elemental_chaos_air
1:14.402 generic e clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, commander_of_the_dead, elemental_chaos_air
1:15.687 generic e clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, commander_of_the_dead, elemental_chaos_air
1:16.969 generic c death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead, elemental_chaos_air
1:18.253 generic e clawing_shadows Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), commander_of_the_dead, elemental_chaos_air
1:19.535 generic e clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_air
1:20.817 generic f festering_strike Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_air
1:22.100 generic c death_coil Fluffy_Pillow 58.0/100: 58% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_air
1:23.383 generic e clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_air
1:24.667 generic c death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), elemental_chaos_air
1:25.949 generic e clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), elemental_chaos_air
1:27.231 default E antimagic_shell PR_Death_Knight_Unholy 29.0/100: 29% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(6), elemental_chaos_air
1:27.231 generic c death_coil Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(6), elemental_chaos_air
1:28.513 Waiting     0.388 sec 29.0/100: 29% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, icy_talons(3), festermight(6), elemental_chaos_air
1:28.901 generic c death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_air
1:30.185 generic f festering_strike Fluffy_Pillow 4.0/100: 4% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(6), elemental_chaos_air
1:31.466 generic c death_coil Fluffy_Pillow 24.0/100: 24% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight(6), elemental_chaos_air
1:32.750 generic e clawing_shadows Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_air
1:34.033 cooldowns Q dark_transformation Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight(7), elemental_chaos_air
1:35.315 generic c death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_air
1:36.596 generic f festering_strike Fluffy_Pillow 12.0/100: 12% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_air
1:37.880 cooldowns R apocalypse Fluffy_Pillow 32.0/100: 32% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_air
1:39.163 cooldowns T unholy_assault Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, elemental_chaos_air
1:40.447 high_prio_actions j outbreak Fluffy_Pillow 49.0/100: 49% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, elemental_chaos_air
1:41.518 generic d death_and_decay Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, elemental_chaos_air
1:42.588 generic c death_coil Fluffy_Pillow 74.0/100: 74% runic_power
2.0/6: 33% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, elemental_chaos_air
1:43.606 generic e clawing_shadows Fluffy_Pillow 49.0/100: 49% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, elemental_chaos_air
1:44.624 generic c death_coil Fluffy_Pillow 62.0/100: 62% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(5), commander_of_the_dead, elemental_chaos_air
1:45.641 generic e clawing_shadows Fluffy_Pillow 67.0/100: 67% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, elemental_chaos_air
1:46.661 generic e clawing_shadows Fluffy_Pillow 80.0/100: 80% runic_power
4.0/6: 67% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, elemental_chaos_air
1:47.681 generic e clawing_shadows Fluffy_Pillow 93.0/100: 93% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, elemental_chaos_air
1:48.700 generic e clawing_shadows Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, elemental_chaos_air
1:49.718 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(9), commander_of_the_dead, elemental_chaos_air
1:50.736 generic e clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(9), commander_of_the_dead, elemental_chaos_air
1:51.754 generic f festering_strike Fluffy_Pillow 88.0/100: 88% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, elemental_chaos_air
1:52.773 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, elemental_chaos_air
1:53.844 generic c death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(10), commander_of_the_dead, elemental_chaos_air
1:54.914 generic c death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), commander_of_the_dead, elemental_chaos_air
1:55.983 generic e clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), commander_of_the_dead, elemental_chaos_air
1:57.054 generic c death_coil Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
icy_talons(3), runic_corruption, sudden_doom, unholy_assault, festermight(11), commander_of_the_dead, elemental_chaos_air
1:58.123 generic e clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
icy_talons(3), unholy_assault, commander_of_the_dead, elemental_chaos_air
1:59.193 generic f festering_strike Fluffy_Pillow 41.0/100: 41% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight, commander_of_the_dead, elemental_chaos_air
2:00.474 generic c death_coil Fluffy_Pillow 61.0/100: 61% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight, commander_of_the_dead, elemental_chaos_frost
2:01.801 generic e clawing_shadows Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight, commander_of_the_dead, elemental_chaos_frost
2:03.124 generic c death_coil Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead, elemental_chaos_frost
2:04.450 generic e clawing_shadows Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), elemental_chaos_frost
2:05.776 generic f festering_strike Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight(3), elemental_chaos_frost
2:07.102 default E antimagic_shell PR_Death_Knight_Unholy 57.0/100: 57% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(3), elemental_chaos_frost
2:07.231 high_prio_actions j outbreak Fluffy_Pillow 57.0/100: 57% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight(3), elemental_chaos_frost
2:08.555 generic c death_coil Fluffy_Pillow 67.0/100: 67% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), sudden_doom, festermight(3), elemental_chaos_frost
2:09.882 generic c death_coil Fluffy_Pillow 72.0/100: 72% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(3), elemental_chaos_frost
2:11.206 generic e clawing_shadows Fluffy_Pillow 72.0/100: 72% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_frost
2:12.531 generic e clawing_shadows Fluffy_Pillow 90.0/100: 90% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_frost
2:13.857 generic f festering_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), festermight(5), elemental_chaos_frost
2:15.183 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(5), elemental_chaos_frost
2:16.507 generic c death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(5), elemental_chaos_frost
2:17.832 generic c death_coil Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight(5), elemental_chaos_frost
2:19.159 cooldowns Q dark_transformation Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, elemental_chaos_frost
2:20.482 generic e clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune
icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, elemental_chaos_frost
2:21.809 generic c death_coil Fluffy_Pillow 33.0/100: 33% runic_power
5.0/6: 83% rune
rune_mastery, icy_talons(3), dark_transformation, festermight, commander_of_the_dead, elemental_chaos_frost
2:23.132 cooldowns R apocalypse Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
rune_mastery, icy_talons(3), dark_transformation, runic_corruption, festermight, commander_of_the_dead, elemental_chaos_frost
2:24.459 generic d death_and_decay Fluffy_Pillow 20.0/100: 20% runic_power
6.0/6: 100% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, elemental_chaos_frost
2:25.787 generic e clawing_shadows Fluffy_Pillow 30.0/100: 30% runic_power
5.0/6: 83% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, elemental_chaos_frost
2:27.049 generic f festering_strike Fluffy_Pillow 43.0/100: 43% runic_power
4.0/6: 67% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, elemental_chaos_frost
2:28.311 generic c death_coil Fluffy_Pillow 63.0/100: 63% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, elemental_chaos_frost
2:29.102 trinkets m use_item_dragon_games_equipment Fluffy_Pillow 63.0/100: 63% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, elemental_chaos_frost
2:29.572 generic c death_coil Fluffy_Pillow 63.0/100: 63% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, dragon_games_equipment, elemental_chaos_frost
2:30.833 generic e clawing_shadows Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, festermight(6), commander_of_the_dead, elemental_chaos_frost
2:32.093 generic e clawing_shadows Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, elemental_chaos_frost
2:33.353 generic e clawing_shadows Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune
unholy_ground, icy_talons(3), dark_transformation, festermight(8), commander_of_the_dead, elemental_chaos_frost
2:34.615 high_prio_actions j outbreak Fluffy_Pillow 77.0/100: 77% runic_power
2.0/6: 33% rune
unholy_ground, icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, elemental_chaos_frost
2:35.877 generic c death_coil Fluffy_Pillow 87.0/100: 87% runic_power
1.0/6: 17% rune
icy_talons(3), dark_transformation, sudden_doom, festermight(9), commander_of_the_dead, elemental_chaos_frost
2:37.201 generic c death_coil Fluffy_Pillow 87.0/100: 87% runic_power
1.0/6: 17% rune
icy_talons(3), dark_transformation, festermight(9), commander_of_the_dead, elemental_chaos_frost
2:38.526 generic c death_coil Fluffy_Pillow 57.0/100: 57% runic_power
1.0/6: 17% rune
icy_talons(3), dark_transformation, sudden_doom, festermight(9), commander_of_the_dead, elemental_chaos_frost
2:39.850 generic e clawing_shadows Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, runic_corruption, festermight(9), commander_of_the_dead, elemental_chaos_frost
2:41.175 generic e clawing_shadows Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune
icy_talons(3), commander_of_the_dead, elemental_chaos_frost
2:42.501 generic c death_coil Fluffy_Pillow 88.0/100: 88% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, commander_of_the_dead, elemental_chaos_frost
2:43.827 generic c death_coil Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight, commander_of_the_dead, elemental_chaos_frost
2:45.152 generic f festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, elemental_chaos_frost
2:46.475 generic c death_coil Fluffy_Pillow 83.0/100: 83% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight, commander_of_the_dead, elemental_chaos_frost
2:47.801 generic e clawing_shadows Fluffy_Pillow 83.0/100: 83% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, commander_of_the_dead, elemental_chaos_frost
2:49.126 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), commander_of_the_dead, elemental_chaos_frost
2:50.451 generic e clawing_shadows Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), elemental_chaos_frost
2:51.776 generic e clawing_shadows Fluffy_Pillow 88.0/100: 88% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(3), elemental_chaos_frost
2:53.102 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4), elemental_chaos_frost
2:54.427 generic f festering_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(4), elemental_chaos_frost
2:55.752 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4), elemental_chaos_frost
2:57.076 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_frost
2:58.403 generic f festering_strike Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_frost
2:59.730 generic c death_coil Fluffy_Pillow 95.0/100: 95% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_frost
3:01.053 high_prio_actions j outbreak Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
3:02.379 high_prio_actions h army_of_the_dead Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), elemental_chaos_earth
3:03.705 generic c death_coil Fluffy_Pillow 85.0/100: 85% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), elemental_chaos_earth
3:05.031 cooldowns Q dark_transformation Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, sudden_doom, elemental_chaos_earth
3:06.356 cooldowns P summon_gargoyle Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, elemental_chaos_earth
3:06.356 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, elemental_chaos_earth
3:07.681 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, commander_of_the_dead, elemental_chaos_earth
3:09.008 high_prio_actions i death_coil Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_earth
3:10.333 cooldowns R apocalypse Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune
icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_earth
3:10.333 trinkets l use_item_algethar_puzzle_box Fluffy_Pillow 87.0/100: 87% runic_power
6.0/6: 100% rune
icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, elemental_chaos_earth
3:12.100 cooldowns S empower_rune_weapon Fluffy_Pillow 87.0/100: 87% runic_power
6.0/6: 100% rune
icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:12.100 cooldowns T unholy_assault Fluffy_Pillow 92.0/100: 92% runic_power
6.0/6: 100% rune
empower_rune_weapon, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:13.254 cooldowns U soul_reaper Fluffy_Pillow 97.0/100: 97% runic_power
6.0/6: 100% rune
empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:14.216 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:15.179 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:16.143 generic c death_coil Fluffy_Pillow 70.0/100: 70% runic_power
5.0/6: 83% rune
empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:17.103 default E antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:17.103 generic c death_coil Fluffy_Pillow 45.0/100: 45% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:18.066 generic d death_and_decay Fluffy_Pillow 15.0/100: 15% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:19.028 cooldowns U soul_reaper Fluffy_Pillow 30.0/100: 30% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:20.170 racials k berserking Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:20.170 generic c death_coil Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune
berserking, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:21.003 generic e clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune
berserking, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:21.837 generic e clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
berserking, antimagic_shell, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:22.670 generic c death_coil Fluffy_Pillow 41.0/100: 41% runic_power
4.0/6: 67% rune
berserking, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:23.504 generic e clawing_shadows Fluffy_Pillow 11.0/100: 11% runic_power
5.0/6: 83% rune
berserking, antimagic_shell, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:24.336 generic e clawing_shadows Fluffy_Pillow 29.0/100: 29% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:25.171 cooldowns U soul_reaper Fluffy_Pillow 42.0/100: 42% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:26.087 generic c death_coil Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:26.923 generic c death_coil Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:27.755 generic c death_coil Fluffy_Pillow 37.0/100: 37% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, unholy_ground, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:28.589 high_prio_actions j outbreak Fluffy_Pillow 7.0/100: 7% runic_power
6.0/6: 100% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:29.462 generic e clawing_shadows Fluffy_Pillow 22.0/100: 22% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:30.336 generic c death_coil Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:31.210 cooldowns U soul_reaper Fluffy_Pillow 5.0/100: 5% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, algethar_puzzle, elemental_chaos_earth
3:32.129 generic e clawing_shadows Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
berserking, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_earth
3:33.335 generic c death_coil Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), sudden_doom, festermight, commander_of_the_dead, elemental_chaos_earth
3:34.661 generic e clawing_shadows Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, commander_of_the_dead, elemental_chaos_earth
3:35.986 generic c death_coil Fluffy_Pillow 51.0/100: 51% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
3:37.311 cooldowns U soul_reaper Fluffy_Pillow 21.0/100: 21% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), elemental_chaos_earth
3:38.636 generic e clawing_shadows Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
3:39.960 generic e clawing_shadows Fluffy_Pillow 49.0/100: 49% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(3), elemental_chaos_earth
3:41.285 generic c death_coil Fluffy_Pillow 62.0/100: 62% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(4), elemental_chaos_earth
3:42.609 generic e clawing_shadows Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_earth
3:43.934 cooldowns U soul_reaper Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(5), elemental_chaos_earth
3:45.257 generic f festering_strike Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(5), elemental_chaos_earth
3:46.583 generic c death_coil Fluffy_Pillow 85.0/100: 85% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), elemental_chaos_earth
3:47.909 generic c death_coil Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), elemental_chaos_earth
3:49.236 generic f festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(5), elemental_chaos_earth
3:50.561 cooldowns Q dark_transformation Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), elemental_chaos_earth
3:51.888 cooldowns U soul_reaper Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, elemental_chaos_earth
3:53.212 generic c death_coil Fluffy_Pillow 60.0/100: 60% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_earth
3:54.537 generic c death_coil Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_earth
3:55.863 high_prio_actions j outbreak Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, elemental_chaos_earth
3:57.189 default E antimagic_shell PR_Death_Knight_Unholy 10.0/100: 10% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_earth
3:57.189 cooldowns R apocalypse Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_earth
3:58.514 cooldowns U soul_reaper Fluffy_Pillow 22.0/100: 22% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, elemental_chaos_earth
3:59.839 generic d death_and_decay Fluffy_Pillow 37.0/100: 37% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, elemental_chaos_earth
4:01.164 generic e clawing_shadows Fluffy_Pillow 47.0/100: 47% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(4), commander_of_the_dead, elemental_chaos_air
4:02.386 generic c death_coil Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, elemental_chaos_air
4:03.608 generic c death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, elemental_chaos_air
4:04.830 cooldowns U soul_reaper Fluffy_Pillow 0.0/100: 0% runic_power
3.0/6: 50% rune
unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(5), commander_of_the_dead, elemental_chaos_air
4:06.051 generic e clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, festermight(5), commander_of_the_dead, elemental_chaos_air
4:07.273 generic c death_coil Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, elemental_chaos_air
4:08.495 generic e clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, festermight(6), commander_of_the_dead, elemental_chaos_air
4:09.717 generic e clawing_shadows Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, festermight(7), commander_of_the_dead, elemental_chaos_air
4:10.937 cooldowns U soul_reaper Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(8), commander_of_the_dead, elemental_chaos_air
4:12.219 generic f festering_strike Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(8), commander_of_the_dead, elemental_chaos_air
4:13.501 generic c death_coil Fluffy_Pillow 89.0/100: 89% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(8), commander_of_the_dead, elemental_chaos_air
4:14.782 generic c death_coil Fluffy_Pillow 64.0/100: 64% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(8), commander_of_the_dead, elemental_chaos_air
4:16.066 generic c death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(8), commander_of_the_dead, elemental_chaos_air
4:17.348 cooldowns U soul_reaper Fluffy_Pillow 4.0/100: 4% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), commander_of_the_dead, elemental_chaos_air
4:18.632 generic e clawing_shadows Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), commander_of_the_dead, elemental_chaos_air
4:19.913 generic c death_coil Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight, commander_of_the_dead, elemental_chaos_air
4:21.196 generic e clawing_shadows Fluffy_Pillow 2.0/100: 2% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight, elemental_chaos_air
4:22.477 high_prio_actions j outbreak Fluffy_Pillow 15.0/100: 15% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_air
4:23.759 Waiting     2.000 sec 25.0/100: 25% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_air
4:25.759 cooldowns U soul_reaper Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_air
4:27.042 generic c death_coil Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_air
4:28.324 generic e clawing_shadows Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(2), elemental_chaos_air
4:29.102 trinkets m use_item_dragon_games_equipment Fluffy_Pillow 23.0/100: 23% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_air
4:29.607 generic e clawing_shadows Fluffy_Pillow 23.0/100: 23% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(3), dragon_games_equipment, elemental_chaos_air
4:30.889 generic c death_coil Fluffy_Pillow 36.0/100: 36% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_air
4:32.172 cooldowns U soul_reaper Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_air
4:33.454 generic e clawing_shadows Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_air
4:34.737 generic c death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), elemental_chaos_air
4:36.016 generic e clawing_shadows Fluffy_Pillow 9.0/100: 9% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), elemental_chaos_air
4:37.299 default E antimagic_shell PR_Death_Knight_Unholy 22.0/100: 22% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_air
4:37.299 cooldowns Q dark_transformation Fluffy_Pillow 22.0/100: 22% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_air
4:38.580 cooldowns U soul_reaper Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(6), commander_of_the_dead, elemental_chaos_air
4:39.861 generic c death_coil Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, commander_of_the_dead, elemental_chaos_air
4:41.144 generic c death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, commander_of_the_dead, elemental_chaos_air
4:42.425 cooldowns T unholy_assault Fluffy_Pillow 12.0/100: 12% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, commander_of_the_dead, elemental_chaos_air
4:43.708 cooldowns R apocalypse Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), dark_transformation, unholy_assault, commander_of_the_dead, elemental_chaos_air
4:44.777 cooldowns U soul_reaper Fluffy_Pillow 29.0/100: 29% runic_power
5.0/6: 83% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, elemental_chaos_air
4:45.846 generic d death_and_decay Fluffy_Pillow 44.0/100: 44% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, elemental_chaos_air
4:46.913 generic e clawing_shadows Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(4), commander_of_the_dead, elemental_chaos_air
4:47.931 generic c death_coil Fluffy_Pillow 72.0/100: 72% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, elemental_chaos_air
4:48.949 high_prio_actions j outbreak Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), commander_of_the_dead, elemental_chaos_air
4:49.967 generic e clawing_shadows Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(5), commander_of_the_dead, elemental_chaos_air
4:50.985 cooldowns U soul_reaper Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, elemental_chaos_air
4:52.003 generic c death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, elemental_chaos_air
4:53.021 generic c death_coil Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, elemental_chaos_air
4:54.040 generic e clawing_shadows Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(6), commander_of_the_dead, elemental_chaos_air
4:55.059 generic c death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
rune_mastery, unholy_ground, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, elemental_chaos_air
4:56.079 generic c death_coil Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, unholy_ground, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), commander_of_the_dead, elemental_chaos_air
4:57.097 generic f festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, elemental_chaos_air
4:58.166 generic e clawing_shadows Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(7), commander_of_the_dead, elemental_chaos_air
4:59.235 generic c death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), commander_of_the_dead, elemental_chaos_air

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6095 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3463 0 12965 12348 6827
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 259300 246960 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 15.36% 15.36% 1504
Haste 13.49% 13.49% 2293
Versatility 10.17% 3.99% 818
Attack Power 6400 5922 0
Mastery 44.26% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +687 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +687 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJRSLSAJJRIkkkEBAAAAAAAAAKJJhIAAgkESLRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions+=/antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
# Variables
actions+=/variable,name=epidemic_priority,op=setif,value=1,value_else=0,condition=talent.improved_death_coil&!talent.coil_of_devastation&active_enemies>=3|talent.coil_of_devastation&active_enemies>=4|!talent.improved_death_coil&active_enemies>=2
actions+=/variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle|time>20
actions+=/variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4&cooldown.unholy_assault.remains>10
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(5*gcd.max))>=1
actions+=/variable,name=pop_wounds,op=setif,value=1,value_else=0,condition=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.rotten_touch.up&debuff.festering_wound.stack>=1|debuff.festering_wound.stack>4)|fight_remains<5&debuff.festering_wound.stack>=1
actions+=/variable,name=pooling_runic_power,op=setif,value=1,value_else=0,condition=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=st_planning,op=setif,value=1,value_else=0,condition=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,op=setif,value=1,value_else=0,condition=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=20|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration|active_enemies>=3&(buff.dark_transformation.up|death_and_decay.ticking))|fight_remains<=21
# Call Action Lists
actions+=/call_action_list,name=high_prio_actions
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup=0
actions+=/call_action_list,name=cooldowns,if=variable.st_planning
actions+=/call_action_list,name=aoe_cooldowns,if=variable.adds_remain
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=aoe_setup,if=variable.adds_remain&cooldown.any_dnd.remains<10&!death_and_decay.ticking
actions+=/call_action_list,name=aoe_burst,if=active_enemies>=4&death_and_decay.ticking
actions+=/call_action_list,name=aoe,if=active_enemies>=4&(cooldown.any_dnd.remains>10&!death_and_decay.ticking|!variable.adds_remain)
actions+=/call_action_list,name=generic,if=active_enemies<=3

# Generic AoE
actions.aoe=epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# AoE Burst
actions.aoe_burst=epidemic,if=(!talent.bursting_sores|rune<1|talent.bursting_sores&debuff.festering_wound.stack=0)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30|buff.festermight.stack=20)
actions.aoe_burst+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=1
actions.aoe_burst+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_burst+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe_burst+=/wound_spender

# AoE Cooldowns
actions.aoe_cooldowns=vile_contagion,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.aoe_cooldowns+=/summon_gargoyle
actions.aoe_cooldowns+=/abomination_limb,if=rune<2|buff.festermight.stack>10|!talent.festermight|buff.festermight.up&buff.festermight.remains<12
actions.aoe_cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=talent.bursting_sores&debuff.festering_wound.up&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)|!talent.bursting_sores&debuff.festering_wound.stack>=4
actions.aoe_cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.stack<=2|buff.dark_transformation.up
actions.aoe_cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.aoe_cooldowns+=/dark_transformation,if=(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.aoe_cooldowns+=/empower_rune_weapon,if=buff.dark_transformation.up
actions.aoe_cooldowns+=/sacrificial_pact,if=!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# AoE Setup
actions.aoe_setup=any_dnd,if=(!talent.bursting_sores|death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets>=8|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5)
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies&talent.bursting_sores
actions.aoe_setup+=/epidemic,if=!variable.pooling_runic_power|fight_remains<10
actions.aoe_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=death_knight.fwounded_targets<active_enemies
actions.aoe_setup+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=cooldown.apocalypse.remains<variable.apoc_timing&debuff.festering_wound.stack<4
actions.aoe_setup+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic

# ST/Cleave Cooldowns
actions.cooldowns=summon_gargoyle,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=cooldown.apocalypse.remains<5
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=variable.st_planning&debuff.festering_wound.stack>=4
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.gargoyle.remains<=21|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)

# Garg Setup
actions.garg_setup=apocalypse,if=debuff.festering_wound.stack>=4&(buff.commander_of_the_dead.up&pet.gargoyle.remains<21|!talent.commander_of_the_dead)
actions.garg_setup+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead.up|!talent.commander_of_the_dead&runic_power>=40
actions.garg_setup+=/empower_rune_weapon,if=pet.gargoyle.active&pet.gargoyle.remains<=21
actions.garg_setup+=/unholy_assault,if=pet.gargoyle.active&pet.gargoyle.remains<=21
actions.garg_setup+=/potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&runic_power>40|!talent.commander_of_the_dead
actions.garg_setup+=/any_dnd,if=!death_and_decay.ticking&debuff.festering_wound.stack>0
actions.garg_setup+=/festering_strike,if=debuff.festering_wound.stack=0|!talent.apocalypse
actions.garg_setup+=/death_coil,if=rune<=1

# Generic
actions.generic=death_coil,if=!variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
actions.generic+=/epidemic,if=variable.epidemic_priority&(!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10)
actions.generic+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground&(pet.apoc_ghoul.active&pet.apoc_ghoul.remains>=10|pet.gargoyle.active&pet.gargoyle.remains>5|pet.army_ghoul.active&pet.army_ghoul.remains>5))&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Priority Actions
actions.high_prio_actions=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
actions.high_prio_actions+=/army_of_the_dead,if=talent.summon_gargoyle&cooldown.summon_gargoyle.remains<2|!talent.summon_gargoyle|fight_remains<35
actions.high_prio_actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5&buff.commander_of_the_dead.remains>26|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/epidemic,if=active_enemies>=4&(talent.commander_of_the_dead&buff.commander_of_the_dead.up&cooldown.apocalypse.remains<5|debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions.high_prio_actions+=/wound_spender,if=(cooldown.apocalypse.remains>variable.apoc_timing+3|active_enemies>=3)&talent.plaguebringer&(talent.superstrain|talent.unholy_blight)&buff.plaguebringer.remains<gcd
actions.high_prio_actions+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21
actions.high_prio_actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60|death_knight.disable_aotd)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>80)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=6827
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 13860 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
13859.9 13859.9 9.4 / 0.068% 1618.6 / 11.7% 992.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.5 13.3 Mana 0.00% 27.6 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 13860
Mind Blast 1682 12.1% 30.8 9.63sec 16397 14083 Direct 30.8 14472 28987 16397 13.3%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.76 30.76 0.00 0.00 0.00 1.1644 0.0000 504314.43 504314.43 0.00% 14082.67 14082.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.74% 26.68 14 37 14472.30 13853 20028 14474.12 13975 15233 386080 386080 0.00%
crit 13.26% 4.08 0 12 28986.56 27705 40056 28562.18 0 37657 118234 118234 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.52

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage{$?s137033=true}[ |cFFFFFFFFGenerates {$/100;s2=0} Insanity|r][]{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [S]:30.80
  • if_expr:variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Mind Flay 5556 40.1% 62.2 4.82sec 26798 7722 Periodic 369.9 3973 7961 4502 13.3% 71.7%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.15 0.00 369.92 369.92 0.00 3.4706 0.5819 1665547.42 1665547.42 0.00% 7721.63 7721.63
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.72% 320.79 245 400 3972.91 3789 5478 3973.89 3866 4138 1274474 1274474 0.00%
crit 13.28% 49.13 24 79 7960.55 7578 10956 7962.69 7645 8505 391073 391073 0.00%

Action Details: Mind Flay

  • id:15407
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:2.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.324852
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.50
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=4.500 seconds} and slowing their movement speed by {$s2=50}%. |cFFFFFFFFGenerates {$=}{{$s4=6}*{$s3=200}/100} Insanity over the duration.|r

Action Priority List

    filler
    [L]:62.15
  • interrupt_if_expr:ticks>=2
Shadow Crash 0 (945) 0.0% (6.8%) 8.9 31.98sec 31931 26904

Stats Details: Shadow Crash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.87 0.00 0.00 0.00 0.00 1.1869 0.0000 0.00 0.00 0.00% 26903.69 26903.69

Action Details: Shadow Crash

  • id:205385
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:15.0

Spelldata

  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r

Action Priority List

    main
    [T]:8.87
  • if_expr:!variable.holding_crash
    Shadow Crash (_damage) 945 6.8% 9.8 31.97sec 28855 0 Direct 9.8 25449 50983 28856 13.3%

Stats Details: Shadow Crash Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.82 9.82 0.00 0.00 0.00 0.0000 0.0000 283295.86 283295.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.66% 8.51 2 12 25448.93 23770 35474 25449.85 24345 27781 216520 216520 0.00%
crit 13.34% 1.31 0 6 50982.85 47539 70949 38185.60 0 70949 66776 66776 0.00%

Action Details: Shadow Crash Damage

  • id:205386
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.103750
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadow Weaving 122 0.9% 32.0 6.48sec 1127 0 Direct 32.0 1127 0 1127 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.00 32.00 0.00 0.00 0.00 0.0000 0.0000 36051.04 36051.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 32.00 32 32 1126.59 319 2290 1126.60 976 1423 36051 36051 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:977.43
  • base_dd_max:977.43
  • base_dd_mult:1.00

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}
Shadow Word: Death 373 2.7% 3.2 21.33sec 34447 28405 Direct 3.2 30180 60782 34449 13.9%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.23 3.23 0.00 0.00 0.00 1.2129 0.0000 111374.99 111374.99 0.00% 28404.74 28404.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.06% 2.78 0 4 30179.95 27290 39455 30105.67 0 39455 83972 83972 0.00%
crit 13.94% 0.45 0 3 60782.01 54579 78911 23233.23 0 78911 27403 27403 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target. {$?=}A364675[Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]

Action Priority List

    main
    [R]:3.23
  • target_if_expr:(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
Shadow Word: Pain 1702 12.3% 18.3 15.82sec 27909 23769 Direct 18.3 2832 5668 3202 13.1%
Periodic 188.4 2118 4239 2398 13.2% 97.5%

Stats Details: Shadow Word Pain

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.28 18.28 188.42 188.42 17.28 1.1742 1.5519 510301.16 510301.16 0.00% 1625.78 23769.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.94% 15.90 8 22 2831.76 2602 3717 2831.88 2743 2996 45014 45014 0.00%
crit 13.06% 2.39 0 9 5667.66 5205 7435 5219.10 0 7435 13534 13534 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.81% 163.57 121 210 2117.90 32 2934 2118.13 2054 2204 346422 346422 0.00%
crit 13.19% 24.85 7 48 4238.89 69 5869 4239.37 3853 4562 105331 105331 0.00%

Action Details: Shadow Word Pain

  • id:589
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:3.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.095880
  • base_td:0.00
  • base_td_mult:1.81
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=2} sec.
  • description:A word of darkness that causes {$?a390707=false}[{$=}{{$s1=0}*(1+{$390707s1=15}/100)}][{$s1=0}] Shadow damage instantly, and an additional {$?a390707=false}[{$=}{{$=}o2*(1+{$390707s1=15}/100)}][{$=}o2] Shadow damage over {$d=16 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m3=300}/100} Insanity.|r][]

Action Priority List

    main
    [Q]:18.28
  • if_expr:refreshable&target.time_to_die>=18&!talent.misery.enabled
  • target_if_expr:remains
Soulseeker Arrow 1049 7.6% 6.2 43.05sec 50798 0 Periodic 73.2 4301 0 4301 0.0% 34.4%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 0.00 73.19 73.19 1.80 0.0000 1.4105 314837.58 314837.58 0.00% 3049.63 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 73.19 14 173 4301.48 132 4896 4299.14 4227 4520 314838 314838 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:4032.41
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1922}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 1957 14.1% 18.5 16.07sec 31630 56609 Periodic 127.2 4069 8151 4612 13.3% 98.9%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.54 0.00 127.18 127.18 17.45 0.5588 2.3336 586523.64 586523.64 0.00% 1909.62 56608.79
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.71% 110.28 80 142 4069.42 154 5619 4070.38 3949 4264 448772 448772 0.00%
crit 13.29% 16.90 4 34 8151.06 294 11238 8153.46 7130 9167 137751 137751 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [P]:8.73
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
  • target_if_expr:remains
pet - shadowfiend 3997 / 473
melee 3997 3.4% 32.0 6.48sec 4372 4065 Direct 32.0 3867 7731 4372 13.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.00 32.00 0.00 0.00 0.00 1.0755 0.0000 139895.91 139895.91 0.00% 4064.97 4064.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.94% 27.82 20 32 3867.36 3640 4356 3867.47 3760 4261 107598 107598 0.00%
crit 13.06% 4.18 0 12 7730.53 7281 8711 7632.90 0 8711 32297 32297 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 1.0 0.00sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [I]:1.00
  • if_expr:buff.power_infusion.up|fight_remains<=15
Desperate Prayer 1.0 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=false}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [K]:1.00
  • if_expr:health.pct<=75
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [H]:1.00
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Shadow Crash (_dots) 8.9 31.98sec

Stats Details: Shadow Crash Dots

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.87 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadow Crash Dots

  • id:391286
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:391286
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadowfiend 2.0 0.00sec

Stats Details: Shadowfiend

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0800 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowfiend

  • id:34433
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:343726
  • description:Summons a shadowy fiend to attack the target for {$d=15 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$262485s1=300}/100} Insanity each time the Shadowfiend attacks.|r][ |cFFFFFFFFGenerates {$=}{{$s4=5}/10}.1% Mana each time the Shadowfiend attacks.|r]

Action Priority List

    main
    [O]:2.00
  • if_expr:variable.dots_up&(fight_remains<30|time_to_die>15)
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 1.0 0.00sec

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 127.2 2.34sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 127.18 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1301.04
  • base_dd_max:1301.04
  • base_dd_mult:1.00

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Fury 1.0 0.0 0.0sec 0.0sec 13.5sec 4.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:11.3s / 15.0s

Stack Uptimes

  • blood_fury_1:4.55%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Desperate Prayer 1.0 0.0 0.0sec 0.0sec 9.2sec 3.08% 0.00% 8.3 (8.3) 0.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • desperate_prayer_1:3.08%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=false}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Devoured Pride 1.0 0.0 0.0sec 0.0sec 15.0sec 5.07% 5.96% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • devoured_pride_1:5.07%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning {$?s123040=false}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=false}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=false}|s200174[Mindbender][Shadowfiend] deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning {$?s123040=false}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=false}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=false}|s200174[Mindbender][Shadowfiend] deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0sec 0.0sec 28.6sec 9.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.3s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.66%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.9sec 45.6sec 16.5sec 23.59% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 228.7s
  • trigger_min/max:0.1s / 218.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.0s

Stack Uptimes

  • sophic_devotion_1:23.59%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.3 0.0 0.0sec 0.0sec 18.6sec 1.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:1.59%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.3 0.0 0.0sec 0.0sec 18.6sec 1.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:1.59%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.3 0.0 0.0sec 0.0sec 18.6sec 1.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:1.57%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.2 0.0 0.0sec 0.0sec 18.6sec 1.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.4s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:1.54%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:Primary stat is increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:Primary stat is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your primary stat up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Idol of Y'Shaarj Devoured Violence procs 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 95.30% 91.96% 98.69% 88.4s 18.8s 289.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Shadow Crash1.7680.0005.34617.51712.43123.883
Mind Blast1.476-0.0008.88949.54535.78566.395
Shadowfiend1.1250.0002.2932.2512.2152.293
Shadow Word: Death75.7480.000290.713244.998197.058294.074

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
ShadowfiendInsanity32.0036.0036.00%1.1360.0062.50%
mana_regenMana341.583978.39100.00%11.65474626.9099.17%
Mind BlastInsanity30.7612.0012.00%0.39172.5493.50%
Mind FlayInsanity369.9234.0034.00%0.09705.8495.40%
Shadow CrashInsanity9.8715.0015.00%1.52133.0889.87%
Shadow Word: PainInsanity18.283.003.00%0.1651.8594.53%
Vampiric TouchInsanity8.730.000.00%0.0034.90100.00%
Usage Type Count Total Avg RPE APR
PR_Priest_Shadow
Shadow Word: DeathMana 3.234041.461250.001249.9827.56
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 216100.0 335.14 402.68 142830.2 181233.1 -25670.8 216100.0
Mana 49999.0 13.26 13.47 474627.1 49935.9 48749.0 49999.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 13859.88
Minimum 12651.92
Maximum 15591.08
Spread ( max - min ) 2939.16
Range [ ( max - min ) / 2 * 100% ] 10.60%
Standard Deviation 415.8654
5th Percentile 13217.58
95th Percentile 14577.60
( 95th Percentile - 5th Percentile ) 1360.02
Mean Distribution
Standard Deviation 4.8023
95.00% Confidence Interval ( 13850.47 - 13869.30 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3459
0.1 Scale Factor Error with Delta=300 1477
0.05 Scale Factor Error with Delta=300 5906
0.01 Scale Factor Error with Delta=300 147635
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 13859.88
Minimum 12651.92
Maximum 15591.08
Spread ( max - min ) 2939.16
Range [ ( max - min ) / 2 * 100% ] 10.60%
Standard Deviation 415.8654
5th Percentile 13217.58
95th Percentile 14577.60
( 95th Percentile - 5th Percentile ) 1360.02
Mean Distribution
Standard Deviation 4.8023
95.00% Confidence Interval ( 13850.47 - 13869.30 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3459
0.1 Scale Factor Error with Delta=300 1477
0.05 Scale Factor Error with Delta=300 5906
0.01 Scale Factor Error with Delta=300 147635
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 13859.88
Minimum 12651.92
Maximum 15591.08
Spread ( max - min ) 2939.16
Range [ ( max - min ) / 2 * 100% ] 10.60%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 4012246.12
Minimum 3056142.55
Maximum 5158045.95
Spread ( max - min ) 2101903.40
Range [ ( max - min ) / 2 * 100% ] 26.19%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 405.42
Minimum 235.44
Maximum 1220.49
Spread ( max - min ) 985.06
Range [ ( max - min ) / 2 * 100% ] 121.49%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 338.57
Minimum 110.58
Maximum 423.98
Spread ( max - min ) 313.40
Range [ ( max - min ) / 2 * 100% ] 46.28%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
otion=elemental_potion_of_ultimate_power_ lask=phial_of_tepid_versatility_ ood=fated_fortune_cooki ugmentation=draconic_augment_run emporary_enchant=main_hand:howling_rune_
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 variable,name=mind_sear_cutoff,op=set,value=2
7 0.00 variable,name=pool_amount,op=set,value=60
8 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice
9 0.00 mind_blast,if=talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in>=25&spell_targets.shadow_crash<=8|fight_style.dungeonslice)
A 0.00 vampiric_touch,if=!talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice)
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<20
B 0.00 run_action_list,name=aoe,if=spell_targets.mind_sear>2|spell_targets.vampiric_touch>3
C 0.00 run_action_list,name=main
actions.cds
# count action,conditions
H 1.00 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Todo Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
I 1.00 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
0.00 dark_ascension,if=pet.fiend.active|!talent.mindbender&!cooldown.fiend.up|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
J 0.00 call_action_list,name=trinkets
K 1.00 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
0.00 mind_flay,if=buff.mind_flay_insanity.up&dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
0.00 mind_spike,if=buff.surge_of_darkness.up
0.00 lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75|spell_targets.lights_judgment>1
0.00 halo,if=raid_event.adds.in>20
Save up to 20s if adds are coming soon.
0.00 shadow_word_death,target_if=min:target.time_to_die,if=target.health.pct<20&(spell_targets.mind_sear<4|talent.inescapable_torment.rank=2&pet.fiend.active)
0.00 divine_star,if=raid_event.adds.in>10
Save up to 10s if adds are coming soon.
0.00 mind_spike,if=(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
L 62.15 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>30
Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=min:remains
Use Shadow Word: Pain while moving as a low-priority action
actions.main
# count action,conditions
M 0.00 call_action_list,name=main_variables
N 0.00 call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
O 2.00 mindbender,if=variable.dots_up&(fight_remains<30|time_to_die>15)
0.00 mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
High priority Mind Blast action when using Inescapable Torment
0.00 damnation,target_if=dot.vampiric_touch.refreshable|dot.shadow_word_pain.refreshable
0.00 void_bolt,if=variable.dots_up&insanity<=85
0.00 mind_sear,target_if=spell_targets.mind_sear>1&buff.mind_devourer.up
Use Mind Devourer Procs on Mind Sear when facing 2 or more targets
0.00 devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
P 8.73 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
Q 18.28 shadow_word_pain,target_if=min:remains,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
0.00 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
R 3.23 shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
S 30.80 mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
0.00 mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
TODO: Dont use if add events are coming soon when talented into PL
T 8.87 shadow_crash,if=!variable.holding_crash
0.00 dark_void,if=raid_event.adds.in>20
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
0.00 void_torrent,if=insanity<=35&!variable.holding_crash,target_if=variable.all_dots_up
TODO: Dont use if add events are coming soon when talented into PL
U 0.00 call_action_list,name=filler
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance
V 1.00 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=fight_remains<20|!talent.ancient_madness|(cooldown.dark_ascension.remains>10&talent.dark_ascension)|(cooldown.void_eruption.remains>10&talent.void_eruption)|(!talent.void_eruption&!talent.dark_ascension)
Sync with cooldowns for Ancient Madness or use when the fight will end soon or at full stacks

Sample Sequence

0124678OQSLLSLQLSPLLSLLQSTLLSLLQSLLPSLQTLSLLQSLLPSLLQSTLLSLQLSLPLQSTLLSLQLSLPLQSTLLSLQLSLOPLQSTLLSLQLSLPLSLQTLSLLQSRLLPSLQTLRSLLHQSLLVPRKSLITLLL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 6 mind_sear_cutoff PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
Pre precombat 7 pool_amount PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
Pre precombat 8 shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
0:00.000 main O shadowfiend Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
bloodlust, shadowform, static_empowerment
0:00.940 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
bloodlust, shadowform, static_empowerment
0:01.879 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
bloodlust, shadowform, static_empowerment(2)
0:02.820 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
bloodlust, shadowform, static_empowerment(3)
0:05.625 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
bloodlust, shadowform, static_empowerment(5)
0:08.431 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity
bloodlust, shadowform, static_empowerment(5)
0:09.372 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
bloodlust, shadowform, static_empowerment(5)
0:12.178 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:13.119 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:15.926 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:16.864 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:17.803 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:20.610 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:23.417 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:24.357 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:27.164 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:29.971 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:30.909 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:31.848 main T shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:32.788 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:35.595 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:38.402 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:39.341 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, shadowform, static_empowerment(5)
0:42.147 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:45.800 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:47.020 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:48.240 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:51.892 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:55.544 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:56.766 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
0:57.987 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:01.640 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:02.860 main T shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:04.080 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:07.734 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:08.955 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:12.607 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:16.259 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:17.479 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:18.699 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:22.351 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:26.002 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:27.223 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:28.442 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:32.096 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:35.750 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:36.970 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:38.192 main T shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:39.413 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:43.065 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:46.718 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:47.937 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
1:51.589 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:52.809 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:56.461 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
1:57.681 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:01.332 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:02.553 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:06.206 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:07.428 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:08.650 main T shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:09.871 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:13.523 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:17.176 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:18.397 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:22.050 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:23.270 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:26.923 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:28.143 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:31.795 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:33.016 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:36.667 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:37.888 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:39.109 main T shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:40.328 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:43.982 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:47.633 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:48.852 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:52.504 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:53.724 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:57.378 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
2:58.599 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:02.251 main O shadowfiend Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:03.473 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:04.694 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:08.346 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:09.565 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:10.787 main T shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:12.007 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:15.661 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:19.314 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:20.535 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:24.186 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:25.407 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:29.058 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
3:30.278 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:33.930 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:35.151 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:38.803 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:40.025 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:43.676 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:44.895 main T shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:46.115 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:49.768 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:50.991 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:54.644 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:58.295 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
3:59.518 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:00.739 main R shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:01.960 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:05.613 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:09.262 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:10.481 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:11.701 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:15.354 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:16.573 main T shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, sophic_devotion, static_empowerment(5)
4:17.795 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:21.448 main R shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:22.669 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:23.891 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:27.545 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:31.197 cds H potion Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5)
4:31.197 main Q shadow_word_pain Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:32.418 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:33.638 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:37.292 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.944 trinkets V use_items Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, static_empowerment(5), elemental_potion_of_ultimate_power
4:40.944 main P vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
4:42.164 main R shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
4:43.385 cds K desperate_prayer PR_Priest_Shadow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
4:43.385 main S mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
4:44.607 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
4:48.260 cds I blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
desperate_prayer, shadowform, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
4:48.260 main T shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, desperate_prayer, shadowform, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
4:49.482 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, desperate_prayer, shadowform, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
4:53.134 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, desperate_prayer, shadowform, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
4:56.787 filler L mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
blood_fury, shadowform, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3463 1 10805 10291 6827
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 216100 205820 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +687 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +515 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +687 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +687 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +89 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +515 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +386 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +386 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +687 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Talents

RowPriest Talents [1]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [2]
1
2
3
4
5
6
7
8
9
10

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIkAAAAAAAAAAAAAAAAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
# otion=elemental_potion_of_ultimate_power_ lask=phial_of_tepid_versatility_ ood=fated_fortune_cooki ugmentation=draconic_augment_run emporary_enchant=main_hand:howling_rune_
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/variable,name=mind_sear_cutoff,op=set,value=2
actions.precombat+=/variable,name=pool_amount,op=set,value=60
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice
actions.precombat+=/mind_blast,if=talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in>=25&spell_targets.shadow_crash<=8|fight_style.dungeonslice)
actions.precombat+=/vampiric_touch,if=!talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice)

# Executed every time the actor is available.
actions=variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
actions+=/variable,name=holding_crash,op=set,value=raid_event.adds.in<20
actions+=/run_action_list,name=aoe,if=spell_targets.mind_sear>2|spell_targets.vampiric_touch>3
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight
actions.aoe+=/shadow_crash,if=!variable.holding_crash
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
actions.aoe+=/dark_void,if=raid_event.adds.in>10
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)&(fight_remains<30|time_to_die>15)
# actions.aoe+=/run_action_list,name=aoe_pl_ire,if=talent.psychic_link.rank=2&talent.insidious_ire.rank=2 Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,if=cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time&talent.mind_devourer.rank=2&spell_targets.mind_sear>=3&!buff.mind_devourer.up&spell_targets.mind_sear<=7
actions.aoe+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7&!buff.mind_devourer.up
actions.aoe+=/void_bolt,if=insanity<=85
# Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks, or mind devourer is up on 2+ targets. If Mind Devourer is up do not cancel mind sear.
actions.aoe+=/mind_sear,target_if=max:spell_targets.mind_sear,if=buff.mind_devourer.up&spell_targets.mind_sear>1|spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3))&!variable.pool_for_cds,early_chain_if=ticks>=2&!buff.mind_devourer_ms_active.up,interrupt_immediate=1,interrupt_if=ticks>=2&!buff.mind_devourer_ms_active.up
actions.aoe+=/call_action_list,name=pl_torrent,if=talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=3&(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&((insanity>=50|dot.devouring_plague.ticking|buff.dark_reveries.up)|buff.voidform.up|buff.dark_ascension.up)
actions.aoe+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75&(!buff.mind_flay_insanity.up&talent.mind_flay_insanity|!talent.psychic_link))&variable.dp_cutoff
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight
actions.aoe+=/shadow_word_pain,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
# TODO: Check Yshaarj Gains for pressing this during Inescapable Torment.
actions.aoe+=/shadow_word_death,target_if=min:target.time_to_die,if=target.time_to_die<=5&insanity<=80&talent.death_and_madness
actions.aoe+=/damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
actions.aoe+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
actions.aoe+=/mindgames,if=spell_targets.mind_sear<5&dot.devouring_plague.ticking|talent.psychic_link
actions.aoe+=/void_torrent,if=insanity<=35&!talent.psychic_link,target_if=variable.dots_up
# High priority action for Mind Flay: Insanity to fish for Idol of C'Thun procs
actions.aoe+=/mind_flay,if=buff.mind_flay_insanity.up&buff.surge_of_darkness.remains>=5&talent.idol_of_cthun&buff.surge_of_darkness.stack<=2,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler


actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# Todo Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=vts_applied,op=set,value=(active_dot.vampiric_touch+8*action.shadow_crash.in_flight)>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up

# Todo Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active|!talent.mindbender&!cooldown.fiend.up|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.filler=mind_flay,if=buff.mind_flay_insanity.up&dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
actions.filler+=/vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/mind_spike,if=buff.surge_of_darkness.up
actions.filler+=/lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75|spell_targets.lights_judgment>1
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=raid_event.adds.in>20
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=target.health.pct<20&(spell_targets.mind_sear<4|talent.inescapable_torment.rank=2&pet.fiend.active)
# Save up to 10s if adds are coming soon.
actions.filler+=/divine_star,if=raid_event.adds.in>10
actions.filler+=/mind_spike,if=(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
actions.filler+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>30
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.filler+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.filler+=/shadow_word_pain,target_if=min:remains

actions.main=call_action_list,name=main_variables
actions.main+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
actions.main+=/mindbender,if=variable.dots_up&(fight_remains<30|time_to_die>15)
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
actions.main+=/damnation,target_if=dot.vampiric_touch.refreshable|dot.shadow_word_pain.refreshable
actions.main+=/void_bolt,if=variable.dots_up&insanity<=85
# Use Mind Devourer Procs on Mind Sear when facing 2 or more targets
actions.main+=/mind_sear,target_if=spell_targets.mind_sear>1&buff.mind_devourer.up
actions.main+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
actions.main+=/shadow_word_pain,target_if=min:remains,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
actions.main+=/shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
actions.main+=/mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# TODO: Dont use if add events are coming soon when talented into PL
actions.main+=/mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
actions.main+=/shadow_crash,if=!variable.holding_crash
actions.main+=/dark_void,if=raid_event.adds.in>20
actions.main+=/devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
# TODO: Dont use if add events are coming soon when talented into PL
actions.main+=/void_torrent,if=insanity<=35&!variable.holding_crash,target_if=variable.all_dots_up
actions.main+=/call_action_list,name=filler

actions.main_variables=variable,name=dots_up,op=set,value=(dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking)|action.shadow_crash.in_flight
actions.main_variables+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions.main_variables+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up

actions.pl_torrent=void_bolt
actions.pl_torrent+=/vampiric_touch,if=remains<=6&cooldown.void_torrent.remains<gcd*2
# Use Devouring Plague before Void Torrent cast if Voidform is not active and Mind Devourer is not active and fighting 4 or less targets or less not talented into Mind Sear
actions.pl_torrent+=/devouring_plague,if=remains<=4&cooldown.void_torrent.remains<gcd*2&!buff.voidform.up&(!talent.mind_sear|spell_targets.mind_sear<=4|!talent.surge_of_darkness&cooldown.mind_blast.full_recharge_time>=3)&!buff.mind_devourer.up
actions.pl_torrent+=/mind_sear,if=!variable.dp_cutoff|buff.mind_devourer.up
actions.pl_torrent+=/mind_blast,if=!talent.mindgames|cooldown.mindgames.remains>=3&!prev_gcd.1.mind_blast
actions.pl_torrent+=/void_torrent,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking|buff.voidform.up
actions.pl_torrent+=/mindgames,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&dot.devouring_plague.ticking|buff.voidform.up

actions.trinkets=use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
# Sync with cooldowns for Ancient Madness or use when the fight will end soon or at full stacks
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=fight_remains<20|!talent.ancient_madness|(cooldown.dark_ascension.remains>10&talent.dark_ascension)|(cooldown.void_eruption.remains>10&talent.void_eruption)|(!talent.void_eruption&!talent.dark_ascension)

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=6827
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 45462 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45461.9 45461.9 43.9 / 0.097% 7627.3 / 16.8% 58.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
738.4 736.4 Mana 0.66% 52.5 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAKRIJkgiAJtkkCiQQIBC

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 45462
Elemental Blast 8046 17.7% 20.9 14.23sec 115188 99125 Direct 20.9 95104 191123 115233 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.94 20.93 0.00 0.00 0.00 1.1621 0.0000 2411903.23 2411903.23 0.00% 99124.74 99124.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.04% 16.54 7 26 95104.15 45560 207468 95128.56 77691 117866 1573286 1573286 0.00%
crit 20.96% 4.39 0 15 191123.48 91119 399264 189505.30 0 332195 838617 838617 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:10.46
  • if_expr:talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
    single
    [O]:1.24
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
    single
    [S]:9.23
  • if_expr:talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
Flame Shock 4738 10.4% 84.0 3.57sec 16914 129538 Direct 84.0 6118 12288 7187 17.3% 0.0%
Periodic 192.3 3612 7266 4248 17.4% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 83.99 83.99 192.32 192.32 82.99 0.1306 1.5500 1420640.84 1420640.84 0.00% 4596.67 129537.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 69.44 39 108 6118.03 3695 13879 6117.45 5278 7323 424842 424842 0.00%
crit 17.33% 14.55 3 30 12287.51 7390 27441 12284.80 9821 18683 178810 178810 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.60% 158.87 113 206 3612.39 1894 8027 3612.03 3185 4236 573893 573893 0.00%
crit 17.40% 33.46 13 57 7266.24 3787 15697 7266.70 6147 8959 243096 243096 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [X]:9.14
Flametongue Weapon 0 (925) 0.0% (2.0%) 1.0 0.00sec 277353 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 925 2.0% 676.8 0.71sec 410 0 Direct 676.8 349 700 410 17.4% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 676.79 676.79 0.00 0.00 0.00 0.0000 0.0000 277352.88 277352.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 559.28 388 730 348.76 289 593 348.73 318 391 195058 195058 0.00%
crit 17.36% 117.51 68 178 700.32 579 1186 700.37 637 806 82295 82295 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1086 2.4% 28.3 7.77sec 11529 0 Direct 28.3 9806 19714 11529 17.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.27 28.27 0.00 0.00 0.00 0.0000 0.0000 325943.48 325943.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 23.36 1 61 9806.14 9732 10030 9806.08 9732 10030 229031 229031 0.00%
crit 17.39% 4.92 0 19 19713.63 19463 20059 19331.38 0 20059 96912 96912 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 5255 11.6% 39.9 7.50sec 39540 34119 Direct 39.9 33641 67388 39540 17.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.85 39.85 0.00 0.00 0.00 1.1589 0.0000 1575696.59 1575696.59 0.00% 34118.54 34118.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.52% 32.88 19 51 33640.84 7659 106953 33706.83 26156 46030 1106255 1106255 0.00%
crit 17.48% 6.97 0 19 67388.12 15317 216254 67557.46 0 169559 469442 469442 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [N]:35.40
  • if_expr:buff.hailstorm.up
    single
    [V]:4.45
Ice Strike 1885 4.1% 24.5 12.33sec 23026 19826 Direct 24.5 19595 39448 23025 17.3% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.54 24.54 0.00 0.00 0.00 1.1614 0.0000 564992.57 564992.57 0.00% 19825.69 19825.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.72% 20.30 11 29 19595.13 15009 43938 19593.69 16965 23244 397732 397732 0.00%
crit 17.28% 4.24 0 13 39448.21 30018 84225 38986.10 0 64921 167261 167261 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:24.54
  • if_expr:talent.hailstorm.enabled
Lava Lash 9208 20.3% 67.9 4.37sec 40633 34926 Direct 67.9 (67.9) 34559 69419 40632 17.4% (17.4%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.92 67.92 0.00 0.00 0.00 1.1634 0.0000 2759835.20 2759835.20 0.00% 34925.78 34925.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 56.09 28 93 34558.95 17703 117191 34570.15 29437 41838 1938341 1938341 0.00%
crit 17.42% 11.83 1 31 69418.80 35407 204727 69452.04 44891 119431 821494 821494 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [I]:50.07
  • if_expr:buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
    single
    [R]:17.85
Lightning Bolt 3315 7.3% 16.2 18.75sec 61291 51426 Direct 16.2 50426 101477 61288 21.3% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.21 16.21 0.00 0.00 0.00 1.1919 0.0000 993285.73 993285.73 0.00% 51425.61 51425.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.72% 12.76 5 23 50425.65 28814 129716 50573.11 39052 70423 643332 643332 0.00%
crit 21.28% 3.45 0 10 101477.06 57629 250126 99296.24 0 236761 349954 349954 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.89

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [K]:7.00
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [P]:0.28
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [T]:8.93
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1732 3.8% 193.4 1.81sec 2684 1508 Direct 193.4 2654 5336 2684 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.43 193.43 0.00 0.00 0.00 1.7800 0.0000 519229.11 741774.79 30.00% 1508.08 1508.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.20% 128.04 77 183 2653.83 2257 4339 2653.60 2428 2932 339806 485449 30.00%
crit 17.38% 33.63 15 62 5335.65 4513 8580 5334.85 4784 6278 179423 256326 30.00%
miss 16.42% 31.76 12 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 868 1.9% 193.4 1.80sec 1345 756 Direct 193.4 1329 2669 1345 17.4% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.43 193.43 0.00 0.00 0.00 1.7805 0.0000 260209.27 371737.01 30.00% 755.56 755.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.24% 128.13 82 177 1328.75 1128 2145 1328.71 1212 1467 170257 243231 30.00%
crit 17.42% 33.70 12 59 2669.30 2257 4290 2669.04 2358 3000 89952 128506 30.00%
miss 16.33% 31.60 13 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 162 (2857) 0.4% (6.3%) 7.0 45.72sec 121711 102256 Direct 7.0 (14.0) 5896 11835 6917 17.2% (19.1%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.00 1.1903 0.0000 48613.99 48613.99 0.00% 102256.41 102256.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.81% 5.82 2 8 5895.88 4707 9102 5899.61 4707 7741 34317 34317 0.00%
crit 17.19% 1.21 0 6 11834.96 9413 18224 8628.89 0 18224 14297 14297 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:7.03
  • if_expr:buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
    Lightning Bolt (_pw) 2695 5.9% 7.0 45.90sec 115344 0 Direct 7.0 95139 190947 115340 21.1% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.00 0.0000 0.0000 806965.36 806965.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.91% 5.52 1 8 95138.67 67234 194575 95190.36 67234 152441 525263 525263 0.00%
crit 21.09% 1.48 0 6 190946.55 134467 389149 153104.12 0 389149 281702 281702 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.89

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (1958) 0.0% (4.3%) 51.7 5.73sec 11364 9724

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.68 0.00 0.00 0.00 0.00 1.1687 0.0000 0.00 0.00 0.00% 9723.66 9723.66

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [Q]:51.68
    Stormstrike (_mh) 1305 2.9% 51.7 5.73sec 7574 0 Direct 51.7 6443 12957 7574 17.4% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.68 51.68 0.00 0.00 0.00 0.0000 0.0000 391455.35 559236.19 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 42.71 20 68 6443.44 5465 10690 6442.32 5782 7223 275222 393184 30.00%
crit 17.36% 8.97 0 22 12957.29 10930 21381 12951.62 0 16825 116233 166052 29.99%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 653 1.4% 51.7 5.73sec 3789 0 Direct 51.7 3222 6476 3789 17.4% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.68 51.68 0.00 0.00 0.00 0.0000 0.0000 195853.66 279798.08 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 42.67 23 66 3221.98 2733 5345 3221.40 2888 3629 137487 196415 30.00%
crit 17.44% 9.01 0 20 6476.24 5465 10690 6476.80 0 8522 58367 83383 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 777 1.7% 5.7 53.59sec 40596 34941 Direct 5.7 34601 69038 40595 17.4% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.74 5.74 0.00 0.00 0.00 1.1619 0.0000 232879.47 232879.47 0.00% 34940.65 34940.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 4.74 0 8 34601.07 26683 71389 34596.70 0 60429 163934 163934 0.00%
crit 17.41% 1.00 0 6 69038.36 53365 133066 45568.26 0 129508 68946 68946 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [U]:5.74
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (715) 0.0% (1.6%) 1.0 0.00sec 214316 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 715 1.6% 151.7 4.07sec 1412 0 Direct 151.7 1202 2415 1412 17.4% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 151.73 151.73 0.00 0.00 0.00 0.0000 0.0000 214316.32 306173.97 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 125.40 64 206 1202.03 1016 1988 1201.87 1077 1344 150737 215344 30.00%
crit 17.35% 26.33 6 52 2414.76 2032 3976 2414.44 2085 2827 63579 90830 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
pet - greater_earth_elemental 413 / 86
melee 413 0.2% 40.0 2.26sec 640 420 Direct 40.0 545 1090 640 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.01 40.01 0.00 0.00 0.00 1.5224 0.0000 25591.78 36560.61 30.00% 420.14 420.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.68% 33.08 8 64 545.25 475 919 544.31 475 702 18037 25767 30.00%
crit 17.32% 6.93 0 22 1090.03 950 1774 1088.95 0 1447 7555 10793 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2296 / 670
melee 2296 1.5% 89.2 3.40sec 2246 1997 Direct 89.2 1914 3826 2246 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.19 89.19 0.00 0.00 0.00 1.1248 0.0000 200336.92 286202.89 30.00% 1996.94 1996.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 73.68 7 186 1913.54 1588 3071 1911.03 1588 2505 140986 201413 30.00%
crit 17.39% 15.51 0 43 3826.18 3176 6141 3819.48 0 5229 59351 84790 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2298 / 672
melee 2298 1.5% 89.5 3.43sec 2247 1996 Direct 89.5 1914 3823 2247 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.50 89.50 0.00 0.00 0.00 1.1255 0.0000 201102.43 287296.51 30.00% 1996.41 1996.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.55% 73.88 1 169 1913.92 1588 3071 1911.51 1588 2418 141410 202020 30.00%
crit 17.45% 15.61 0 44 3823.19 3176 6141 3816.79 0 5323 59692 85277 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2292 / 669
melee 2292 1.5% 89.3 3.41sec 2247 1998 Direct 89.3 1914 3828 2247 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.25 89.25 0.00 0.00 0.00 1.1248 0.0000 200579.30 286549.17 30.00% 1997.92 1997.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 73.72 7 199 1914.12 1588 3071 1911.47 1588 2687 141104 201582 30.00%
crit 17.41% 15.54 0 44 3827.63 3176 6141 3821.53 0 5407 59475 84967 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 310.08sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.12 0.00 0.00 0.00 0.00 1.0194 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [W]:1.12
Feral Spirit 10.7 30.07sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.73 0.00 0.00 0.00 0.00 1.1797 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:10.73
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.19sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.49
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 67.5 124.8 4.4sec 1.6sec 3.6sec 81.46% 98.21% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.4s

Stack Uptimes

  • ashen_catalyst_1:31.49%
  • ashen_catalyst_2:16.74%
  • ashen_catalyst_3:12.09%
  • ashen_catalyst_4:9.86%
  • ashen_catalyst_5:6.16%
  • ashen_catalyst_6:3.09%
  • ashen_catalyst_7:1.60%
  • ashen_catalyst_8:0.45%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.0 0.0 48.4sec 48.4sec 14.7sec 29.21% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 315.2s
  • trigger_min/max:13.1s / 315.2s
  • trigger_pct:84.84%
  • duration_min/max:0.0s / 29.3s

Stack Uptimes

  • crackling_surge_1:23.30%
  • crackling_surge_2:5.91%
  • crackling_surge_3:0.00%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.5sec 12.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.9s
  • trigger_pct:100.00%
  • duration_min/max:16.2s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.35%
  • crumbling_power_3:0.58%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.67%
  • crumbling_power_7:0.66%
  • crumbling_power_8:0.66%
  • crumbling_power_9:0.65%
  • crumbling_power_10:0.63%
  • crumbling_power_11:0.63%
  • crumbling_power_12:0.63%
  • crumbling_power_13:0.63%
  • crumbling_power_14:0.64%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.73%
  • crumbling_power_17:0.78%
  • crumbling_power_18:0.83%
  • crumbling_power_19:0.99%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 7.0 0.0 41.0sec 41.0sec 9.8sec 22.81% 0.00% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 252.4s
  • trigger_min/max:10.0s / 252.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_critical_strike_1:22.81%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.0 0.0 40.8sec 40.8sec 9.8sec 22.82% 0.00% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 271.9s
  • trigger_min/max:10.0s / 271.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_haste_1:22.82%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.0 0.0 40.6sec 40.6sec 9.8sec 23.02% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 257.7s
  • trigger_min/max:10.0s / 257.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_mastery_1:23.02%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.0sec 98.7sec 57.8sec 24.75% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 349.5s

Stack Uptimes

  • elemental_chaos_air_1:24.75%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:Grants Haste and movement speed is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.2sec 99.1sec 58.3sec 25.25% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:25.25%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:Grants Mastery and damage taken reduced.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 122.5sec 98.9sec 57.9sec 25.02% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 337.8s

Stack Uptimes

  • elemental_chaos_fire_1:25.03%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:Grants Critical Strike and damage dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.5sec 98.4sec 58.2sec 24.98% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.3s

Stack Uptimes

  • elemental_chaos_frost_1:24.98%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:Grants Versatility and healing dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.3sec 302.3sec 27.5sec 13.37% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.6s
  • trigger_min/max:300.0s / 325.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.37%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 10.7 0.0 29.2sec 30.1sec 14.7sec 52.52% 0.00% 42.0 (42.0) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 48.5s
  • trigger_min/max:16.0s / 47.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • feral_spirit_1:52.52%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 49.7 230.9 6.1sec 1.1sec 4.8sec 79.00% 87.92% 230.9 (498.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 68.4s
  • trigger_min/max:0.0s / 18.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.4s

Stack Uptimes

  • flurry_1:21.79%
  • flurry_2:34.38%
  • flurry_3:22.82%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 58.0sec 46.9sec 12.9sec 19.35% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 215.4s
  • trigger_min/max:0.1s / 215.4s
  • trigger_pct:98.88%
  • duration_min/max:0.0s / 54.5s

Stack Uptimes

  • forgestorm_ignited_1:19.35%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 35.7 1.5 8.5sec 8.1sec 2.2sec 25.97% 88.94% 1.5 (10.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 34.4s
  • trigger_min/max:1.3s / 31.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.3s

Stack Uptimes

  • hailstorm_5:4.80%
  • hailstorm_6:3.41%
  • hailstorm_7:2.65%
  • hailstorm_8:4.35%
  • hailstorm_9:2.55%
  • hailstorm_10:8.22%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.6 5.6 27.6sec 17.6sec 9.9sec 35.05% 88.56% 5.6 (5.6) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 202.8s
  • trigger_min/max:0.0s / 197.1s
  • trigger_pct:5.01%
  • duration_min/max:0.0s / 53.5s

Stack Uptimes

  • hot_hand_1:35.05%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.5 0.0 12.4sec 12.3sec 4.0sec 32.27% 60.24% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 26.2s
  • trigger_min/max:7.7s / 25.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.8s

Stack Uptimes

  • ice_strike_1:32.27%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 6.0 0.0 48.3sec 48.3sec 14.7sec 29.17% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 327.9s
  • trigger_min/max:14.0s / 327.9s
  • trigger_pct:85.04%
  • duration_min/max:0.0s / 29.7s

Stack Uptimes

  • icy_edge_1:23.38%
  • icy_edge_2:5.79%
  • icy_edge_3:0.00%
  • icy_edge_4:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 38.0 227.3 8.0sec 1.1sec 6.9sec 87.43% 100.00% 16.9 (36.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 33.0s
  • trigger_min/max:0.0s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.8s

Stack Uptimes

  • maelstrom_weapon_1:11.16%
  • maelstrom_weapon_2:12.89%
  • maelstrom_weapon_3:13.23%
  • maelstrom_weapon_4:13.19%
  • maelstrom_weapon_5:10.16%
  • maelstrom_weapon_6:8.01%
  • maelstrom_weapon_7:6.18%
  • maelstrom_weapon_8:4.07%
  • maelstrom_weapon_9:2.26%
  • maelstrom_weapon_10:6.27%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 5.9 0.0 48.4sec 48.4sec 14.7sec 29.14% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 347.3s
  • trigger_min/max:13.1s / 347.3s
  • trigger_pct:85.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • molten_weapon_1:23.31%
  • molten_weapon_2:5.83%
  • molten_weapon_3:0.00%
  • molten_weapon_4:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 7.0 0.0 45.7sec 45.7sec 2.0sec 4.58% 43.77% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 51.6s
  • trigger_min/max:45.0s / 51.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.5s

Stack Uptimes

  • primordial_wave_1:4.58%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.1 60.9sec 45.7sec 16.5sec 23.54% 0.00% 1.1 (1.1) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 207.2s
  • trigger_min/max:0.1s / 195.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.4s

Stack Uptimes

  • sophic_devotion_1:23.54%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.5sec 45.2sec 32.2sec 38.37% 0.00% 25.8 (25.8) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 277.2s
  • trigger_min/max:0.1s / 198.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 166.9s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.33%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.27%
  • spiraling_winds_7:2.25%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.84%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 7.0 0.0 45.9sec 45.9sec 11.8sec 27.59% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:38.0s / 54.0s
  • trigger_min/max:38.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • splintered_elements_1:27.59%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 30.7 8.8 9.6sec 7.4sec 2.9sec 29.26% 58.38% 8.8 (8.8) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 105.5s
  • trigger_min/max:0.0s / 105.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.8s

Stack Uptimes

  • stormbringer_1:29.26%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.9 10.0 49.0 10.9s 1.1s 135.0s
windfury_totem_extra_attack_oh 26.8 7.0 49.0 10.9s 1.1s 135.5s
Elemental Blast: Critical Strike 7.0 0.0 15.0 41.0s 10.0s 252.4s
Elemental Blast: Haste 7.0 0.0 15.0 40.8s 10.0s 271.9s
Elemental Blast: Mastery 7.0 0.0 14.0 40.6s 10.0s 257.7s
Maelstrom Weapon: Feral Spirit 63.0 46.0 84.0 4.8s 0.0s 32.3s
Maelstrom Weapon: Swirling Maelstrom 59.9 43.0 78.0 5.0s 0.8s 25.0s
Maelstrom Weapon: Primordial Wave 70.3 60.0 80.0 45.7s 45.0s 51.6s
Maelstrom Weapon: Windfury Attack 30.3 9.0 61.0 10.8s 0.0s 129.6s
Maelstrom Weapon: main_hand 32.4 14.0 57.0 9.4s 1.1s 128.4s
Maelstrom Weapon: offhand 32.4 11.0 57.0 9.4s 1.1s 107.3s
Maelstrom Weapon: Sundering 1.1 0.0 5.0 106.8s 40.0s 343.9s
Maelstrom Weapon: Lava Lash 13.6 2.0 31.0 20.7s 0.8s 262.1s
Maelstrom Weapon: Ice Strike 4.9 0.0 15.0 51.0s 7.7s 316.2s
Maelstrom Weapon: Stormstrike 10.3 1.0 25.0 26.7s 0.8s 300.5s
Maelstrom Weapon: Stormstrike Off-Hand 10.3 0.0 24.0 26.7s 0.8s 233.4s
Flametongue: Windfury Attack 151.7 78.0 246.0 4.1s 0.0s 44.9s
Stormbringer: Windfury Attack 16.9 3.0 38.0 17.9s 0.0s 213.2s
Flametongue: main_hand 161.7 109.0 216.0 2.2s 1.1s 17.4s
Hot Hand: main_hand 8.1 0.0 22.0 33.0s 1.1s 290.3s
Windfury: main_hand 50.3 19.0 84.0 6.2s 1.1s 65.4s
Flametongue: offhand 161.8 112.0 213.0 2.2s 1.1s 16.2s
Hot Hand: offhand 8.1 0.0 21.0 32.9s 1.1s 290.9s
Flametongue: Sundering 5.7 1.0 8.0 53.7s 40.0s 190.0s
Stormbringer: Sundering 0.6 0.0 4.0 115.4s 40.0s 338.6s
Windfury: Sundering 1.8 0.0 7.0 96.9s 40.0s 338.4s
Flametongue: Lava Lash 67.9 34.0 113.0 4.4s 0.8s 15.4s
Stormbringer: Lava Lash 7.6 0.0 20.0 34.1s 0.8s 288.2s
Flametongue: Ice Strike 24.5 19.0 31.0 12.3s 7.7s 25.4s
Stormbringer: Ice Strike 2.7 0.0 10.0 70.0s 7.7s 346.7s
Windfury: Ice Strike 7.7 1.0 17.0 36.0s 7.7s 280.7s
Flametongue: Stormstrike 51.7 31.0 76.0 5.7s 0.8s 37.9s
Stormbringer: Stormstrike 5.8 0.0 16.0 41.2s 0.8s 322.9s
Windfury: Stormstrike 16.1 3.0 33.0 17.7s 0.8s 191.6s
Flametongue: Stormstrike Off-Hand 51.7 31.0 76.0 5.7s 0.8s 37.9s
Stormbringer: Stormstrike Off-Hand 5.8 0.0 17.0 41.5s 0.8s 314.8s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 23.26% 12.55% 29.72% 0.5s 0.0s 4.5s
Hot Hand 35.05% 8.45% 63.10% 9.9s 0.0s 53.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7050.0001.5257.5791.86513.337
Sundering14.2450.000212.41685.56533.266220.080
Primordial Wave0.7570.0006.6405.3340.93115.885
Windstrike
Stormstrike
1.8970.00027.91698.89548.443172.496
Lava Lash0.9050.00011.62361.79529.850105.459
Flame Shock25.3520.000318.702256.227168.607337.296
Ice Strike0.7770.00012.68019.1445.40244.861
Frost Shock2.8810.00027.981115.93566.831181.696
Elemental Blast2.6260.00036.48355.85211.769124.249
Earth Elemental30.8690.000247.00536.6277.323247.005

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack28.91.59.91%3.93%
main_hand30.51.910.46%5.28%
offhand30.61.810.48%4.92%
Feral Spirit58.84.220.15%11.38%
Sundering1.10.00.39%0.00%
Primordial Wave43.726.615.00%71.94%
Lava Lash12.80.74.39%2.03%
Ice Strike29.20.210.03%0.44%
Frost Shock35.40.012.14%0.01%
Stormstrike (_mh)10.30.03.53%0.00%
Stormstrike Off-Hand10.30.03.53%0.08%
Overflow Stacks0.036.90.00%11.24%
Actual Stacks291.60.088.76%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt129.745.07%
Elemental Blast158.154.93%
Total Spent287.8100.00%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana624.87220911.21100.00%353.53258460.5653.92%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 736.37 738.39 258460.0 49395.4 47000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 20.9428790.131375.001374.9783.78
Flame ShockMana 9.146854.59750.0081.61207.25
Frost ShockMana 39.8519925.08500.00500.0079.08
Ice StrikeMana 24.5440486.481650.001650.0113.96
Lava LashMana 67.9227169.18400.00400.01101.58
Lightning BoltMana 16.218103.39500.00500.02122.58
Primordial WaveMana 7.0310544.391500.001500.0081.14
StormstrikeMana 51.6851682.841000.00999.9911.36
SunderingMana 5.7417209.713000.003000.0413.53

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 45461.93
Minimum 38984.83
Maximum 53946.16
Spread ( max - min ) 14961.33
Range [ ( max - min ) / 2 * 100% ] 16.45%
Standard Deviation 1939.2621
5th Percentile 42379.32
95th Percentile 48816.78
( 95th Percentile - 5th Percentile ) 6437.46
Mean Distribution
Standard Deviation 22.3942
95.00% Confidence Interval ( 45418.04 - 45505.82 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6990
0.1 Scale Factor Error with Delta=300 32104
0.05 Scale Factor Error with Delta=300 128416
0.01 Scale Factor Error with Delta=300 3210382
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 45461.93
Minimum 38984.83
Maximum 53946.16
Spread ( max - min ) 14961.33
Range [ ( max - min ) / 2 * 100% ] 16.45%
Standard Deviation 1939.2621
5th Percentile 42379.32
95th Percentile 48816.78
( 95th Percentile - 5th Percentile ) 6437.46
Mean Distribution
Standard Deviation 22.3942
95.00% Confidence Interval ( 45418.04 - 45505.82 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6990
0.1 Scale Factor Error with Delta=300 32104
0.05 Scale Factor Error with Delta=300 128416
0.01 Scale Factor Error with Delta=300 3210382
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 45461.93
Minimum 38984.83
Maximum 53946.16
Spread ( max - min ) 14961.33
Range [ ( max - min ) / 2 * 100% ] 16.45%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 12999173.05
Minimum 9304609.42
Maximum 17317061.31
Spread ( max - min ) 8012451.90
Range [ ( max - min ) / 2 * 100% ] 30.82%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.49 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 10.73 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
G 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
H 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
I 50.07 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
0.00 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
0.00 ice_strike,if=buff.doom_winds.up
0.00 sundering,if=buff.doom_winds.up
J 7.03 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking
K 7.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
L 10.46 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
M 24.54 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
N 35.40 frost_shock,if=buff.hailstorm.up
0.00 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
0.00 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
O 1.24 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
P 0.28 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
Q 51.68 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
R 17.85 lava_lash
S 9.23 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
T 8.93 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 5.74 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
V 4.45 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
W 1.12 earth_elemental
X 9.14 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ACDEFBJKMNQRUQSINIMIQILINQRFMSINIQITINMQLNRTQNQWMRVQTJFKNIMIQILNQRUVMQTNRQXVMQQQQFILNQMJKNQQRVSXMNQQRIFILIMINIQLNRUQMQTNRXQVJFKMNQISNXQSNMRQVQTIINIMIQTNQQRFUMLDENJKQNRXMQSNRXIQIVIMFLNQILINIMQRTNUQXRQJKMFNQRSNXQMRLNQTXNQRMVQTXNRQUVFLIMIJIKINIQRMSNQQQRFLNMQIQI

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_frost
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), elemental_chaos_frost
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), crumbling_power(20), elemental_chaos_frost
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry(2), crumbling_power(20), elemental_chaos_frost
0:00.893 default B potion Fluffy_Pillow 40678.8/50000: 81% mana bloodlust, berserking, flurry, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon, crumbling_power(19), elemental_chaos_frost
0:00.893 single J primordial_wave Fluffy_Pillow 40678.8/50000: 81% mana bloodlust, berserking, flurry, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon, crumbling_power(19), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:01.787 single K lightning_bolt Fluffy_Pillow 40609.2/50000: 81% mana bloodlust, berserking, flurry(2), primordial_wave, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon(10), crumbling_power(19), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:02.681 single M ice_strike Fluffy_Pillow 41539.6/50000: 83% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hailstorm(10), crumbling_power(18), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:03.494 single N frost_shock Fluffy_Pillow 41190.4/50000: 82% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(17), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:04.308 single Q stormstrike Fluffy_Pillow 41992.8/50000: 84% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(3), crumbling_power(16), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:05.121 single R lava_lash Fluffy_Pillow 42293.6/50000: 85% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(4), crumbling_power(15), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:05.934 single U sundering Fluffy_Pillow 43194.4/50000: 86% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(4), crumbling_power(14), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.747 single Q stormstrike Fluffy_Pillow 41495.2/50000: 83% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), crumbling_power(13), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.559 single S elemental_blast Fluffy_Pillow 41794.4/50000: 84% mana bloodlust, berserking, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(7), crumbling_power(12), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:08.372 single I lava_lash Fluffy_Pillow 41720.2/50000: 83% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hot_hand, hailstorm(7), crumbling_power(11), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.161 single N frost_shock Fluffy_Pillow 42582.6/50000: 85% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(7), crumbling_power(10), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.951 single I lava_lash Fluffy_Pillow 43346.6/50000: 87% mana bloodlust, berserking, flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), crumbling_power(9), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:10.740 single M ice_strike Fluffy_Pillow 44209.0/50000: 88% mana bloodlust, berserking, flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(4), crumbling_power(8), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:11.528 single I lava_lash Fluffy_Pillow 43819.8/50000: 88% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(6), ice_strike, crumbling_power(7), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:12.318 single Q stormstrike Fluffy_Pillow 44683.8/50000: 89% mana bloodlust, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, crumbling_power(6), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:13.187 single I lava_lash Fluffy_Pillow 45074.2/50000: 90% mana bloodlust, flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), ice_strike, crumbling_power(5), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.054 single L elemental_blast Fluffy_Pillow 46061.4/50000: 92% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, crumbling_power(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.009 single I lava_lash Fluffy_Pillow 46214.4/50000: 92% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, crumbling_power(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.963 single N frost_shock Fluffy_Pillow 47340.8/50000: 95% mana bloodlust, elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, crumbling_power(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:16.918 single Q stormstrike Fluffy_Pillow 48368.8/50000: 97% mana bloodlust, elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), crumbling_power, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:17.870 single R lava_lash Fluffy_Pillow 48892.0/50000: 98% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:18.854 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, maelstrom_weapon(5), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:19.837 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(6), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.852 single S elemental_blast Fluffy_Pillow 49924.4/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(7), ice_strike, sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:21.834 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hot_hand, hailstorm(7), ice_strike, sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:22.816 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon, hailstorm(7), ice_strike, sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:23.800 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:24.783 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:25.766 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:26.750 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(5), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:27.734 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, hailstorm(5), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.717 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(5), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:29.701 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:30.683 single Q stormstrike Fluffy_Pillow 49921.2/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:31.668 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(8), ice_strike, sophic_devotion, elemental_chaos_frost
0:32.653 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon, hailstorm(8), ice_strike, elemental_chaos_frost
0:33.636 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(3), elemental_chaos_frost
0:34.620 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, maelstrom_weapon(5), elemental_chaos_frost
0:35.604 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, ashen_catalyst, hailstorm(5), elemental_chaos_frost
0:36.587 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(5), elemental_chaos_frost
0:37.571 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), elemental_chaos_frost
0:38.554 single W earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_frost
0:39.538 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(2), elemental_chaos_frost
0:40.520 single R lava_lash Fluffy_Pillow 49921.2/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(5), maelstrom_weapon(4), ice_strike, elemental_chaos_frost
0:41.798 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(4), ice_strike, elemental_chaos_frost
0:43.074 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(4), elemental_chaos_frost
0:44.482 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), maelstrom_weapon(5), elemental_chaos_frost
0:45.758 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon, hailstorm(5), elemental_chaos_frost
0:47.169 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(4), maelstrom_weapon(10), hailstorm(5), elemental_chaos_frost
0:48.445 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(10), hailstorm(5), elemental_chaos_frost
0:49.723 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), hailstorm(10), elemental_chaos_frost
0:50.883 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(6), hot_hand, maelstrom_weapon(3), elemental_chaos_frost
0:52.043 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), elemental_chaos_frost
0:53.202 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(6), ice_strike, elemental_chaos_frost
0:54.363 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, molten_weapon(2), hot_hand, maelstrom_weapon(7), ice_strike, elemental_chaos_frost
0:55.524 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(8), ice_strike, elemental_chaos_frost
0:56.687 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, elemental_chaos_frost
0:57.848 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, hailstorm(9), ice_strike, elemental_chaos_frost
0:59.009 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon, elemental_chaos_frost
1:00.171 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_earth
1:01.333 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(3), elemental_chaos_earth
1:02.610 single V frost_shock Fluffy_Pillow 49043.2/50000: 98% mana flurry(3), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(4), elemental_chaos_earth
1:03.955 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(5), elemental_chaos_earth
1:05.230 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_earth
1:06.506 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(8), ice_strike, elemental_chaos_earth
1:07.782 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), hailstorm(8), ice_strike, elemental_chaos_earth
1:09.058 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(6), maelstrom_weapon, elemental_chaos_earth
1:10.333 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), stormbringer, maelstrom_weapon, elemental_chaos_earth
1:11.609 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon, elemental_chaos_earth
1:12.884 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), maelstrom_weapon, elemental_chaos_earth
1:14.159 Waiting     2.384 sec 50000.0/50000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon, elemental_chaos_earth
1:16.543 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(4), maelstrom_weapon(2), elemental_chaos_earth
1:17.961 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(3), ice_strike, elemental_chaos_earth
1:19.239 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(6), stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_earth
1:20.516 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(6), stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_earth
1:21.794 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(7), stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_earth
1:23.070 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(8), maelstrom_weapon(9), ice_strike, forgestorm_ignited, elemental_chaos_earth
1:24.445 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, crackling_surge(2), ashen_catalyst(8), maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_earth
1:25.721 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, crackling_surge(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_earth
1:26.997 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon, hailstorm(10), ice_strike, forgestorm_ignited, elemental_chaos_earth
1:28.274 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_earth
1:29.551 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_earth
1:30.829 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(8), ice_strike, forgestorm_ignited, elemental_chaos_earth
1:32.168 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_earth
1:33.445 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(2), hailstorm(10), ice_strike, forgestorm_ignited, elemental_chaos_earth
1:34.605 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(6), maelstrom_weapon(3), elemental_chaos_earth
1:35.767 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(6), stormbringer, maelstrom_weapon(4), elemental_chaos_earth
1:36.928 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(7), maelstrom_weapon(4), elemental_chaos_earth
1:38.088 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(4), elemental_chaos_earth
1:39.250 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(2), maelstrom_weapon(5), elemental_chaos_earth
1:40.410 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, ashen_catalyst(2), hailstorm(5), elemental_chaos_earth
1:41.538 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, ashen_catalyst(3), hailstorm(5), elemental_chaos_earth
1:42.665 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, ashen_catalyst(4), maelstrom_weapon, hailstorm(5), ice_strike, elemental_chaos_earth
1:43.792 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, ashen_catalyst(5), maelstrom_weapon(3), elemental_chaos_earth
1:44.918 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(5), stormbringer, maelstrom_weapon(4), elemental_chaos_earth
1:46.158 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(6), maelstrom_weapon(6), elemental_chaos_earth
1:47.398 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), spiraling_winds, elemental_chaos_earth
1:48.636 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), spiraling_winds, elemental_chaos_earth
1:49.875 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds(2), elemental_chaos_earth
1:51.152 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), spiraling_winds(3), elemental_chaos_earth
1:52.430 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), spiraling_winds(3), elemental_chaos_earth
1:53.669 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), spiraling_winds(4), elemental_chaos_earth
1:54.927 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds(4), elemental_chaos_earth
1:56.167 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), ice_strike, spiraling_winds(5), elemental_chaos_earth
1:57.408 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), spiraling_winds(6), elemental_chaos_earth
1:58.648 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), spiraling_winds(6), elemental_chaos_earth
1:59.888 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(9), spiraling_winds(7), elemental_chaos_earth
2:01.128 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(2), hailstorm(9), spiraling_winds(8), elemental_chaos_frost
2:02.368 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(8), elemental_chaos_frost
2:03.645 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, molten_weapon(2), ashen_catalyst, maelstrom_weapon(4), spiraling_winds(9), elemental_chaos_frost
2:04.923 single Q stormstrike Fluffy_Pillow 49044.8/50000: 98% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_frost
2:06.214 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_frost
2:07.489 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(3), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_frost
2:08.766 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_frost
2:10.043 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), hailstorm(8), ice_strike, spiraling_winds(10), elemental_chaos_frost
2:11.320 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon, spiraling_winds(10), elemental_chaos_frost
2:12.596 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, maelstrom_weapon, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:13.873 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:15.148 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:16.425 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:17.701 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(4), maelstrom_weapon(10), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:18.978 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(10), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:20.254 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), hailstorm(10), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:21.415 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:22.578 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:23.741 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), maelstrom_weapon(6), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:24.901 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(6), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:26.062 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hailstorm(6), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
2:27.224 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
2:28.386 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
2:29.547 Waiting     0.208 sec 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
2:29.755 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
2:30.917 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hailstorm(5), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
2:32.078 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
2:33.354 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(6), maelstrom_weapon(3), ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
2:34.632 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(3), ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
2:35.908 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(4), ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
2:37.278 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:38.554 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:39.831 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), hot_hand, maelstrom_weapon, hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:41.108 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana hot_hand, maelstrom_weapon(2), hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:42.386 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_frost
2:43.664 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), hot_hand, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
2:44.940 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
2:46.217 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_frost
2:47.493 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_frost
2:48.770 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_frost
2:50.047 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), hailstorm(7), ice_strike, spiraling_winds(10), elemental_chaos_frost
2:51.323 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), stormbringer, maelstrom_weapon, spiraling_winds(10), elemental_chaos_frost
2:52.601 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(4), stormbringer, maelstrom_weapon, spiraling_winds(10), elemental_chaos_frost
2:53.876 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_frost
2:55.152 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_frost
2:56.428 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
2:57.705 single M ice_strike Fluffy_Pillow 49043.2/50000: 98% mana flurry, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
2:58.982 single L elemental_blast Fluffy_Pillow 49436.4/50000: 99% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(9), ice_strike, spiraling_winds(10), elemental_chaos_frost
3:00.258 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), hailstorm(9), ice_strike, spiraling_winds(10), elemental_chaos_fire
3:00.258 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), hailstorm(9), ice_strike, crumbling_power(20), spiraling_winds(10), elemental_chaos_fire
3:00.258 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), hailstorm(9), ice_strike, crumbling_power(20), spiraling_winds(10), elemental_chaos_fire
3:01.420 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(3), crumbling_power(19), spiraling_winds(10), elemental_chaos_fire
3:02.586 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(10), crumbling_power(19), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:03.746 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(6), hailstorm(10), crumbling_power(18), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:04.804 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(7), maelstrom_weapon(2), hailstorm(10), crumbling_power(17), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:05.861 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(7), maelstrom_weapon(3), crumbling_power(16), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:06.916 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(3), crumbling_power(15), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:07.973 Waiting     0.669 sec 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(4), crumbling_power(14), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:08.642 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(4), crumbling_power(14), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:09.935 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(5), ice_strike, crumbling_power(13), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:10.992 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, splintered_elements, ashen_catalyst(4), maelstrom_weapon(6), ice_strike, crumbling_power(12), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:12.049 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_critical_strike, splintered_elements, ashen_catalyst(5), hailstorm(6), ice_strike, crumbling_power(11), forgestorm_ignited, elemental_chaos_fire
3:13.104 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst(6), maelstrom_weapon, crumbling_power(10), forgestorm_ignited, elemental_chaos_fire
3:14.265 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, maelstrom_weapon, crumbling_power(9), elemental_chaos_fire
3:15.426 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon, crumbling_power(8), elemental_chaos_fire
3:16.703 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(2), crumbling_power(7), elemental_chaos_fire
3:17.981 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), crumbling_power(6), elemental_chaos_fire
3:19.258 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, hot_hand, maelstrom_weapon(3), crumbling_power(5), elemental_chaos_fire
3:20.535 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(4), elemental_chaos_fire
3:21.811 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), elemental_chaos_fire
3:23.087 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(6), ice_strike, elemental_chaos_fire
3:24.429 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(8), ice_strike, elemental_chaos_fire
3:25.705 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), hailstorm(8), ice_strike, sophic_devotion, elemental_chaos_fire
3:26.982 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
3:28.259 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), hot_hand, stormbringer, maelstrom_weapon(7), sophic_devotion, elemental_chaos_fire
3:29.535 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(9), sophic_devotion, elemental_chaos_fire
3:30.812 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(9), sophic_devotion, elemental_chaos_fire
3:32.053 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(9), sophic_devotion, elemental_chaos_fire
3:33.293 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
3:34.531 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
3:35.770 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_fire
3:37.010 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_fire
3:38.251 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst, maelstrom_weapon(8), ice_strike, sophic_devotion, elemental_chaos_fire
3:39.490 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(2), hailstorm(8), ice_strike, sophic_devotion, elemental_chaos_fire
3:40.728 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), maelstrom_weapon, sophic_devotion, elemental_chaos_fire
3:42.004 single Q stormstrike Fluffy_Pillow 49041.6/50000: 98% mana ashen_catalyst(3), maelstrom_weapon, sophic_devotion, elemental_chaos_fire
3:43.297 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(4), maelstrom_weapon, sophic_devotion, elemental_chaos_fire
3:44.573 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon, sophic_devotion, elemental_chaos_fire
3:45.863 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana stormbringer, maelstrom_weapon, elemental_chaos_fire
3:47.139 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, maelstrom_weapon, elemental_chaos_fire
3:48.414 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst(2), maelstrom_weapon(10), elemental_chaos_fire
3:49.691 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(3), hailstorm(10), elemental_chaos_fire
3:50.852 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(3), maelstrom_weapon, hailstorm(10), ice_strike, elemental_chaos_fire
3:52.013 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), hailstorm(10), ice_strike, elemental_chaos_fire
3:53.174 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(4), elemental_chaos_fire
3:54.334 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(5), elemental_chaos_fire
3:55.495 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(5), elemental_chaos_fire
3:56.657 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(5), elemental_chaos_fire
3:57.817 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), elemental_chaos_fire
3:58.979 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_fire
4:00.139 Waiting     0.993 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), elemental_chaos_frost
4:01.132 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), elemental_chaos_frost
4:02.623 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(6), ice_strike, elemental_chaos_frost
4:03.899 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(8), ice_strike, elemental_chaos_frost
4:05.176 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(2), hailstorm(8), ice_strike, forgestorm_ignited, elemental_chaos_frost
4:06.452 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_frost
4:07.728 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_frost
4:09.004 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(4), hailstorm(7), forgestorm_ignited, elemental_chaos_frost
4:10.280 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), stormbringer, maelstrom_weapon, hailstorm(7), forgestorm_ignited, elemental_chaos_frost
4:11.555 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_frost
4:12.832 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(6), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_frost
4:14.108 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_frost
4:15.385 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, maelstrom_weapon(4), ice_strike, forgestorm_ignited, elemental_chaos_frost
4:16.662 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), stormbringer, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_frost
4:17.938 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_frost
4:19.215 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(4), hailstorm(5), forgestorm_ignited, elemental_chaos_frost
4:20.494 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), hailstorm(5), forgestorm_ignited, elemental_chaos_frost
4:21.770 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), maelstrom_weapon, forgestorm_ignited, elemental_chaos_frost
4:23.047 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon, forgestorm_ignited, elemental_chaos_frost
4:24.324 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), maelstrom_weapon(3), elemental_chaos_frost
4:25.601 single V frost_shock Fluffy_Pillow 49043.2/50000: 98% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(3), elemental_chaos_frost
4:26.879 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(4), elemental_chaos_frost
4:28.155 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(8), elemental_chaos_frost
4:29.430 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), hot_hand, hailstorm(8), elemental_chaos_frost
4:30.706 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon, hailstorm(8), elemental_chaos_frost
4:31.984 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(8), ice_strike, elemental_chaos_frost
4:33.261 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(4), hailstorm(8), ice_strike, elemental_chaos_frost
4:34.538 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), hailstorm(8), ice_strike, elemental_chaos_frost
4:35.815 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, primordial_wave, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(10), hailstorm(8), ice_strike, elemental_chaos_frost
4:37.091 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, elemental_chaos_frost
4:38.255 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, elemental_chaos_frost
4:39.417 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), elemental_chaos_frost
4:40.579 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), sophic_devotion, elemental_chaos_frost
4:41.742 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
4:42.903 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst, maelstrom_weapon(6), sophic_devotion, elemental_chaos_frost
4:44.063 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(2), maelstrom_weapon(7), ice_strike, sophic_devotion, elemental_chaos_frost
4:45.225 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(7), ice_strike, sophic_devotion, elemental_chaos_frost
4:46.353 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(3), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
4:47.480 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, ashen_catalyst(4), stormbringer, maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
4:48.607 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(5), stormbringer, maelstrom_weapon(6), sophic_devotion, elemental_chaos_frost
4:49.847 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(6), maelstrom_weapon(7), sophic_devotion, elemental_chaos_frost
4:51.087 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(7), sophic_devotion, elemental_chaos_frost
4:52.327 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(8), sophic_devotion, elemental_chaos_frost
4:53.566 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon, hailstorm(8), sophic_devotion, elemental_chaos_frost
4:54.805 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_frost
4:56.103 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(5), ice_strike, elemental_chaos_frost
4:57.380 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), hot_hand, maelstrom_weapon(7), ice_strike, elemental_chaos_frost
4:58.657 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_frost
4:59.934 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(7), ice_strike, elemental_chaos_frost

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.82% 15.82% 1047
Haste 21.67% 17.84% 3032
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 58.69% 58.69% 3842
Armor 3603 3603 3603
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +386 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAKRIJkgiAJtkkCiQQIBC

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Gamba : 46188 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
46187.7 46187.7 79.6 / 0.172% 13958.7 / 30.2% 50.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
855.1 852.5 Mana 1.49% 52.3 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikCC

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Gamba 46188
Ascendance (_dre) 0 (993) 0.0% (2.1%) 8.1 31.68sec 36765 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.09 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 993 2.1% 8.1 31.68sec 36765 0 Direct 8.1 30786 61780 36764 19.3% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.09 8.09 0.00 0.00 0.00 0.0000 0.0000 297440.27 297440.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 6.53 0 19 30786.19 25295 51006 30759.88 0 42776 201034 201034 0.00%
crit 19.29% 1.56 0 8 61779.55 50590 100641 48670.96 0 99493 96406 96406 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 77 0.2% 3.7 90.41sec 6189 5660 Direct 3.7 6189 0 6189 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0936 0.0000 23100.00 33000.85 30.00% 5660.38 5660.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 6188.95 3670 13032 6205.45 4819 8560 23100 33001 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6990 15.1% 25.3 11.67sec 82700 70460 Direct 25.3 68277 137161 82734 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.35 25.34 0.00 0.00 0.00 1.1737 0.0000 2096190.01 2096190.01 0.00% 70460.17 70460.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.01% 20.02 10 29 68276.87 43655 135035 68276.16 54407 83961 1366814 1366814 0.00%
crit 20.99% 5.32 0 14 137161.44 87310 273870 136862.50 0 240554 729376 729376 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [R]:25.35
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
Flame Shock 1519 3.3% 30.7 9.62sec 14818 33804 Direct 30.7 2733 5485 3211 17.4% 0.0%
Periodic 187.4 1621 3255 1904 17.3% 0.0% 97.1%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.74 30.74 187.42 187.42 29.58 0.4383 1.5546 455504.33 455504.33 0.00% 1494.28 33803.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 25.40 11 44 2732.88 2271 4687 2733.06 2417 3135 69407 69407 0.00%
crit 17.38% 5.34 0 16 5484.55 4543 9374 5457.76 0 8004 29307 29307 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.67% 154.94 112 204 1620.55 2 2788 1620.32 1482 1837 251087 251087 0.00%
crit 17.33% 32.48 12 62 3254.54 2 5512 3254.26 2873 3798 105703 105703 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [N]:1.16
  • if_expr:!ticking
    single
    [Z]:10.50
Flametongue Weapon 0 (1482) 0.0% (3.2%) 1.0 0.00sec 444110 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1482 3.2% 1113.5 0.67sec 399 0 Direct 1113.5 340 682 399 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1113.48 1113.48 0.00 0.00 0.00 0.0000 0.0000 444109.77 444109.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.68% 920.66 622 1275 339.64 277 570 339.69 310 377 312696 312696 0.00%
crit 17.32% 192.82 114 296 681.54 554 1140 681.73 617 753 131414 131414 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1105 2.4% 28.8 7.58sec 11517 0 Direct 28.8 9805 19712 11517 17.3% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.77 28.77 0.00 0.00 0.00 0.0000 0.0000 331284.02 331284.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 23.80 2 64 9805.25 9732 10030 9805.29 9732 10030 233331 233331 0.00%
crit 17.27% 4.97 0 19 19712.02 19463 20059 19320.02 0 20059 97953 97953 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1061 2.3% 17.3 16.31sec 18426 15743 Direct 17.3 15665 31546 18427 17.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.26 17.26 0.00 0.00 0.00 1.1704 0.0000 318069.78 318069.78 0.00% 15742.91 15742.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 14.26 3 31 15664.62 7338 29843 15720.33 11832 21511 223393 223393 0.00%
crit 17.39% 3.00 0 11 31545.83 14677 59686 30164.67 0 52031 94677 94677 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [X]:17.26
Ice Strike 1448 3.1% 21.1 14.34sec 20581 17770 Direct 21.1 17521 35086 20580 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.09 21.09 0.00 0.00 0.00 1.1582 0.0000 434051.70 434051.70 0.00% 17770.07 17770.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 17.42 8 27 17521.01 14382 29675 17523.63 15229 20052 305151 305151 0.00%
crit 17.42% 3.67 0 11 35085.92 28763 58000 34350.29 0 54340 128900 128900 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:2.64
  • if_expr:buff.doom_winds.up
    single
    [T]:18.45
Lava Lash 1361 2.9% 19.1 15.36sec 21402 18264 Direct 19.1 18165 36577 21403 17.6% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.08 19.08 0.00 0.00 0.00 1.1719 0.0000 408293.79 408293.79 0.00% 18264.09 18264.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.42% 15.72 7 25 18165.44 15146 31252 18159.77 16058 21198 285609 285609 0.00%
crit 17.58% 3.35 0 11 36576.54 30292 61788 35483.13 0 55795 122685 122685 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [O]:3.65
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [U]:15.43
Lightning Bolt 3118 6.8% 18.5 15.35sec 50649 43120 Direct 18.5 41569 83336 50648 21.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.47 18.47 0.00 0.00 0.00 1.1747 0.0000 935571.51 935571.51 0.00% 43119.86 43119.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.26% 14.46 3 26 41568.97 27610 87329 41567.84 32055 52961 600922 600922 0.00%
crit 21.74% 4.02 0 12 83335.96 55220 172997 81909.98 0 141589 334649 334649 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.89

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [S]:5.07
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [V]:13.41
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1465 3.2% 164.0 2.13sec 2679 1577 Direct 164.0 2651 5326 2679 17.3% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 164.02 164.02 0.00 0.00 0.00 1.6983 0.0000 439369.85 627687.22 30.00% 1577.35 1577.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.27% 108.69 54 165 2650.93 2257 4339 2650.66 2409 2950 288118 411608 30.00%
crit 17.32% 28.40 8 54 5325.75 4513 8677 5325.31 4703 6262 151251 216079 30.00%
miss 16.42% 26.93 10 52 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 752 1.6% 167.8 2.07sec 1344 791 Direct 167.8 1328 2668 1344 17.4% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 167.81 167.81 0.00 0.00 0.00 1.6986 0.0000 225558.38 322234.47 30.00% 791.31 791.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.28% 111.22 60 161 1328.22 1128 2169 1328.12 1203 1476 147727 211044 30.00%
crit 17.38% 29.17 10 54 2668.21 2257 4339 2667.88 2349 3066 77831 111190 30.00%
miss 16.34% 27.42 9 52 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7553) 0.0% (16.4%) 91.8 3.26sec 24663 21228

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 91.80 0.00 0.00 0.00 0.00 1.1618 0.0000 0.00 0.00 0.00% 21227.57 21227.57

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:12.95
  • if_expr:buff.doom_winds.up
    single
    [Q]:78.86
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Stormstrike (_mh) 4068 (5036) 8.8% (10.9%) 122.4 3.26sec 12331 0 Direct 122.4 (183.5) 8474 17027 9961 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.43 122.43 0.00 0.00 0.00 0.0000 0.0000 1219501.26 1742189.08 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 101.14 48 171 8473.88 2623 22860 8490.66 7030 9991 857014 1224337 30.00%
crit 17.39% 21.29 3 45 17026.58 5246 44361 17062.09 11678 24873 362488 517853 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 968 2.1% 61.1 5.49sec 4751 0 Direct 61.1 4751 0 4751 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.05 61.05 0.00 0.00 0.00 0.0000 0.0000 290074.66 290074.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.05 20 112 4751.47 1152 20245 4765.48 3632 6218 290075 290075 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2033 (2517) 4.4% (5.5%) 122.4 3.26sec 6163 0 Direct 122.4 (183.5) 4236 8519 4979 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.43 122.43 0.00 0.00 0.00 0.0000 0.0000 609566.45 870831.42 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 101.20 42 170 4236.33 1312 11299 4244.77 3561 5153 428696 612438 30.00%
crit 17.34% 21.23 4 43 8519.46 2623 22860 8535.56 5498 12016 180870 258393 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 484 1.0% 61.1 5.49sec 2375 0 Direct 61.1 2375 0 2375 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.05 61.05 0.00 0.00 0.00 0.0000 0.0000 144968.98 144968.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.05 20 112 2374.61 576 9180 2381.71 1860 3122 144969 144969 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1028 2.2% 6.5 48.51sec 47470 40954 Direct 6.5 40475 81416 47472 17.1% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.49 6.49 0.00 0.00 0.00 1.1592 0.0000 307970.58 307970.58 0.00% 40953.53 40953.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.91% 5.38 1 9 40474.90 25567 88799 40514.28 30096 56730 217705 217705 0.00%
crit 17.09% 1.11 0 6 81416.20 51135 163367 57111.27 0 147361 90265 90265 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [M]:1.74
  • if_expr:buff.doom_winds.up
    single
    [W]:4.74
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (6790) 0.0% (14.7%) 1.0 0.00sec 2032019 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6790 14.7% 411.8 2.43sec 4934 0 Direct 411.8 4203 8429 4934 17.3% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 411.84 411.84 0.00 0.00 0.00 0.0000 0.0000 2032019.08 2902958.42 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 340.60 200 501 4202.88 1423 11556 4200.72 3572 5095 1431490 2045037 30.00%
crit 17.30% 71.24 36 121 8429.17 2845 23304 8423.18 6372 10966 600529 857921 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 502 1.1% 32.6 8.70sec 4619 3321 Direct 32.6 3805 7654 4619 21.1% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.56 32.56 0.00 0.00 0.00 1.3908 0.0000 150405.05 150405.05 0.00% 3321.37 3321.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.85% 25.68 0 72 3805.30 3224 6198 3802.90 0 5101 97703 97703 0.00%
crit 21.15% 6.89 0 24 7654.19 6448 12396 7569.28 0 11671 52702 52702 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 293 0.6% 38.0 7.49sec 2309 1601 Direct 38.0 1902 3820 2308 21.2% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.00 38.00 0.00 0.00 0.00 1.4422 0.0000 87719.69 87719.69 0.00% 1600.72 1600.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.79% 29.94 0 87 1901.62 1612 3099 1900.68 0 2713 56936 56936 0.00%
crit 21.21% 8.06 0 28 3820.19 3224 6198 3795.99 0 5564 30784 30784 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (5850) 0.0% (12.7%) 23.3 10.21sec 75310 65613

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.26 0.00 0.00 0.00 0.00 1.1478 0.0000 0.00 0.00 0.00% 65612.76 65612.76

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:23.26
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [P]:0.01
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1573 (1884) 3.4% (4.1%) 31.1 10.21sec 18166 0 Direct 31.0 (42.6) 12899 26023 15168 17.3% (12.6%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 31.06 31.05 0.00 0.00 0.00 0.0000 0.0000 470968.06 470968.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.71% 25.68 0 82 12899.31 3748 33657 12885.34 0 20690 331272 331272 0.00%
crit 17.29% 5.37 0 21 26023.50 7495 62719 25256.38 0 48892 139696 139696 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 312 0.7% 11.5 19.81sec 8086 0 Direct 11.5 8086 0 8086 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.54 11.54 0.00 0.00 0.00 0.0000 0.0000 93304.08 93304.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.54 0 37 8085.90 3316 27203 7981.15 0 15908 93304 93304 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 785 (940) 1.7% (2.0%) 31.1 10.21sec 9061 0 Direct 31.0 (42.6) 6455 12965 7568 17.1% (12.5%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 31.06 31.05 0.00 0.00 0.00 0.0000 0.0000 234989.94 234989.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.89% 25.74 0 81 6454.57 1874 16828 6445.57 0 10810 166126 166126 0.00%
crit 17.11% 5.31 0 21 12964.53 3748 30059 12607.12 0 26239 68864 68864 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 155 0.3% 11.5 19.81sec 4028 0 Direct 11.5 4028 0 4028 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.54 11.54 0.00 0.00 0.00 0.0000 0.0000 46480.35 46480.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.54 0 37 4028.16 1509 13483 3979.01 0 8363 46480 46480 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3026 6.5% 23.3 10.22sec 38966 0 Direct 23.3 32157 64490 38965 21.1% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.26 23.26 0.00 0.00 0.00 0.0000 0.0000 906183.75 906183.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.94% 18.36 0 55 32156.51 15339 56970 32105.96 0 44943 590370 590370 0.00%
crit 21.06% 4.90 0 23 64489.88 30678 109804 62472.64 0 109804 315814 315814 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.89

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 423 / 89
melee 423 0.2% 41.2 2.40sec 643 430 Direct 41.2 547 1095 643 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.17 41.17 0.00 0.00 0.00 1.4952 0.0000 26465.28 37808.51 30.00% 429.88 429.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 34.01 19 64 547.35 475 902 546.33 475 681 18615 26593 30.00%
crit 17.41% 7.17 0 23 1095.46 950 1715 1092.75 0 1437 7851 11215 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 3900 / 2714
melee 3900 5.9% 365.4 1.63sec 2224 1948 Direct 365.4 1896 3787 2224 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 365.43 365.43 0.00 0.00 0.00 1.1417 0.0000 812799.77 1161172.13 30.00% 1948.20 1948.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 302.04 194 438 1896.22 1588 3106 1896.75 1755 2115 572736 818216 30.00%
crit 17.35% 63.39 24 105 3787.04 3176 6212 3788.41 3367 4436 240063 342956 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Gamba
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.2 308.53sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.16 0.00 0.00 0.00 0.00 0.9987 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Y]:1.16
Feral Spirit 14.7 21.46sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.69 0.00 0.00 0.00 0.00 1.1534 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:14.69
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 307.41sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.48
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 6.5 0.0 41.1sec 41.1sec 7.4sec 16.00% 88.72% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 320.7s
  • trigger_min/max:6.0s / 320.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 60.0s

Stack Uptimes

  • ascendance_1:16.00%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.8sec 12.71% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.0s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.73%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.74%
  • crumbling_power_19:1.21%
  • crumbling_power_20:0.06%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4sec 90.4sec 7.9sec 9.88% 11.45% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 14.7 0.0 24.1sec 21.0sec 17.4sec 69.56% 100.00% 0.0 (0.0) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.7s / 111.1s
  • trigger_min/max:6.7s / 46.5s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 97.6s

Stack Uptimes

  • earthen_weapon_2:67.32%
  • earthen_weapon_4:2.23%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 8.4 0.0 34.0sec 34.0sec 9.8sec 27.55% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 298.3s
  • trigger_min/max:10.0s / 298.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_critical_strike_1:27.55%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.5 0.0 33.8sec 33.8sec 9.8sec 27.77% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 244.9s
  • trigger_min/max:10.0s / 244.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_haste_1:27.77%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.5 0.0 33.7sec 33.7sec 9.8sec 27.79% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 227.6s
  • trigger_min/max:10.0s / 227.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_mastery_1:27.79%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 124.9sec 101.7sec 58.0sec 24.88% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 347.7s

Stack Uptimes

  • elemental_chaos_air_1:24.88%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:Grants Haste and movement speed is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.7sec 100.2sec 58.1sec 25.34% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 314.2s

Stack Uptimes

  • elemental_chaos_earth_1:25.34%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:Grants Mastery and damage taken reduced.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 123.5sec 99.0sec 57.8sec 25.02% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 337.3s

Stack Uptimes

  • elemental_chaos_fire_1:25.02%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:Grants Critical Strike and damage dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.7sec 97.2sec 58.3sec 24.76% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 322.1s

Stack Uptimes

  • elemental_chaos_frost_1:24.76%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:Grants Versatility and healing dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.4sec 307.4sec 27.4sec 13.28% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.3s
  • trigger_min/max:300.0s / 329.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.28%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 12.0 2.7 26.1sec 21.5sec 17.4sec 69.56% 0.00% 59.2 (59.2) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 111.1s
  • trigger_min/max:6.7s / 46.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 97.6s

Stack Uptimes

  • feral_spirit_1:69.56%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 44.0 382.6 6.8sec 0.7sec 5.8sec 85.02% 90.69% 382.6 (907.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 63.8s
  • trigger_min/max:0.0s / 16.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 62.3s

Stack Uptimes

  • flurry_1:19.99%
  • flurry_2:34.82%
  • flurry_3:30.21%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 119.9 17.7sec 2.2sec 14.6sec 84.77% 100.00% 56.9 (56.9) 16.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 50.7s
  • trigger_min/max:0.0s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.68%
  • forceful_winds_2:13.88%
  • forceful_winds_3:12.52%
  • forceful_winds_4:10.67%
  • forceful_winds_5:33.02%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.2sec 46.2sec 12.9sec 19.49% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 213.6s
  • trigger_min/max:0.2s / 213.6s
  • trigger_pct:98.86%
  • duration_min/max:0.0s / 56.2s

Stack Uptimes

  • forgestorm_ignited_1:19.49%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 19.8 1.3 15.3sec 14.3sec 7.8sec 51.28% 79.50% 1.3 (1.3) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.3s / 76.4s
  • trigger_min/max:8.3s / 76.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.7s

Stack Uptimes

  • ice_strike_1:51.28%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 23.7 19.7 12.6sec 6.8sec 7.7sec 61.10% 100.00% 19.7 (19.7) 23.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 84.9s
  • trigger_min/max:0.8s / 34.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.0s

Stack Uptimes

  • legacy_of_the_frost_witch_1:61.10%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 51.3 414.6 5.9sec 0.6sec 5.1sec 86.54% 100.00% 66.6 (71.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 44.7s
  • trigger_min/max:0.0s / 8.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.5s

Stack Uptimes

  • maelstrom_weapon_1:8.91%
  • maelstrom_weapon_2:10.56%
  • maelstrom_weapon_3:12.17%
  • maelstrom_weapon_4:12.61%
  • maelstrom_weapon_5:8.39%
  • maelstrom_weapon_6:7.11%
  • maelstrom_weapon_7:5.50%
  • maelstrom_weapon_8:4.74%
  • maelstrom_weapon_9:3.86%
  • maelstrom_weapon_10:12.69%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.0sec 45.4sec 16.6sec 23.73% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 203.0s
  • trigger_min/max:0.0s / 203.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.0s

Stack Uptimes

  • sophic_devotion_1:23.73%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.1sec 45.7sec 32.1sec 38.01% 0.00% 25.5 (25.5) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 267.5s
  • trigger_min/max:0.1s / 204.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 184.0s

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.29%
  • spiraling_winds_4:2.27%
  • spiraling_winds_5:2.26%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.21%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.65%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 6.5 0.0 41.1sec 41.1sec 7.4sec 16.00% 100.00% 41.6 (41.6) 6.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 320.7s
  • trigger_min/max:6.0s / 320.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 60.0s

Stack Uptimes

  • static_accumulation_1:16.00%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 62.0 19.0 4.8sec 3.7sec 1.1sec 23.22% 53.53% 19.0 (19.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 63.2s
  • trigger_min/max:0.0s / 63.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • stormbringer_1:23.22%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.7 30.0 69.0 17.8s 15.0s 66.3s
Windfury-ForcefulWinds: 2 51.4 30.0 69.0 18.0s 0.7s 64.0s
Windfury-ForcefulWinds: 3 49.8 30.0 69.0 18.6s 0.5s 82.3s
Windfury-ForcefulWinds: 4 46.5 21.0 66.0 19.8s 1.1s 89.1s
Windfury-ForcefulWinds: 5 212.4 99.0 363.0 4.7s 0.0s 92.2s
windfury_totem_extra_attack_mh 27.9 9.0 52.0 10.5s 1.2s 160.0s
windfury_totem_extra_attack_oh 29.5 11.0 53.0 9.9s 0.1s 104.2s
Elemental Blast: Critical Strike 8.4 1.0 17.0 34.0s 10.0s 298.3s
Elemental Blast: Haste 8.5 2.0 17.0 33.8s 10.0s 244.9s
Elemental Blast: Mastery 8.5 1.0 17.0 33.7s 10.0s 227.6s
Windfury: Unruly Winds 137.3 80.0 201.0 2.4s 0.0s 37.8s
Maelstrom Weapon: Feral Spirit 79.8 55.0 111.0 3.8s 0.0s 31.5s
Maelstrom Weapon: Elemental Assault 115.1 75.0 166.0 2.6s 0.8s 9.7s
Maelstrom Weapon: Static Accumulation 95.8 0.0 276.0 4.9s 1.0s 315.7s
Stormflurry 38.4 13.0 77.0 10.1s 0.8s 115.3s
Legacy of the Frost Witch: Bugged Trigger 10.5 0.0 33.0 23.0s 1.6s 318.5s
Maelstrom Weapon: Windfury Attack 82.2 40.0 130.0 4.7s 0.0s 73.0s
Maelstrom Weapon: main_hand 27.4 9.0 56.0 11.0s 1.2s 141.8s
Maelstrom Weapon: Windlash 6.5 0.0 26.0 33.4s 1.2s 334.5s
Maelstrom Weapon: offhand 28.1 10.0 51.0 10.7s 1.2s 143.0s
Maelstrom Weapon: Windlash Off-Hand 7.6 0.0 26.0 29.8s 0.2s 322.0s
Maelstrom Weapon: Doom Winds 0.7 0.0 4.0 138.8s 90.0s 273.0s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 105.3s 40.0s 342.1s
Maelstrom Weapon: Windstrike 6.2 0.0 26.0 35.4s 0.8s 310.6s
Maelstrom Weapon: Windstrike Off-Hand 6.2 0.0 24.0 35.0s 0.8s 317.0s
Maelstrom Weapon: Lava Lash 3.8 0.0 11.0 58.2s 8.4s 306.6s
Maelstrom Weapon: Ice Strike 4.2 0.0 13.0 55.7s 8.3s 326.5s
Maelstrom Weapon: Stormstrike 24.4 5.0 46.0 12.7s 0.8s 175.2s
Maelstrom Weapon: Stormstrike Off-Hand 24.4 8.0 47.0 12.7s 0.8s 199.4s
Flametongue: Windfury Attack 411.8 240.0 603.0 2.4s 0.0s 37.8s
Stormbringer: Windfury Attack 43.7 17.0 83.0 7.8s 0.0s 98.8s
Flametongue: main_hand 137.1 71.0 202.0 2.6s 1.2s 71.4s
Windfury: main_hand 52.3 25.0 86.0 6.2s 1.2s 85.2s
Flametongue: Windlash 32.6 0.0 90.0 8.7s 1.2s 317.4s
Windfury: Windlash 12.2 0.0 38.0 20.3s 1.2s 328.7s
Flametongue: offhand 140.4 74.0 198.0 2.6s 1.2s 64.2s
Flametongue: Windlash Off-Hand 38.0 0.0 103.0 7.5s 0.1s 315.0s
Flametongue: Sundering 6.5 4.0 9.0 48.6s 40.0s 151.7s
Stormbringer: Sundering 0.7 0.0 4.0 111.1s 40.0s 324.6s
Windfury: Sundering 3.2 0.0 8.0 87.1s 40.0s 352.1s
Flametongue: Windstrike 31.0 0.0 96.0 10.2s 0.8s 317.2s
Stormbringer: Windstrike 3.2 0.0 18.0 49.8s 0.8s 343.6s
Windfury: Windstrike 12.0 0.0 39.0 21.7s 0.8s 320.4s
Flametongue: Windstrike Off-Hand 31.0 0.0 96.0 10.2s 0.8s 317.2s
Stormbringer: Windstrike Off-Hand 3.3 0.0 19.0 48.9s 0.8s 335.0s
Flametongue: Lava Lash 19.1 11.0 26.0 15.4s 8.4s 62.7s
Stormbringer: Lava Lash 2.1 0.0 8.0 76.4s 8.8s 332.0s
Flametongue: Ice Strike 21.1 13.0 29.0 14.3s 8.3s 76.4s
Stormbringer: Ice Strike 2.2 0.0 11.0 76.5s 8.3s 329.5s
Windfury: Ice Strike 8.3 2.0 17.0 36.0s 8.3s 296.0s
Flametongue: Stormstrike 122.4 51.0 198.0 3.3s 0.8s 61.1s
Stormbringer: Stormstrike 12.9 1.0 32.0 22.2s 0.8s 267.9s
Windfury: Stormstrike 49.3 11.0 88.0 7.1s 0.8s 103.4s
Flametongue: Stormstrike Off-Hand 122.4 51.0 198.0 3.3s 0.8s 61.1s
Stormbringer: Stormstrike Off-Hand 12.9 1.0 35.0 22.1s 0.8s 241.4s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 25.18% 14.70% 49.18% 0.8s 0.0s 19.9s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.6920.0001.48210.1833.60518.171
Doom Winds0.5260.0002.4361.9650.8395.359
Sundering8.4120.000111.72256.64410.123167.028
Windstrike
Stormstrike
0.9840.0005.117113.50066.882184.330
Lava Lash4.1610.00050.51480.32733.431150.828
Flame Shock19.3900.000227.958246.534165.820333.744
Ice Strike2.8010.00064.32559.94215.371137.258
Frost Shock12.0940.000191.097219.872137.186314.650
Elemental Blast0.4050.00030.30210.2715.03739.333
Earth Elemental24.5970.000206.35730.1248.402206.357

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack66.216.014.97%22.35%
main_hand24.23.25.47%4.50%
Windlash5.51.01.25%1.38%
offhand24.53.65.55%5.00%
Windlash Off-Hand6.61.01.48%1.43%
Feral Spirit69.410.315.70%14.40%
Doom Winds0.70.10.15%0.10%
Sundering1.10.20.25%0.29%
Windstrike23.30.05.26%0.00%
Windstrike (_mh)6.20.01.40%0.02%
Windstrike Off-Hand6.20.01.40%0.04%
Lava Lash3.60.20.82%0.27%
Ice Strike4.00.20.90%0.32%
Stormstrike76.215.617.24%21.72%
Stormstrike (_mh)20.83.64.71%5.02%
Stormstrike Off-Hand20.73.84.68%5.24%
Ascendance (_dre)82.912.818.76%17.91%
Overflow Stacks0.071.70.00%13.95%
Actual Stacks442.20.086.05%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt135.430.93%
Elemental Blast195.544.65%
Lightning Bolt (_ti)106.924.42%
Total Spent437.9100.00%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Gamba
mana_regenMana666.26255739.30100.00%383.84223656.2446.65%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 852.47 855.12 223655.6 49204.1 43569.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Gamba
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 25.3534852.151375.001375.0060.15
Flame ShockMana 11.668747.93750.00284.5752.07
Frost ShockMana 17.268630.85500.00499.9836.85
Ice StrikeMana 21.0934798.921650.001650.0012.47
Lava LashMana 19.087630.77400.00400.0053.51
Lightning BoltMana 18.479236.10500.00500.01101.30
StormstrikeMana 122.43122425.141000.001333.5518.49
SunderingMana 6.4919463.403000.003000.0615.82

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Gamba Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Gamba Damage Per Second
Count 7499
Mean 46187.66
Minimum 35416.17
Maximum 60104.63
Spread ( max - min ) 24688.46
Range [ ( max - min ) / 2 * 100% ] 26.73%
Standard Deviation 3517.7642
5th Percentile 40781.25
95th Percentile 52291.91
( 95th Percentile - 5th Percentile ) 11510.66
Mean Distribution
Standard Deviation 40.6224
95.00% Confidence Interval ( 46108.04 - 46267.28 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 223
0.1% Error 22284
0.1 Scale Factor Error with Delta=300 105638
0.05 Scale Factor Error with Delta=300 422550
0.01 Scale Factor Error with Delta=300 10563726
Priority Target DPS
PR_Shaman_Enhancement_Gamba Priority Target Damage Per Second
Count 7499
Mean 46187.66
Minimum 35416.17
Maximum 60104.63
Spread ( max - min ) 24688.46
Range [ ( max - min ) / 2 * 100% ] 26.73%
Standard Deviation 3517.7642
5th Percentile 40781.25
95th Percentile 52291.91
( 95th Percentile - 5th Percentile ) 11510.66
Mean Distribution
Standard Deviation 40.6224
95.00% Confidence Interval ( 46108.04 - 46267.28 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 223
0.1% Error 22284
0.1 Scale Factor Error with Delta=300 105638
0.05 Scale Factor Error with Delta=300 422550
0.01 Scale Factor Error with Delta=300 10563726
DPS(e)
PR_Shaman_Enhancement_Gamba Damage Per Second (Effective)
Count 7499
Mean 46187.66
Minimum 35416.17
Maximum 60104.63
Spread ( max - min ) 24688.46
Range [ ( max - min ) / 2 * 100% ] 26.73%
Damage
PR_Shaman_Enhancement_Gamba Damage
Count 7499
Mean 13002695.34
Minimum 8443406.10
Maximum 18928380.10
Spread ( max - min ) 10484974.00
Range [ ( max - min ) / 2 * 100% ] 40.32%
DTPS
PR_Shaman_Enhancement_Gamba Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Gamba Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Gamba Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Gamba Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Gamba Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Gamba Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_GambaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Gamba Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.48 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 14.69 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
G 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 23.26 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
K 12.95 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
L 2.64 ice_strike,if=buff.doom_winds.up
M 1.74 sundering,if=buff.doom_winds.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
N 1.16 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
0.00 frost_shock,if=buff.hailstorm.up
O 3.65 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
P 0.01 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
Q 78.86 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 25.35 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
S 5.07 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
0.00 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
T 18.45 ice_strike
U 15.43 lava_lash
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
V 13.41 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 4.74 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
X 17.26 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Y 1.16 earth_elemental
Z 10.50 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGBKLKKKKKMNRQRTQUVQJFJVJJJRJJFJTSQQQORQXYTVQQVQUQXWFQQRQTURXQZXVQQQRTUXQZXFQRQTQUVQGKMKRKKQTQSQFORXQVQTXZRQJJJUFJJTJQQQQRQUWRQQFQTSQUVXZQRQQTVQUXZQQQFRTUQQDERGKKMVKKKQRQQQFOSQTXZRQVQUXZTQQQRQXUZWQQQFQQJJJJRQTOFQRQJJRJTUSQQFQQRQTUWVQXGZRKLKUVQQXZFRQQTUVQVQR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 2 augmentation PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_frost
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, maelstrom_weapon, elemental_chaos_frost
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, maelstrom_weapon, crumbling_power(20), elemental_chaos_frost
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, maelstrom_weapon, crumbling_power(20), elemental_chaos_frost
0:00.866 default G doom_winds Fluffy_Pillow 40635.6/50000: 81% mana bloodlust, berserking, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), crumbling_power(19), elemental_chaos_frost
0:01.731 default B potion Fluffy_Pillow 42019.6/50000: 84% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), doom_winds, crumbling_power(19), elemental_chaos_frost
0:01.731 single K stormstrike Fluffy_Pillow 42019.6/50000: 84% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), doom_winds, crumbling_power(19), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:02.596 single L ice_strike Fluffy_Pillow 42403.6/50000: 85% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), doom_winds, crumbling_power(18), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:03.462 single K stormstrike Fluffy_Pillow 42139.2/50000: 84% mana bloodlust, berserking, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, crumbling_power(17), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:04.328 single K stormstrike Fluffy_Pillow 42524.8/50000: 85% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(16), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:05.194 single K stormstrike Fluffy_Pillow 42910.4/50000: 86% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(15), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.062 single K stormstrike Fluffy_Pillow 43299.2/50000: 87% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(14), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.929 single K stormstrike Fluffy_Pillow 43686.4/50000: 87% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(13), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.796 single M sundering Fluffy_Pillow 44073.6/50000: 88% mana bloodlust, berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(12), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:08.663 single N flame_shock Fluffy_Pillow 42460.8/50000: 85% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(11), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.531 single R elemental_blast Fluffy_Pillow 43099.6/50000: 86% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(10), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:10.399 single Q stormstrike Fluffy_Pillow 43113.4/50000: 86% mana bloodlust, berserking, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:11.238 single R elemental_blast Fluffy_Pillow 42455.8/50000: 85% mana bloodlust, berserking, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:12.080 single T ice_strike Fluffy_Pillow 42428.0/50000: 85% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:13.005 single Q stormstrike Fluffy_Pillow 42258.0/50000: 85% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:13.929 single U lava_lash Fluffy_Pillow 42736.4/50000: 85% mana bloodlust, flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.855 single V lightning_bolt Fluffy_Pillow 43818.0/50000: 88% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, crumbling_power(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.781 single Q stormstrike Fluffy_Pillow 44799.6/50000: 90% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:16.707 single J windstrike Fluffy_Pillow 45281.2/50000: 91% mana bloodlust, ascendance, flurry(3), elemental_blast_haste, elemental_blast_mastery, stormbringer, maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:17.631 default F feral_spirit Fluffy_Pillow 46759.6/50000: 94% mana bloodlust, ascendance, flurry(2), elemental_blast_haste, elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:18.555 single J windstrike Fluffy_Pillow 48238.0/50000: 96% mana bloodlust, ascendance, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:19.480 single V lightning_bolt Fluffy_Pillow 49718.0/50000: 99% mana bloodlust, ascendance, flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.405 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:21.377 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:22.332 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:23.286 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:24.240 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:25.194 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:26.148 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:27.101 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.055 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(9), legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:29.010 single S lightning_bolt Fluffy_Pillow 49878.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:29.964 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:30.918 single Q stormstrike Fluffy_Pillow 49526.4/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:31.872 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:32.825 single O lava_lash Fluffy_Pillow 48524.8/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:33.780 single R elemental_blast Fluffy_Pillow 49652.8/50000: 99% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:34.734 single Q stormstrike Fluffy_Pillow 49804.2/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:35.660 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:36.587 single Y earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
0:37.511 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
0:38.437 single V lightning_bolt Fluffy_Pillow 49831.6/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
0:39.362 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, sophic_devotion, elemental_chaos_frost
0:40.289 single Q stormstrike Fluffy_Pillow 49483.2/50000: 99% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, sophic_devotion, elemental_chaos_frost
0:41.493 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_frost
0:42.697 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
0:43.899 single U lava_lash Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
0:45.138 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
0:46.377 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
0:47.616 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
0:49.034 default F feral_spirit Fluffy_Pillow 48980.8/50000: 98% mana flurry(3), forceful_winds(4), stormbringer, maelstrom_weapon(8), sophic_devotion, elemental_chaos_frost
0:50.274 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), sophic_devotion, elemental_chaos_frost
0:51.514 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), sophic_devotion, elemental_chaos_frost
0:52.752 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), sophic_devotion, elemental_chaos_frost
0:53.990 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
0:55.229 single T ice_strike Fluffy_Pillow 49982.4/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_frost
0:56.470 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:57.708 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
0:58.947 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, elemental_chaos_frost
1:00.185 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, elemental_chaos_fire
1:01.423 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_fire
1:02.661 Waiting     1.028 sec 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_fire
1:03.689 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_fire
1:05.121 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, maelstrom_weapon(5), sophic_devotion, elemental_chaos_fire
1:06.359 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:07.598 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:08.838 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:10.076 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(7), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:11.314 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, sophic_devotion, elemental_chaos_fire
1:12.515 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, ice_strike, sophic_devotion, elemental_chaos_fire
1:13.719 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, ice_strike, sophic_devotion, elemental_chaos_fire
1:14.919 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
1:16.119 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_fire
1:17.320 Waiting     0.968 sec 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
1:18.288 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
1:19.713 Waiting     0.308 sec 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
1:20.021 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_fire
1:21.225 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_fire
1:22.462 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(9), forgestorm_ignited, elemental_chaos_fire
1:23.702 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:24.940 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:26.178 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:27.417 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:28.658 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, elemental_chaos_fire
1:29.896 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:31.134 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:32.372 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:33.611 single M sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), doom_winds, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:34.850 single K stormstrike Fluffy_Pillow 48982.4/50000: 98% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, ice_strike, forgestorm_ignited, elemental_chaos_fire
1:36.089 single R elemental_blast Fluffy_Pillow 49964.8/50000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(10), doom_winds, ice_strike, forgestorm_ignited, elemental_chaos_fire
1:37.327 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), doom_winds, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:38.565 single K stormstrike Fluffy_Pillow 48980.8/50000: 98% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:39.804 single Q stormstrike Fluffy_Pillow 49963.2/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:41.041 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(7), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:42.279 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_fire
1:43.517 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(10), ice_strike, elemental_chaos_fire
1:44.754 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:45.994 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:47.233 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:48.471 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_fire
1:49.711 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds, elemental_chaos_fire
1:50.951 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(2), elemental_chaos_fire
1:52.190 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(2), elemental_chaos_fire
1:53.427 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_fire
1:54.666 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_fire
1:55.903 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_fire
1:57.141 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_fire
1:58.381 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(6), elemental_chaos_fire
1:59.619 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), spiraling_winds(7), elemental_chaos_fire
2:00.821 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), static_accumulation, spiraling_winds(7), elemental_chaos_earth
2:02.025 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth
2:03.226 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, stormbringer, maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
2:04.429 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
2:05.632 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:06.835 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:08.037 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:09.238 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:10.476 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:11.733 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:12.973 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:14.213 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:15.451 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:16.690 single R elemental_blast Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:17.928 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:19.166 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:20.403 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:21.641 single R elemental_blast Fluffy_Pillow 48980.8/50000: 98% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:22.882 single Q stormstrike Fluffy_Pillow 49591.4/50000: 99% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:24.085 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:25.289 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:26.491 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:27.694 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_earth
2:28.898 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_earth
2:30.100 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:31.303 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:32.506 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:33.744 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:34.982 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_earth
2:36.221 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_earth
2:37.462 single R elemental_blast Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(6), elemental_chaos_earth
2:38.698 single Q stormstrike Fluffy_Pillow 49585.0/50000: 99% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
2:39.938 single Q stormstrike Fluffy_Pillow 49569.0/50000: 99% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_earth
2:41.176 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_earth
2:42.416 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:43.655 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:44.895 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:46.135 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:47.376 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
2:48.612 Waiting     1.037 sec 50000.0/50000: 100% mana forceful_winds(5), maelstrom_weapon(3), elemental_chaos_earth
2:49.649 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(5), maelstrom_weapon(3), elemental_chaos_earth
2:51.061 single Q stormstrike Fluffy_Pillow 49977.6/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(4), elemental_chaos_earth
2:52.300 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(5), elemental_chaos_earth
2:53.538 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(7), sophic_devotion, elemental_chaos_earth
2:54.775 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(8), sophic_devotion, elemental_chaos_earth
2:56.012 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), sophic_devotion, elemental_chaos_earth
2:57.216 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, sophic_devotion, elemental_chaos_earth
2:58.419 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, sophic_devotion, elemental_chaos_earth
2:59.623 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_earth
3:00.826 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, sophic_devotion, elemental_chaos_air
3:00.826 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, crumbling_power(20), sophic_devotion, elemental_chaos_air
3:00.826 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, crumbling_power(20), sophic_devotion, elemental_chaos_air
3:01.885 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(19), sophic_devotion, elemental_chaos_air
3:02.946 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), sophic_devotion, elemental_chaos_air
3:04.006 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(18), sophic_devotion, elemental_chaos_air
3:05.067 single M sundering Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(17), sophic_devotion, elemental_chaos_air
3:06.158 single V lightning_bolt Fluffy_Pillow 48745.6/50000: 97% mana berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), doom_winds, ice_strike, crumbling_power(16), sophic_devotion, elemental_chaos_air
3:07.251 single K stormstrike Fluffy_Pillow 49994.4/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), sophic_devotion, elemental_chaos_air
3:08.343 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_air
3:09.433 single K stormstrike Fluffy_Pillow 49744.0/50000: 99% mana berserking, flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(7), doom_winds, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_air
3:10.524 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_air
3:11.615 single R elemental_blast Fluffy_Pillow 49745.6/50000: 99% mana berserking, flurry(2), forceful_winds(5), maelstrom_weapon(10), crumbling_power(11), elemental_chaos_air
3:12.705 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, forceful_winds(5), legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_air
3:13.797 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_air
3:14.997 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_air
3:16.197 default F feral_spirit Fluffy_Pillow 49920.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(7), legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_air
3:17.398 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), crumbling_power(6), elemental_chaos_air
3:18.598 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), crumbling_power(5), elemental_chaos_air
3:19.796 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(4), elemental_chaos_air
3:20.996 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:22.195 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:23.394 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:24.593 Waiting     0.619 sec 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
3:25.212 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_air
3:26.411 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), spiraling_winds, forgestorm_ignited, elemental_chaos_air
3:27.611 single V lightning_bolt Fluffy_Pillow 49920.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds, forgestorm_ignited, elemental_chaos_air
3:28.811 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_air
3:30.012 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_air
3:31.214 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, elemental_chaos_air
3:32.413 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_air
3:33.614 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(3), spiraling_winds(4), elemental_chaos_air
3:34.815 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(3), ice_strike, spiraling_winds(5), elemental_chaos_air
3:36.015 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(5), elemental_chaos_air
3:37.215 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(6), elemental_chaos_air
3:38.414 single R elemental_blast Fluffy_Pillow 48918.4/50000: 98% mana flurry(2), forceful_winds, maelstrom_weapon(9), ice_strike, spiraling_winds(7), elemental_chaos_air
3:39.613 single Q stormstrike Fluffy_Pillow 49461.8/50000: 99% mana flurry, elemental_blast_critical_strike, forceful_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_air
3:40.814 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air
3:42.014 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air
3:43.215 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_air
3:44.414 Waiting     0.480 sec 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_air
3:44.894 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_air
3:46.266 single Q stormstrike Fluffy_Pillow 48918.4/50000: 98% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_air
3:47.466 single Q stormstrike Fluffy_Pillow 49838.4/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_air
3:48.666 single Q stormstrike Fluffy_Pillow 49758.4/50000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_air
3:49.867 default F feral_spirit Fluffy_Pillow 49680.0/50000: 99% mana flurry(3), forceful_winds(3), stormbringer, maelstrom_weapon(9), spiraling_winds(10), elemental_chaos_air
3:51.065 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_air
3:52.264 single Q stormstrike Fluffy_Pillow 49918.4/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), elemental_chaos_air
3:53.464 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, elemental_chaos_air
3:54.663 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, elemental_chaos_air
3:55.865 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_air
3:57.066 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:58.266 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:59.465 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
4:00.665 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:01.904 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:03.143 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:04.383 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(9), ice_strike, forgestorm_ignited, elemental_chaos_earth
4:05.621 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_earth
4:06.861 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:08.063 single J windstrike Fluffy_Pillow 48923.2/50000: 98% mana ascendance, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:09.266 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:10.470 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:11.671 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:12.873 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, elemental_chaos_earth
4:14.077 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:15.279 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:16.481 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:17.721 single Q stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:18.960 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:20.201 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:21.440 single Q stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_earth
4:22.679 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_earth
4:23.919 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:25.156 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
4:26.395 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:27.632 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:28.870 single V lightning_bolt Fluffy_Pillow 48980.8/50000: 98% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_earth
4:30.109 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), ice_strike, elemental_chaos_earth
4:31.347 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, elemental_chaos_earth
4:32.584 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_earth
4:33.822 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), doom_winds, elemental_chaos_earth
4:35.059 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(7), doom_winds, elemental_chaos_earth
4:36.296 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, elemental_chaos_earth
4:37.534 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, elemental_chaos_earth
4:38.771 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:40.011 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(9), doom_winds, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:41.250 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(9), ice_strike, elemental_chaos_earth
4:42.487 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:43.725 single Q stormstrike Fluffy_Pillow 48980.8/50000: 98% mana elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:44.964 single X frost_shock Fluffy_Pillow 49963.2/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:46.203 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth
4:47.440 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(4), elemental_chaos_earth
4:48.678 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), elemental_chaos_earth
4:49.918 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), elemental_chaos_earth
4:51.157 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(2), elemental_chaos_earth
4:52.396 single T ice_strike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), elemental_chaos_earth
4:53.634 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, elemental_chaos_earth
4:54.873 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), ice_strike, elemental_chaos_earth
4:56.111 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:57.349 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:58.587 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:59.826 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 25.38% 21.55% 3663
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Gamba"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikCC

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Phys : 44171 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
44171.2 44171.2 49.2 / 0.111% 8488.2 / 19.2% 48.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
855.2 852.3 Mana 1.98% 52.0 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikGC

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Phys 44171
Ascendance 0 (323) 0.0% (0.7%) 2.0 180.44sec 47838 44172

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0834 0.0000 0.00 0.00 0.00% 44172.17 44172.17

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [G]:2.00
  • if_expr:(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
    Ascendance (_damage) 323 0.7% 2.0 180.44sec 47838 0 Direct 2.0 40270 80984 47836 18.6% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 95676.93 95676.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.41% 1.63 0 2 40269.74 35123 52193 38823.37 0 52193 65568 65568 0.00%
crit 18.59% 0.37 0 2 80984.03 70246 104386 27210.61 0 104386 30108 30108 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 77 0.2% 3.7 90.47sec 6171 5644 Direct 3.7 6171 0 6171 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0935 0.0000 22971.38 32817.10 30.00% 5644.07 5644.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.72 3 4 6170.55 3670 9854 6189.74 4974 8019 22971 32817 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.72
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6593 15.0% 25.0 11.66sec 79069 67084 Direct 25.0 65290 131118 79099 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.02 25.01 0.00 0.00 0.00 1.1786 0.0000 1977982.89 1977982.89 0.00% 67084.38 67084.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.02% 19.76 9 28 65289.51 43655 135035 65283.39 53171 80410 1290179 1290179 0.00%
crit 20.98% 5.25 0 14 131117.86 87310 260860 130790.47 0 220062 687804 687804 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [S]:25.02
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
Flame Shock 1524 3.5% 33.6 8.71sec 13608 27560 Direct 33.6 2695 5413 3171 17.5% 0.0%
Periodic 184.9 1615 3241 1897 17.4% 0.0% 96.1%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.61 33.61 184.87 184.87 32.51 0.4938 1.5599 457332.79 457332.79 0.00% 1499.58 27560.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.50% 27.73 13 44 2695.43 2271 4687 2694.83 2439 3051 74737 74737 0.00%
crit 17.50% 5.88 0 16 5413.22 4543 9033 5396.82 0 7247 31831 31831 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.62% 152.73 107 198 1614.57 1 2788 1614.24 1472 1796 246600 246600 0.00%
crit 17.38% 32.14 12 57 3241.10 15 5512 3240.70 2888 3729 104165 104165 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [O]:1.10
  • if_expr:!ticking
    single
    [b]:13.07
Flametongue Weapon 0 (1435) 0.0% (3.3%) 1.0 0.00sec 429826 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1435 3.3% 1073.3 0.69sec 400 0 Direct 1073.3 341 684 400 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1073.30 1073.30 0.00 0.00 0.00 0.0000 0.0000 429825.66 429825.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 887.92 624 1187 341.25 277 570 341.33 315 381 302999 302999 0.00%
crit 17.27% 185.38 109 287 684.13 554 1140 684.34 630 783 126827 126827 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1106 2.5% 28.8 7.64sec 11526 0 Direct 28.8 9806 19717 11526 17.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.80 28.80 0.00 0.00 0.00 0.0000 0.0000 331907.08 331907.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 23.80 2 63 9805.72 9732 10030 9805.75 9732 10030 233346 233346 0.00%
crit 17.36% 5.00 0 18 19716.93 19463 20059 19337.64 0 20059 98561 98561 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1215 2.8% 20.4 13.70sec 17849 15057 Direct 20.4 15217 30527 17849 17.2% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.45 20.45 0.00 0.00 0.00 1.1855 0.0000 364975.75 364975.75 0.00% 15056.76 15056.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.81% 16.93 4 29 15216.57 7338 30284 15253.77 11723 19434 257664 257664 0.00%
crit 17.19% 3.52 0 13 30526.65 14677 57914 29764.13 0 51541 107311 107311 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [Z]:20.45
Ice Strike 1491 3.4% 21.9 13.79sec 20453 17581 Direct 21.9 17372 34860 20453 17.6% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.87 21.87 0.00 0.00 0.00 1.1634 0.0000 447283.87 447283.87 0.00% 17581.22 17581.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.38% 18.02 9 27 17371.84 14382 29675 17370.96 15515 20095 312964 312964 0.00%
crit 17.62% 3.85 0 12 34859.96 28763 59350 34301.67 0 52906 134320 134320 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:2.64
  • if_expr:buff.doom_winds.up
    single
    [V]:19.23
Lava Lash 1367 3.1% 19.4 14.81sec 21115 17864 Direct 19.4 17964 36098 21115 17.4% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.44 19.44 0.00 0.00 0.00 1.1820 0.0000 410383.50 410383.50 0.00% 17863.73 17863.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 16.06 7 24 17963.52 15146 30117 17956.75 15888 20869 288457 288457 0.00%
crit 17.38% 3.38 0 12 36097.57 30292 58645 35159.89 0 53569 121927 121927 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [P]:2.41
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [W]:17.03
Lightning Bolt 3066 7.0% 18.8 14.94sec 48878 41495 Direct 18.8 40160 80457 48877 21.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.83 18.83 0.00 0.00 0.00 1.1780 0.0000 920243.91 920243.91 0.00% 41495.42 41495.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.37% 14.75 5 27 40159.83 27610 88620 40165.80 31760 50382 592554 592554 0.00%
crit 21.63% 4.07 0 13 80457.40 55220 166430 79545.05 0 136929 327690 327690 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.89

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [T]:4.23
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [X]:14.60
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1497 3.4% 172.1 1.93sec 2613 1468 Direct 172.1 2581 5192 2613 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 172.12 172.12 0.00 0.00 0.00 1.7796 0.0000 449682.23 642419.56 30.00% 1468.08 1468.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.18% 113.91 67 166 2581.38 2257 4339 2580.23 2365 2848 294050 420082 30.00%
crit 17.42% 29.98 10 55 5191.77 4513 8677 5189.08 4614 5914 155632 222337 30.00%
miss 16.40% 28.23 10 53 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 757 1.7% 173.7 2.01sec 1310 736 Direct 173.7 1295 2604 1310 17.3% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 173.68 173.68 0.00 0.00 0.00 1.7792 0.0000 227505.53 325016.18 30.00% 736.23 736.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.29% 115.14 72 164 1295.08 1128 2169 1294.55 1188 1449 149110 213020 30.00%
crit 17.34% 30.11 12 58 2603.64 2257 4290 2602.44 2330 2978 78395 111996 30.00%
miss 16.37% 28.44 9 50 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (6784) 0.0% (15.4%) 87.8 3.23sec 23224 19578

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 87.76 0.00 0.00 0.00 0.00 1.1862 0.0000 0.00 0.00 0.00% 19578.24 19578.24

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:5.72
  • if_expr:buff.doom_winds.up
    single
    [R]:69.32
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    single
    [U]:12.73
    Stormstrike (_mh) 3668 (4522) 8.3% (10.3%) 117.0 3.23sec 11609 0 Direct 117.0 (174.6) 8011 16091 9417 17.4% (11.7%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.04 117.04 0.00 0.00 0.00 0.0000 0.0000 1102148.36 1574537.80 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 96.68 50 152 8010.55 2623 20343 8021.21 6851 9580 774432 1106360 30.00%
crit 17.40% 20.37 5 44 16091.08 5246 40096 16115.49 11191 22974 327716 468178 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 854 1.9% 57.5 5.47sec 4460 0 Direct 57.5 4460 0 4460 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.55 57.55 0.00 0.00 0.00 0.0000 0.0000 256633.47 256633.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 57.55 21 112 4459.59 1152 18390 4468.88 3363 6083 256633 256633 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 1835 (2261) 4.2% (5.1%) 117.0 3.23sec 5805 0 Direct 117.0 (174.6) 4004 8057 4709 17.4% (11.7%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.04 117.04 0.00 0.00 0.00 0.0000 0.0000 551167.77 787402.61 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 96.68 52 153 4004.16 1312 10172 4009.52 3352 4771 387135 553065 30.00%
crit 17.39% 20.36 4 41 8056.78 2623 20076 8068.51 4771 10990 164032 234338 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 427 1.0% 57.5 5.47sec 2229 0 Direct 57.5 2229 0 2229 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.55 57.55 0.00 0.00 0.00 0.0000 0.0000 128281.95 128281.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 57.55 21 112 2229.21 576 9162 2233.96 1636 2929 128282 128282 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1033 2.3% 6.7 46.26sec 45942 39444 Direct 6.7 39126 78549 45942 17.3% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.74 6.74 0.00 0.00 0.00 1.1649 0.0000 309831.14 309831.14 0.00% 39443.81 39443.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.71% 5.58 1 9 39126.27 25567 82147 39150.42 26347 56374 218248 218248 0.00%
crit 17.29% 1.17 0 6 78549.30 51135 158260 56194.39 0 158260 91584 91584 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [N]:1.46
  • if_expr:buff.doom_winds.up
    single
    [Y]:5.28
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (6743) 0.0% (15.2%) 1.0 0.00sec 2015591 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6743 15.2% 404.6 2.47sec 4981 0 Direct 404.6 4252 8496 4981 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 404.63 404.63 0.00 0.00 0.00 0.0000 0.0000 2015591.13 2879489.32 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.81% 335.09 210 481 4252.03 1423 11363 4255.57 3666 5090 1424792 2035469 30.00%
crit 17.19% 69.54 32 113 8495.91 2845 22449 8502.94 7070 10775 590799 844021 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 450 1.0% 24.1 10.15sec 5527 4074 Direct 24.1 4565 9172 5527 20.9% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.12 24.12 0.00 0.00 0.00 1.3567 0.0000 133296.34 133296.34 0.00% 4073.85 4073.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.12% 19.08 10 29 4565.16 3559 6128 4565.78 4111 5575 87116 87116 0.00%
crit 20.88% 5.03 0 15 9172.35 7118 12257 9134.20 0 11995 46181 46181 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 236 0.5% 25.2 9.69sec 2768 2028 Direct 25.2 2288 4598 2768 20.8% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.24 25.24 0.00 0.00 0.00 1.3649 0.0000 69865.32 69865.32 0.00% 2028.32 2028.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.21% 19.99 11 30 2288.41 1780 3064 2288.23 2089 2799 45745 45745 0.00%
crit 20.79% 5.25 0 14 4597.67 3626 6128 4584.16 0 6031 24120 24120 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (5825) 0.0% (13.0%) 18.1 11.29sec 95383 97357

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.07 0.00 0.00 0.00 0.00 0.9797 0.0000 0.00 0.00 0.00% 97357.13 97357.13

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [K]:17.98
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [Q]:0.09
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1594 (1985) 3.6% (4.4%) 24.0 11.29sec 24451 0 Direct 24.0 (35.3) 16790 33749 19639 16.8% (11.4%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.03 24.03 0.00 0.00 0.00 0.0000 0.0000 471857.69 471857.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.20% 19.99 10 35 16790.08 4869 31358 16908.27 12374 23319 335622 335622 0.00%
crit 16.80% 4.04 0 12 33749.24 9908 61957 33356.54 0 59048 136236 136236 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 391 0.9% 11.3 18.45sec 10258 0 Direct 11.3 10258 0 10258 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.27 11.27 0.00 0.00 0.00 0.0000 0.0000 115624.38 115624.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.27 3 21 10258.15 3316 27564 10246.75 7060 17911 115624 115624 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 797 (992) 1.8% (2.2%) 24.0 11.29sec 12220 0 Direct 24.0 (35.3) 8396 16867 9821 16.8% (11.4%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.03 24.03 0.00 0.00 0.00 0.0000 0.0000 235954.62 235954.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.18% 19.99 8 42 8396.04 2434 15679 8455.49 6092 11432 167796 167796 0.00%
crit 16.82% 4.04 0 14 16867.27 4954 30562 16681.35 0 29372 68159 68159 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 195 0.4% 11.3 18.45sec 5114 0 Direct 11.3 5114 0 5114 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.27 11.27 0.00 0.00 0.00 0.0000 0.0000 57647.24 57647.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.27 3 21 5114.38 1658 13815 5110.25 3641 7930 57647 57647 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 2848 6.4% 18.0 11.35sec 46862 0 Direct 18.0 38710 77554 46863 21.0% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.98 17.98 0.00 0.00 0.00 0.0000 0.0000 842721.41 842721.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.01% 14.21 6 21 38709.83 18281 56318 38688.35 32850 47984 550018 550018 0.00%
crit 20.99% 3.77 0 11 77554.44 37293 111350 76230.75 0 106055 292703 292703 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.140000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.89

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 410 / 86
melee 410 0.2% 40.3 2.56sec 635 417 Direct 40.3 541 1082 635 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.32 40.32 0.00 0.00 0.00 1.5242 0.0000 25611.40 36588.64 30.00% 416.74 416.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 33.30 22 56 540.87 475 791 540.22 475 672 18010 25729 30.00%
crit 17.42% 7.02 0 21 1082.40 950 1582 1080.49 0 1473 7602 10860 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4119 / 2564
melee 4119 5.8% 340.5 1.74sec 2251 2009 Direct 340.5 1920 3833 2251 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 340.52 340.52 0.00 0.00 0.00 1.1204 0.0000 766569.70 1095127.49 30.00% 2009.20 2009.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 281.57 209 380 1920.01 1588 3071 1920.34 1739 2145 540620 772333 30.00%
crit 17.31% 58.95 27 92 3832.79 3176 6141 3833.59 3388 4350 225950 322794 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Phys
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.72sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.2 306.95sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.18 0.00 0.00 0.00 0.00 0.9984 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [a]:1.18
Feral Spirit 13.4 24.18sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.42 0.00 0.00 0.00 0.00 1.1405 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:13.42
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.50
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 91.58% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 180.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.2s / 182.7s
  • trigger_min/max:180.2s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.6sec 5.5sec 18.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.4s
  • trigger_min/max:0.0s / 164.3s
  • trigger_pct:100.00%
  • duration_min/max:17.0s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.45%
  • crumbling_power_4:0.72%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.70%
  • crumbling_power_7:0.70%
  • crumbling_power_8:0.68%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.71%
  • crumbling_power_18:1.24%
  • crumbling_power_19:0.84%
  • crumbling_power_20:0.02%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.5sec 90.5sec 7.9sec 9.85% 12.52% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.6s
  • trigger_min/max:90.0s / 92.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_1:9.85%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 13.4 0.0 25.9sec 23.0sec 17.3sec 62.25% 100.00% 0.0 (0.0) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.6s / 71.4s
  • trigger_min/max:5.6s / 46.7s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 53.8s

Stack Uptimes

  • earthen_weapon_2:58.61%
  • earthen_weapon_4:3.64%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 8.3 0.0 33.9sec 33.9sec 9.8sec 27.23% 0.00% 0.0 (0.0) 8.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 231.6s
  • trigger_min/max:10.0s / 231.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_critical_strike_1:27.23%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 8.4 0.0 33.7sec 33.7sec 9.8sec 27.38% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 240.0s
  • trigger_min/max:10.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_haste_1:27.38%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 8.4 0.0 33.7sec 33.7sec 9.8sec 27.38% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 239.9s
  • trigger_min/max:10.0s / 239.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • elemental_blast_mastery_1:27.38%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 126.4sec 100.1sec 57.8sec 24.82% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 345.2s

Stack Uptimes

  • elemental_chaos_air_1:24.82%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:Grants Haste and movement speed is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.8sec 98.6sec 57.9sec 24.99% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 343.5s

Stack Uptimes

  • elemental_chaos_earth_1:24.99%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:Grants Mastery and damage taken reduced.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 121.7sec 97.7sec 57.8sec 25.01% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 306.9s

Stack Uptimes

  • elemental_chaos_fire_1:25.01%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:Grants Critical Strike and damage dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.1sec 98.6sec 58.3sec 25.17% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 341.9s

Stack Uptimes

  • elemental_chaos_frost_1:25.17%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:Grants Versatility and healing dealt by critical strikes is increased.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 308.0sec 0.0sec 27.4sec 13.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 331.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.41%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 10.8 2.6 29.2sec 24.2sec 17.3sec 62.25% 0.00% 53.0 (53.0) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 71.4s
  • trigger_min/max:5.6s / 46.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.8s

Stack Uptimes

  • feral_spirit_1:62.25%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 44.1 364.5 6.8sec 0.7sec 5.7sec 84.01% 90.37% 364.5 (862.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 66.7s
  • trigger_min/max:0.0s / 16.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.5s

Stack Uptimes

  • flurry_1:20.35%
  • flurry_2:33.36%
  • flurry_3:30.30%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 117.7 17.8sec 2.2sec 14.6sec 83.94% 100.00% 56.3 (56.3) 16.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 49.5s
  • trigger_min/max:0.0s / 38.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:15.39%
  • forceful_winds_2:14.40%
  • forceful_winds_3:12.70%
  • forceful_winds_4:10.63%
  • forceful_winds_5:30.82%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.5sec 46.3sec 13.0sec 19.54% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 244.3s
  • trigger_min/max:0.1s / 244.3s
  • trigger_pct:98.84%
  • duration_min/max:0.0s / 53.8s

Stack Uptimes

  • forgestorm_ignited_1:19.54%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.6 1.3 14.7sec 13.8sec 7.2sec 49.60% 76.93% 1.3 (1.3) 4.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.9s / 64.6s
  • trigger_min/max:8.3s / 54.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.6s

Stack Uptimes

  • ice_strike_1:49.60%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 24.3 15.2 12.4sec 7.5sec 7.0sec 56.84% 100.00% 15.2 (15.2) 23.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 51.4s
  • trigger_min/max:0.8s / 37.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.4s

Stack Uptimes

  • legacy_of_the_frost_witch_1:56.84%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 48.6 374.1 6.2sec 0.7sec 5.3sec 85.39% 100.00% 44.3 (48.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 32.3s
  • trigger_min/max:0.0s / 8.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.1s

Stack Uptimes

  • maelstrom_weapon_1:9.83%
  • maelstrom_weapon_2:11.50%
  • maelstrom_weapon_3:13.12%
  • maelstrom_weapon_4:13.69%
  • maelstrom_weapon_5:8.70%
  • maelstrom_weapon_6:6.97%
  • maelstrom_weapon_7:5.13%
  • maelstrom_weapon_8:4.18%
  • maelstrom_weapon_9:3.37%
  • maelstrom_weapon_10:8.89%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 61.0sec 45.7sec 16.6sec 23.72% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:1714.51

Trigger Details

  • interval_min/max:15.0s / 214.7s
  • trigger_min/max:0.0s / 214.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.8s

Stack Uptimes

  • sophic_devotion_1:23.72%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.5sec 45.9sec 32.2sec 38.11% 0.00% 25.7 (25.7) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 264.6s
  • trigger_min/max:0.1s / 212.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 212.9s

Stack Uptimes

  • spiraling_winds_1:2.33%
  • spiraling_winds_2:2.30%
  • spiraling_winds_3:2.30%
  • spiraling_winds_4:2.27%
  • spiraling_winds_5:2.26%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.21%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.75%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 59.1 18.3 5.0sec 3.8sec 1.2sec 22.93% 55.41% 18.3 (18.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 72.9s
  • trigger_min/max:0.0s / 72.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s

Stack Uptimes

  • stormbringer_1:22.93%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=true}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.2 33.0 66.0 17.9s 15.0s 54.8s
Windfury-ForcefulWinds: 2 50.5 30.0 69.0 18.1s 0.8s 66.3s
Windfury-ForcefulWinds: 3 48.7 27.0 72.0 18.8s 0.7s 77.7s
Windfury-ForcefulWinds: 4 45.0 21.0 69.0 20.4s 0.7s 110.2s
Windfury-ForcefulWinds: 5 209.2 93.0 351.0 4.8s 0.0s 90.0s
windfury_totem_extra_attack_mh 27.9 10.0 51.0 10.5s 1.2s 112.6s
windfury_totem_extra_attack_oh 28.1 11.0 50.0 10.5s 0.1s 149.6s
Elemental Blast: Critical Strike 8.3 0.0 18.0 33.9s 10.0s 231.6s
Elemental Blast: Haste 8.4 1.0 16.0 33.7s 10.0s 240.0s
Elemental Blast: Mastery 8.4 1.0 16.0 33.7s 10.0s 239.9s
Windfury: Unruly Winds 134.9 86.0 192.0 2.5s 0.0s 38.3s
Maelstrom Weapon: Feral Spirit 71.4 51.0 94.0 4.2s 0.0s 31.7s
Maelstrom Weapon: Elemental Assault 105.8 71.0 146.0 2.8s 0.8s 11.1s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.4s
Stormflurry 35.2 9.0 73.0 11.0s 0.8s 120.6s
Legacy of the Frost Witch: Bugged Trigger 8.0 4.0 12.0 26.9s 1.6s 179.5s
Maelstrom Weapon: Windfury Attack 80.9 37.0 135.0 4.8s 0.0s 76.9s
Maelstrom Weapon: main_hand 28.8 9.0 51.0 10.1s 1.3s 127.0s
Maelstrom Weapon: Windlash 4.9 0.0 13.0 43.7s 1.2s 194.1s
Maelstrom Weapon: offhand 29.1 10.0 57.0 10.1s 1.3s 133.3s
Maelstrom Weapon: Windlash Off-Hand 5.0 0.0 17.0 42.3s 1.2s 195.8s
Maelstrom Weapon: Doom Winds 0.8 0.0 4.0 137.6s 90.0s 273.8s
Maelstrom Weapon: Sundering 1.4 0.0 7.0 101.0s 40.0s 350.5s
Maelstrom Weapon: Windstrike 4.8 0.0 13.0 44.9s 0.8s 193.2s
Maelstrom Weapon: Windstrike Off-Hand 4.8 0.0 15.0 44.5s 0.8s 193.5s
Maelstrom Weapon: Lava Lash 3.9 0.0 12.0 56.0s 9.0s 306.5s
Maelstrom Weapon: Ice Strike 4.4 0.0 12.0 54.1s 8.4s 318.8s
Maelstrom Weapon: Stormstrike 23.4 6.0 46.0 12.6s 0.9s 141.8s
Maelstrom Weapon: Stormstrike Off-Hand 23.4 7.0 47.0 12.6s 0.9s 147.6s
Flametongue: Windfury Attack 404.6 258.0 576.0 2.5s 0.0s 38.3s
Stormbringer: Windfury Attack 42.7 16.0 75.0 7.9s 0.0s 113.7s
Flametongue: main_hand 143.9 92.0 198.0 2.5s 1.3s 27.4s
Windfury: main_hand 48.8 17.0 80.0 6.3s 1.3s 88.0s
Flametongue: Windlash 24.1 19.0 32.0 10.2s 1.2s 170.3s
Windfury: Windlash 16.3 10.0 26.0 14.7s 1.2s 177.2s
Flametongue: offhand 145.2 98.0 197.0 2.5s 1.3s 27.4s
Flametongue: Windlash Off-Hand 25.2 21.0 33.0 9.7s 1.2s 168.1s
Flametongue: Sundering 6.7 4.0 9.0 46.3s 40.0s 114.6s
Stormbringer: Sundering 0.7 0.0 5.0 114.9s 40.0s 347.3s
Windfury: Sundering 3.1 0.0 7.0 84.0s 40.0s 335.8s
Flametongue: Windstrike 24.0 15.0 46.0 11.3s 0.8s 171.3s
Stormbringer: Windstrike 2.5 0.0 11.0 60.5s 0.8s 193.9s
Windfury: Windstrike 17.1 8.0 33.0 15.4s 0.8s 177.6s
Flametongue: Windstrike Off-Hand 24.0 15.0 46.0 11.3s 0.8s 171.3s
Stormbringer: Windstrike Off-Hand 2.5 0.0 10.0 61.0s 0.8s 194.0s
Flametongue: Lava Lash 19.4 12.0 26.0 14.8s 8.7s 50.6s
Stormbringer: Lava Lash 2.0 0.0 8.0 75.2s 9.0s 318.6s
Flametongue: Ice Strike 21.9 14.0 29.0 13.8s 8.3s 54.3s
Stormbringer: Ice Strike 2.3 0.0 9.0 75.1s 8.4s 333.1s
Windfury: Ice Strike 8.5 1.0 18.0 34.9s 8.3s 277.5s
Flametongue: Stormstrike 117.0 64.0 191.0 3.2s 0.9s 28.5s
Stormbringer: Stormstrike 12.4 1.0 33.0 21.9s 0.9s 278.4s
Windfury: Stormstrike 41.1 13.0 79.0 7.7s 0.9s 105.1s
Flametongue: Stormstrike Off-Hand 117.0 64.0 191.0 3.2s 0.9s 28.5s
Stormbringer: Stormstrike Off-Hand 12.3 1.0 31.0 21.9s 0.9s 259.7s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 23.35% 16.11% 29.91% 0.7s 0.0s 18.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.6840.0001.4859.1992.45915.932
Ascendance0.6930.0002.4171.3870.9223.343
Doom Winds0.8530.0002.6373.1772.0886.778
Sundering6.9760.00074.61247.8217.727127.773
Windstrike
Stormstrike
0.9550.0005.049101.28157.640161.221
Lava Lash3.8190.00038.32774.85337.218135.379
Flame Shock15.6920.000171.902234.181157.956327.012
Ice Strike2.2780.00042.22150.24415.035103.700
Frost Shock9.6930.000105.334203.977131.238279.307
Elemental Blast0.5860.00025.47414.6748.56632.311
Earth Elemental25.7150.000126.32531.01417.686126.325

Maelstrom Weapon Details

Maelstrom Weapon Sources
Ability Actual Overflow % Actual % Overflow
Windfury Attack69.911.117.31%22.60%
main_hand26.92.06.65%4.00%
Windlash3.81.00.94%2.13%
offhand27.02.16.69%4.22%
Windlash Off-Hand4.10.91.01%1.92%
Feral Spirit64.47.115.94%14.45%
Ascendance48.611.412.05%23.24%
Doom Winds0.70.10.17%0.14%
Sundering1.20.10.31%0.28%
Windstrike18.10.04.48%0.00%
Windstrike (_mh)4.70.01.17%0.05%
Windstrike Off-Hand4.80.01.18%0.09%
Lava Lash3.80.10.93%0.22%
Ice Strike4.20.21.04%0.34%
Stormstrike78.98.919.54%18.17%
Stormstrike (_mh)21.51.95.32%3.94%
Stormstrike Off-Hand21.32.05.28%4.19%
Overflow Stacks0.048.90.00%10.81%
Actual Stacks403.70.089.19%0.00%
Maelstrom Weapon Consumers
Ability Actual % Total
Lightning Bolt133.633.42%
Elemental Blast182.145.54%
Lightning Bolt (_ti)84.121.04%
Total Spent399.9100.00%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Phys
mana_regenMana674.42255676.99100.00%379.11223706.8746.67%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 852.26 855.15 223706.6 49131.9 41443.2 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Phys
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 25.0234397.001375.001375.0057.50
Flame ShockMana 14.1710628.48750.00316.2643.03
Frost ShockMana 20.4510224.10500.00500.0035.70
Ice StrikeMana 21.8736082.891650.001649.9912.40
Lava LashMana 19.447774.16400.00400.0052.79
Lightning BoltMana 18.839413.81500.00500.0097.75
StormstrikeMana 117.04117042.391000.001333.6317.41
SunderingMana 6.7420232.103000.003000.0315.31

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Phys Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Phys Damage Per Second
Count 7499
Mean 44171.21
Minimum 36108.60
Maximum 52476.21
Spread ( max - min ) 16367.61
Range [ ( max - min ) / 2 * 100% ] 18.53%
Standard Deviation 2172.2990
5th Percentile 40772.18
95th Percentile 47930.19
( 95th Percentile - 5th Percentile ) 7158.01
Mean Distribution
Standard Deviation 25.0852
95.00% Confidence Interval ( 44122.04 - 44220.37 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9291
0.1 Scale Factor Error with Delta=300 40284
0.05 Scale Factor Error with Delta=300 161133
0.01 Scale Factor Error with Delta=300 4028311
Priority Target DPS
PR_Shaman_Enhancement_Phys Priority Target Damage Per Second
Count 7499
Mean 44171.21
Minimum 36108.60
Maximum 52476.21
Spread ( max - min ) 16367.61
Range [ ( max - min ) / 2 * 100% ] 18.53%
Standard Deviation 2172.2990
5th Percentile 40772.18
95th Percentile 47930.19
( 95th Percentile - 5th Percentile ) 7158.01
Mean Distribution
Standard Deviation 25.0852
95.00% Confidence Interval ( 44122.04 - 44220.37 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9291
0.1 Scale Factor Error with Delta=300 40284
0.05 Scale Factor Error with Delta=300 161133
0.01 Scale Factor Error with Delta=300 4028311
DPS(e)
PR_Shaman_Enhancement_Phys Damage Per Second (Effective)
Count 7499
Mean 44171.21
Minimum 36108.60
Maximum 52476.21
Spread ( max - min ) 16367.61
Range [ ( max - min ) / 2 * 100% ] 18.53%
Damage
PR_Shaman_Enhancement_Phys Damage
Count 7499
Mean 12426392.32
Minimum 8848267.48
Maximum 16604521.76
Spread ( max - min ) 7756254.28
Range [ ( max - min ) / 2 * 100% ] 31.21%
DTPS
PR_Shaman_Enhancement_Phys Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Phys Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Phys Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Phys Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Phys Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Phys Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_PhysTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Phys Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.50 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 13.42 feral_spirit
G 2.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
H 3.72 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
K 17.98 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
L 5.72 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
M 2.64 ice_strike,if=buff.doom_winds.up
N 1.46 sundering,if=buff.doom_winds.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
O 1.10 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
0.00 frost_shock,if=buff.hailstorm.up
P 2.41 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
Q 0.09 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 69.32 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
S 25.02 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
T 4.23 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
U 12.73 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
V 19.23 ice_strike
W 17.03 lava_lash
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
X 14.60 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 5.28 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
Z 20.45 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
a 1.18 earth_elemental
b 13.07 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ABCDFGEHKMKNKOKSKFKKSKVKWXRZXabRRFSRVWZbRRRSRZVWbRTRRSRFRVWXYRRSRXRVWZbUSUZbVFRWRRSRZbVXRRHLLLFLLSRRPSRVYZXUXRWZSVFRZbXRWZVSRRXRZbWUSRVYZFRSRRRWVTRSZbUZWVXRRFSDGEHKWKMKKKFKSKWXRVXYRSRZWXbFRRSRVRWXRRZSbUVUWXRRZbFSRVRRRTRWYSRVZbUSWZbUUVFXRHLLLLSLVWXRRSZbYUFRSRV

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 2 augmentation PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_fire
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
0:00.000 default B potion Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_fire
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, crumbling_power(20), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:00.954 default G ascendance Fluffy_Pillow 40776.4/50000: 82% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:01.906 default E berserking Fluffy_Pillow 42299.6/50000: 85% mana bloodlust, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, static_accumulation, crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:01.906 default H doom_winds Fluffy_Pillow 42299.6/50000: 85% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, static_accumulation, crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:02.774 single K windstrike Fluffy_Pillow 43688.4/50000: 87% mana bloodlust, berserking, ascendance, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), static_accumulation, doom_winds, crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:03.641 single M ice_strike Fluffy_Pillow 45075.6/50000: 90% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, doom_winds, crumbling_power(17), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:04.507 single K windstrike Fluffy_Pillow 44811.2/50000: 90% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, crumbling_power(16), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:05.373 single N sundering Fluffy_Pillow 46196.8/50000: 92% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, crumbling_power(15), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:06.241 single K windstrike Fluffy_Pillow 44585.6/50000: 89% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, crumbling_power(14), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:07.108 single O flame_shock Fluffy_Pillow 45972.8/50000: 92% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:07.975 single K windstrike Fluffy_Pillow 46610.0/50000: 93% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:08.841 single S elemental_blast Fluffy_Pillow 47995.6/50000: 96% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:09.707 single K windstrike Fluffy_Pillow 48006.2/50000: 96% mana bloodlust, berserking, ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:10.574 default F feral_spirit Fluffy_Pillow 49393.4/50000: 99% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:11.442 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:12.308 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:13.174 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:14.040 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:14.965 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:15.890 single K windstrike Fluffy_Pillow 49830.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(3), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:16.815 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(2), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:17.743 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:18.669 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:19.596 single Z frost_shock Fluffy_Pillow 48483.2/50000: 97% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:20.521 single X lightning_bolt Fluffy_Pillow 49463.2/50000: 99% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:21.447 single a earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:22.374 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:23.301 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:24.254 single R stormstrike Fluffy_Pillow 49524.8/50000: 99% mana bloodlust, flurry(3), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:25.207 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:26.160 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:27.114 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:28.041 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:28.966 single W lava_lash Fluffy_Pillow 49830.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:29.893 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:30.817 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
0:31.741 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_fire
0:32.666 single R stormstrike Fluffy_Pillow 49480.0/50000: 99% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(9), forgestorm_ignited, elemental_chaos_fire
0:33.591 single R stormstrike Fluffy_Pillow 48960.0/50000: 98% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
0:34.517 single S elemental_blast Fluffy_Pillow 48441.6/50000: 97% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
0:35.443 single R stormstrike Fluffy_Pillow 48548.2/50000: 97% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
0:36.368 single Z frost_shock Fluffy_Pillow 49028.2/50000: 98% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
0:37.322 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, elemental_chaos_fire
0:38.275 single W lava_lash Fluffy_Pillow 49874.8/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, elemental_chaos_fire
0:39.229 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
0:40.185 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds(4), elemental_chaos_fire
0:41.456 single T lightning_bolt Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(5), elemental_chaos_fire
0:42.694 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_fire
0:43.934 single R stormstrike Fluffy_Pillow 48984.0/50000: 98% mana flurry(3), elemental_blast_mastery, stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_fire
0:45.173 single S elemental_blast Fluffy_Pillow 49966.4/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_fire
0:46.410 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_fire
0:47.648 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_fire
0:48.886 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, elemental_chaos_fire
0:50.123 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, elemental_chaos_fire
0:51.362 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:52.600 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:53.840 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:55.080 single R stormstrike Fluffy_Pillow 48984.0/50000: 98% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:56.318 single R stormstrike Fluffy_Pillow 49964.8/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:57.556 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:58.794 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:00.032 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:01.270 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:02.508 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:03.747 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:04.986 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:06.223 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), elemental_chaos_frost
1:07.462 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(5), elemental_chaos_frost
1:08.701 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), stormbringer, maelstrom_weapon(6), elemental_chaos_frost
1:10.081 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(2), stormbringer, elemental_chaos_frost
1:11.318 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, elemental_chaos_frost
1:12.556 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon, elemental_chaos_frost
1:13.793 Waiting     0.860 sec 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon, elemental_chaos_frost
1:14.653 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon, elemental_chaos_frost
1:16.085 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(3), ice_strike, elemental_chaos_frost
1:17.324 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, elemental_chaos_frost
1:18.560 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), ice_strike, elemental_chaos_frost
1:19.799 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_frost
1:21.039 single R stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_frost
1:22.277 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_frost
1:23.515 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:24.753 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:25.991 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
1:27.230 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_frost
1:28.469 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, elemental_chaos_frost
1:29.708 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:30.947 single R stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:32.186 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:33.425 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(8), doom_winds, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:34.664 single L stormstrike Fluffy_Pillow 49982.4/50000: 100% mana forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_frost
1:35.902 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_frost
1:37.140 default F feral_spirit Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_frost
1:38.379 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_frost
1:39.619 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, elemental_chaos_frost
1:40.860 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_frost
1:42.097 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
1:43.337 single R stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
1:44.576 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, elemental_chaos_frost
1:45.814 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, elemental_chaos_frost
1:47.053 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
1:48.257 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
1:49.461 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:50.663 single Z frost_shock Fluffy_Pillow 48923.2/50000: 98% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:51.867 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_frost
1:53.070 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon, elemental_chaos_frost
1:54.273 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(5), elemental_chaos_frost
1:55.476 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, legacy_of_the_frost_witch, elemental_chaos_frost
1:56.681 single W lava_lash Fluffy_Pillow 49928.0/50000: 100% mana flurry(3), forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
1:57.918 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
1:59.156 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(3), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_frost
2:00.393 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), elemental_chaos_earth
2:01.631 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), ice_strike, elemental_chaos_earth
2:02.869 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, elemental_chaos_earth
2:04.106 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, elemental_chaos_earth
2:05.345 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_earth
2:06.583 Waiting     1.085 sec 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_earth
2:07.668 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_earth
2:08.905 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:10.143 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:11.382 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:12.621 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:13.970 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, forgestorm_ignited, elemental_chaos_earth
2:15.210 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:16.448 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:17.686 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:18.924 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:20.163 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(2), ice_strike, elemental_chaos_earth
2:21.402 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(2), elemental_chaos_earth
2:22.640 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), elemental_chaos_earth
2:23.878 Waiting     1.017 sec 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, maelstrom_weapon(4), elemental_chaos_earth
2:24.895 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(4), elemental_chaos_earth
2:26.334 single S elemental_blast Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(7), elemental_chaos_earth
2:27.572 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, legacy_of_the_frost_witch, elemental_chaos_earth
2:28.810 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_earth
2:30.049 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_earth
2:31.288 single Z frost_shock Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_earth
2:32.527 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(3), spiraling_winds(3), sophic_devotion, elemental_chaos_earth
2:33.766 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(4), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:35.003 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(4), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:36.243 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:37.445 single R stormstrike Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:38.648 single R stormstrike Fluffy_Pillow 49848.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:39.849 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:41.049 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(9), spiraling_winds(7), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:42.251 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(8), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:43.454 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:44.656 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:46.043 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:47.282 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:48.520 Waiting     0.899 sec 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:49.419 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:50.814 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:52.216 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:53.454 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_earth
2:54.691 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(5), ice_strike, forgestorm_ignited, elemental_chaos_earth
2:55.930 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:57.169 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:58.408 default F feral_spirit Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:59.765 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, elemental_chaos_earth
3:01.002 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:01.002 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(20), elemental_chaos_air
3:02.201 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), elemental_chaos_air
3:02.201 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), elemental_chaos_air
3:03.293 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), elemental_chaos_air
3:04.385 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(18), elemental_chaos_air
3:05.477 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, crumbling_power(17), elemental_chaos_air
3:06.568 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(16), elemental_chaos_air
3:07.661 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), elemental_chaos_air
3:08.751 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_air
3:09.844 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_air
3:10.934 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_air
3:12.025 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds, elemental_chaos_air
3:13.115 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds, elemental_chaos_air
3:14.208 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(2), elemental_chaos_air
3:15.408 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(3), elemental_chaos_air
3:16.608 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(3), elemental_chaos_air
3:17.808 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(4), elemental_chaos_air
3:19.010 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(4), elemental_chaos_air
3:20.210 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(5), elemental_chaos_air
3:21.412 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_air
3:22.613 single R stormstrike Fluffy_Pillow 48921.6/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, spiraling_winds(6), elemental_chaos_air
3:23.812 single S elemental_blast Fluffy_Pillow 49840.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(7), elemental_chaos_air
3:25.012 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_air
3:26.212 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air
3:27.412 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_air
3:28.613 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_air
3:29.814 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), spiraling_winds(10), elemental_chaos_air
3:31.014 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), spiraling_winds(10), elemental_chaos_air
3:32.214 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, spiraling_winds(10), elemental_chaos_air
3:33.416 single R stormstrike Fluffy_Pillow 47923.2/50000: 96% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_air
3:34.617 single S elemental_blast Fluffy_Pillow 47844.8/50000: 96% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_air
3:35.818 single R stormstrike Fluffy_Pillow 48391.4/50000: 97% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
3:37.019 single V ice_strike Fluffy_Pillow 49313.0/50000: 99% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
3:38.220 single R stormstrike Fluffy_Pillow 49584.6/50000: 99% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:39.420 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:40.620 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_air
3:41.820 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:43.020 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:44.221 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:45.419 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:46.618 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, sophic_devotion, elemental_chaos_air
3:47.820 Waiting     0.996 sec 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, sophic_devotion, elemental_chaos_air
3:48.816 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, sophic_devotion, elemental_chaos_air
3:50.203 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(2), sophic_devotion, elemental_chaos_air
3:51.403 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(3), ice_strike, sophic_devotion, elemental_chaos_air
3:52.603 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(6), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_air
3:53.803 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon(6), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_air
3:55.004 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_air
3:56.205 single R stormstrike Fluffy_Pillow 47921.6/50000: 96% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_air
3:57.406 single Z frost_shock Fluffy_Pillow 48843.2/50000: 98% mana forceful_winds(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_air
3:58.607 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_air
3:59.807 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:01.008 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:02.207 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:03.407 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_air
4:04.609 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_air
4:05.812 single R stormstrike Fluffy_Pillow 48924.8/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_air
4:07.013 single R stormstrike Fluffy_Pillow 49846.4/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_air
4:08.213 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_air
4:09.414 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:10.615 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:11.814 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:13.015 single S elemental_blast Fluffy_Pillow 48921.6/50000: 98% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:14.216 single R stormstrike Fluffy_Pillow 49468.2/50000: 99% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:15.382 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, elemental_chaos_air
4:16.548 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, elemental_chaos_air
4:17.713 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_air
4:18.880 Waiting     0.962 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), spiraling_winds(2), sophic_devotion, elemental_chaos_air
4:19.842 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), spiraling_winds(3), sophic_devotion, elemental_chaos_air
4:21.189 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(5), spiraling_winds(4), sophic_devotion, elemental_chaos_air
4:22.355 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, forceful_winds(4), spiraling_winds(4), sophic_devotion, elemental_chaos_air
4:23.521 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), spiraling_winds(5), sophic_devotion, elemental_chaos_air
4:24.722 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), spiraling_winds(5), sophic_devotion, elemental_chaos_air
4:25.922 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), spiraling_winds(6), sophic_devotion, elemental_chaos_air
4:27.124 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, stormbringer, maelstrom_weapon(3), spiraling_winds(7), sophic_devotion, elemental_chaos_air
4:28.325 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, maelstrom_weapon(6), spiraling_winds(7), sophic_devotion, elemental_chaos_air
4:29.525 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, maelstrom_weapon(7), ice_strike, spiraling_winds(8), sophic_devotion, elemental_chaos_air
4:30.726 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds(8), elemental_chaos_air
4:31.926 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_air
4:33.128 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:34.327 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:35.528 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:36.728 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(10), elemental_chaos_air
4:37.929 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(10), elemental_chaos_air
4:39.130 single S elemental_blast Fluffy_Pillow 49921.6/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, spiraling_winds(10), elemental_chaos_air
4:40.331 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), doom_winds, legacy_of_the_frost_witch, elemental_chaos_air
4:41.498 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_air
4:42.663 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:43.829 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:44.993 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:46.156 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:47.322 single S elemental_blast Fluffy_Pillow 49865.6/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:48.490 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:49.655 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, maelstrom_weapon, elemental_chaos_air
4:50.856 Waiting     0.788 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon, elemental_chaos_air
4:51.644 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon, elemental_chaos_air
4:53.014 single U stormstrike Fluffy_Pillow 48920.0/50000: 98% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), elemental_chaos_air
4:54.214 default F feral_spirit Fluffy_Pillow 49840.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(2), stormbringer, maelstrom_weapon(3), elemental_chaos_air
4:55.414 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), elemental_chaos_air
4:56.614 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), elemental_chaos_air
4:58.042 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_air
4:59.242 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_air

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.55% 21.55% 3663
Versatility 7.11% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Phys"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAoEhkQCKCk0SSaICQikGC

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 285012297
Max Event Queue: 332
Sim Seconds: 2250297
CPU Seconds: 269.0234
Physical Seconds: 135.5288
Speed Up: 8365

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.48sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 152382 508 7.65 3119 6288 38.3 38.3 27.3% 0.0% 0.0% 0.0% 6.91sec 152382 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 0 0 0.00 0 0 7.4 0.0 0.0% 0.0% 0.0% 0.0% 43.22sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 143.84sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 775802 2586 38.63 3599 7239 193.2 193.2 27.6% 16.4% 0.0% 0.0% 1.81sec 1108316 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 377398 1258 37.73 1799 3621 188.7 188.7 27.6% 16.8% 0.0% 0.0% 1.81sec 539154 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost blood_draw 374606 27760 93 0.40 10919 22094 2.0 2.0 26.5% 0.0% 0.0% 0.0% 179.80sec 27760 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.50sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 2863610 9545 26.51 16909 33887 132.5 132.5 27.7% 0.0% 0.0% 0.0% 2.02sec 2863610 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 202234 674 0.53 59558 119721 2.8 2.6 27.9% 0.0% 0.0% 0.0% 120.03sec 202234 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 3215 11 1.24 407 820 0.6 6.2 27.4% 0.0% 0.0% 0.0% 82.01sec 3215 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 380957 1270 1.79 33423 67187 9.0 9.0 27.0% 0.0% 0.0% 0.0% 30.17sec 544238 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 82.85sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 641546 2138 19.74 5087 10201 61.3 98.7 27.6% 0.0% 0.0% 0.0% 4.87sec 641546 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 668492 2228 8.78 11913 23882 43.9 43.9 27.7% 0.0% 0.0% 0.0% 4.97sec 668492 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 334320 1114 8.78 5955 11952 43.9 43.9 27.7% 0.0% 0.0% 0.0% 4.97sec 334320 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.1 0.0 0.0% 0.0% 0.0% 0.0% 74.39sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 1802399 6008 12.27 23003 46136 61.3 61.3 27.6% 0.0% 0.0% 0.0% 4.87sec 1802399 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 377802 1259 12.27 4823 9668 61.3 61.3 27.6% 0.0% 0.0% 0.0% 4.87sec 377802 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 385288 1284 10.95 5508 11083 54.7 54.7 27.5% 0.0% 0.0% 0.0% 5.40sec 550426 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 192666 642 10.95 2753 5547 54.7 54.7 27.4% 0.0% 0.0% 0.0% 5.40sec 275244 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1402590 4675 10.18 0 27553 50.9 50.9 100.0% 0.0% 0.0% 0.0% 5.80sec 1402590 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 701295 2338 10.18 0 13777 50.9 50.9 100.0% 0.0% 0.0% 0.0% 5.80sec 701295 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 37.50sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 303.68sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.67sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.45sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1512469 5042 47.80 4949 9947 239.0 239.0 27.6% 0.0% 0.0% 0.0% 1.25sec 1512469 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 60284 201 4.07 2314 4651 20.4 20.4 27.7% 0.0% 0.0% 0.0% 14.34sec 86122 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 60230 201 4.07 2314 4651 20.4 20.4 27.6% 0.0% 0.0% 0.0% 14.32sec 86045 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.4 0.0 0.0% 0.0% 0.0% 0.0% 14.25sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 94942 580 19.37 1406 2812 52.9 52.9 27.7% 0.0% 0.0% 0.0% 5.32sec 135634 163.83sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 175 1 1.07 47 94 2.9 2.9 26.9% 0.0% 0.0% 0.0% 120.67sec 250 163.83sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul main_hand 0 193678 1182 35.21 1578 3156 96.1 96.1 27.6% 0.0% 0.0% 0.0% 2.88sec 276690 163.83sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.67sec 0 163.83sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.20sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 44.32sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 62511 208 1.38 7827 15711 6.9 6.9 15.9% 0.0% 0.0% 0.0% 45.94sec 62511 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 175.69sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 847161 2824 31.20 4661 9373 156.0 156.0 16.3% 0.0% 0.0% 0.0% 2.31sec 1210261 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.81sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy blood_draw 374606 26510 88 0.40 11335 22801 2.0 2.0 16.7% 0.0% 0.0% 0.0% 179.81sec 26510 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy clawing_shadows 207311 1291381 4305 14.82 14981 30101 74.1 74.1 16.2% 0.0% 0.0% 0.0% 3.92sec 1291381 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 58556 195 1.40 7204 14465 7.0 7.0 16.4% 0.0% 0.0% 0.0% 45.90sec 58556 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_and_decay 43265 72090 240 18.40 673 1352 8.5 92.0 16.3% 0.0% 0.0% 0.0% 36.88sec 72090 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1387149 4624 20.06 11879 23856 100.4 100.3 16.3% 0.0% 0.0% 0.0% 2.96sec 1387149 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 409082 1364 27.38 2988 0 0.0 136.9 0.0% 0.0% 0.0% 0.0% 0.00sec 409082 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 269649 899 1.37 33623 67609 6.9 6.9 16.5% 0.0% 0.0% 0.0% 29.08sec 385222 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 169.26sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 321168 1071 5.01 11003 22128 25.1 25.1 16.3% 0.0% 0.0% 0.0% 11.99sec 458823 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 516988 1723 20.32 4371 8779 101.6 101.6 16.3% 0.0% 0.0% 0.0% 3.63sec 516988 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 23773 79 2.32 1755 3528 11.6 11.6 16.3% 0.0% 0.0% 0.0% 27.00sec 23773 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 146659 489 3.15 7993 16072 15.8 15.8 16.3% 0.0% 0.0% 0.0% 6.80sec 146659 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 704794 2349 3.15 38389 77185 15.8 15.8 16.4% 0.0% 0.0% 0.0% 6.80sec 704794 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.38sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 57380 191 0.73 13535 27288 3.6 3.6 16.0% 0.0% 0.0% 0.0% 91.53sec 57380 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 22.1 0.0 0.0% 0.0% 0.0% 0.0% 13.28sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 251609 839 19.90 2172 4365 11.6 99.5 16.3% 0.0% 0.0% 0.0% 27.00sec 251609 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 89720 299 7.55 2044 4083 37.8 37.8 16.2% 0.0% 0.0% 0.0% 7.86sec 128175 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 26 0 0.06 72 143 0.3 0.3 16.1% 0.0% 0.0% 0.0% 90.12sec 37 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul main_hand 0 1256592 4189 39.27 5506 10989 196.4 196.4 16.3% 0.0% 0.0% 0.0% 1.52sec 1795178 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul monstrous_blow 91797 8628 29 0.67 2217 4436 3.4 3.4 16.1% 0.0% 0.0% 0.0% 91.36sec 12325 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul spawn_travel 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 401031 1337 14.05 4912 9804 70.3 70.3 16.2% 0.0% 0.0% 0.0% 4.17sec 401031 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1632973 32659 49.53 34015 68079 41.3 41.3 16.3% 0.0% 0.0% 0.0% 5.08sec 1632973 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.38sec 0 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 264051 4466 221.61 1040 2079 218.4 218.4 16.2% 0.0% 0.0% 0.0% 0.98sec 377226 59.12sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1390686 23522 372.00 3263 6519 366.6 366.6 16.3% 0.0% 0.0% 0.0% 0.59sec 1986745 59.12sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.35sec 0 59.12sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.51sec 0 58.85sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.93sec 0 59.02sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.93sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 227340 2371 17.52 6985 13969 28.0 28.0 16.2% 0.0% 0.0% 0.0% 10.69sec 227340 95.87sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 961711 10031 71.60 7232 14448 114.4 114.4 16.3% 0.0% 0.0% 0.0% 2.54sec 961711 95.87sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.93sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.93sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.93sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.93sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 228026 1711 92.18 958 1915 204.8 204.8 16.2% 0.0% 0.0% 0.0% 1.37sec 325760 133.30sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 1000501 7506 132.14 2933 5858 293.6 293.6 16.3% 0.0% 0.0% 0.0% 0.95sec 1429323 133.30sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.95sec 0 133.30sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.95sec 0 133.30sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.95sec 0 133.30sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.95sec 0 133.30sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 504314 1681 6.15 14472 28987 30.8 30.8 13.3% 0.0% 0.0% 0.0% 9.63sec 504314 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay ticks -15407 1665547 5552 73.98 3973 7961 62.2 369.9 13.3% 0.0% 0.0% 0.0% 4.82sec 1665547 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 8.9 0.0 0.0% 0.0% 0.0% 0.0% 31.98sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_damage 205386 283296 944 1.96 25449 50983 9.8 9.8 13.3% 0.0% 0.0% 0.0% 31.97sec 283296 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_dots 391286 0 0 0.00 0 0 8.9 0.0 0.0% 0.0% 0.0% 0.0% 31.98sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 36051 120 6.40 1127 0 32.0 32.0 0.0% 0.0% 0.0% 0.0% 6.48sec 36051 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 111375 371 0.65 30180 60782 3.2 3.2 13.9% 0.0% 0.0% 0.0% 21.33sec 111375 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 120803 403 0.64 33285 67200 3.2 3.2 13.7% 0.0% 0.0% 0.0% 21.33sec 124633 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain 589 58549 195 3.66 2832 5668 18.3 18.3 13.1% 0.0% 0.0% 0.0% 15.82sec 510301 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain ticks -589 451753 1506 37.68 2118 4239 18.3 188.4 13.2% 0.0% 0.0% 0.0% 15.82sec 510301 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowfiend 34433 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 314838 1049 14.64 4301 0 6.2 73.2 0.0% 0.0% 0.0% 0.0% 43.05sec 314838 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 586524 1955 25.44 4069 8151 18.5 127.2 13.3% 0.0% 0.0% 0.0% 16.07sec 586524 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 127.2 0.0 0.0% 0.0% 0.0% 0.0% 2.34sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_shadowfiend melee 0 139896 3997 54.86 3867 7731 32.0 32.0 13.1% 0.0% 0.0% 0.0% 6.48sec 139896 35.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 310.08sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2411903 8040 4.19 95104 191123 20.9 20.9 21.0% 0.0% 0.0% 0.0% 14.23sec 2411903 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 30.07sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 603652 2012 16.80 6118 12288 84.0 84.0 17.3% 0.0% 0.0% 0.0% 3.57sec 1420641 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 816989 2723 38.46 3612 7266 84.0 192.3 17.4% 0.0% 0.0% 0.0% 3.57sec 1420641 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 277353 925 135.36 349 700 676.8 676.8 17.4% 0.0% 0.0% 0.0% 0.71sec 277353 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 325943 1086 5.65 9806 19714 28.3 28.3 17.4% 0.0% 0.0% 0.0% 7.77sec 325943 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 1575697 5252 7.97 33641 67388 39.9 39.9 17.5% 0.0% 0.0% 0.0% 7.50sec 1575697 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 564993 1883 4.91 19595 39448 24.5 24.5 17.3% 0.0% 0.0% 0.0% 12.33sec 564993 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 2759835 9199 13.58 34559 69419 67.9 67.9 17.4% 0.0% 0.0% 0.0% 4.37sec 2759835 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 993286 3311 3.24 50426 101477 16.2 16.2 21.3% 0.0% 0.0% 0.0% 18.75sec 993286 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 519229 1731 38.69 2654 5336 193.4 193.4 17.4% 16.4% 0.0% 0.0% 1.81sec 741775 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 260209 867 38.69 1329 2669 193.4 193.4 17.4% 16.3% 0.0% 0.0% 1.80sec 371737 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.19sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement primordial_wave 375982 48614 162 1.41 5896 11835 7.0 7.0 17.2% 0.0% 0.0% 0.0% 45.72sec 48614 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_pw 188196 806965 2690 1.40 95139 190947 7.0 7.0 21.1% 0.0% 0.0% 0.0% 45.90sec 806965 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 51.7 0.0 0.0% 0.0% 0.0% 0.0% 5.73sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 391455 1305 10.34 6443 12957 51.7 51.7 17.4% 0.0% 0.0% 0.0% 5.73sec 559236 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 195854 653 10.34 3222 6476 51.7 51.7 17.4% 0.0% 0.0% 0.0% 5.73sec 279798 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 232879 776 1.15 34601 69038 5.7 5.7 17.4% 0.0% 0.0% 0.0% 53.59sec 232879 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 214316 714 30.35 1202 2415 151.7 151.7 17.4% 0.0% 0.0% 0.0% 4.07sec 306174 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 25592 414 38.81 545 1090 40.0 40.0 17.3% 0.0% 0.0% 0.0% 2.26sec 36561 61.86sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_fiery_wolf melee 0 200337 4422 118.13 1914 3826 89.2 89.2 17.4% 0.0% 0.0% 0.0% 3.40sec 286203 45.30sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_lightning_wolf melee 0 201102 7207 192.43 1914 3823 89.5 89.5 17.4% 0.0% 0.0% 0.0% 3.43sec 287297 27.91sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_frost_wolf melee 0 200579 4311 115.10 1914 3828 89.3 89.3 17.4% 0.0% 0.0% 0.0% 3.41sec 286549 46.53sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_dre 114051 0 0 0.00 0 0 8.1 0.0 0.0% 0.0% 0.0% 0.0% 31.68sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_damage_dre 344548 297440 991 1.62 30786 61780 8.1 8.1 19.3% 0.0% 0.0% 0.0% 31.68sec 297440 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba doom_winds 384352 23100 77 0.75 6189 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.41sec 33001 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 308.53sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba elemental_blast 117014 2096190 6987 5.07 68277 137161 25.3 25.3 21.0% 0.0% 0.0% 0.0% 11.67sec 2096190 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba feral_spirit 51533 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 21.46sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock 188389 98715 329 6.15 2733 5485 30.7 30.7 17.4% 0.0% 0.0% 0.0% 9.62sec 455504 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock ticks -188389 356790 1189 37.48 1621 3255 30.7 187.4 17.3% 0.0% 0.0% 0.0% 9.62sec 455504 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_attack 10444 444110 1480 222.70 340 682 1113.5 1113.5 17.3% 0.0% 0.0% 0.0% 0.67sec 444110 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba forgestorm_ignited_damage 381700 331284 1104 5.75 9805 19712 28.8 28.8 17.3% 0.0% 0.0% 0.0% 7.58sec 331284 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba frost_shock 196840 318070 1060 3.45 15665 31546 17.3 17.3 17.4% 0.0% 0.0% 0.0% 16.31sec 318070 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ice_strike 342240 434052 1447 4.22 17521 35086 21.1 21.1 17.4% 0.0% 0.0% 0.0% 14.34sec 434052 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lava_lash 60103 408294 1361 3.82 18165 36577 19.1 19.1 17.6% 0.0% 0.0% 0.0% 15.36sec 408294 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt 188196 935572 3119 3.69 41569 83336 18.5 18.5 21.7% 0.0% 0.0% 0.0% 15.35sec 935572 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba main_hand 1 439370 1465 32.80 2651 5326 164.0 164.0 17.3% 16.4% 0.0% 0.0% 2.13sec 627687 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba offhand 2 225558 752 33.56 1328 2668 167.8 167.8 17.4% 16.3% 0.0% 0.0% 2.07sec 322234 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.41sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike 17364 0 0 0.00 0 0 91.8 0.0 0.0% 0.0% 0.0% 0.0% 3.26sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_mh 32175 1219501 4065 24.49 8474 17027 122.4 122.4 17.4% 0.0% 0.0% 0.0% 3.26sec 1742189 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_mh 390287 290075 967 12.21 4751 0 61.1 61.1 0.0% 0.0% 0.0% 0.0% 5.49sec 290075 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_offhand 32176 609566 2032 24.49 4236 8519 122.4 122.4 17.3% 0.0% 0.0% 0.0% 3.26sec 870831 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_offhand 390287 144969 483 12.21 2375 0 61.1 61.1 0.0% 0.0% 0.0% 0.0% 5.49sec 144969 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba sundering 197214 307971 1027 1.30 40475 81416 6.5 6.5 17.1% 0.0% 0.0% 0.0% 48.51sec 307971 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_attack 25504 2032019 6773 82.37 4203 8429 411.8 411.8 17.3% 0.0% 0.0% 0.0% 2.43sec 2902958 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash 114089 150405 501 6.51 3805 7654 32.6 32.6 21.1% 0.0% 0.0% 0.0% 8.70sec 150405 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash_offhand 114093 87720 292 7.60 1902 3820 38.0 38.0 21.2% 0.0% 0.0% 0.0% 7.49sec 87720 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike 115356 0 0 0.00 0 0 23.3 0.0 0.0% 0.0% 0.0% 0.0% 10.21sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_mh 115357 470968 1570 6.21 12899 26023 31.1 31.0 17.3% 0.0% 0.0% 0.0% 10.21sec 470968 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_mh 390287 93304 311 2.31 8086 0 11.5 11.5 0.0% 0.0% 0.0% 0.0% 19.81sec 93304 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_offhand 115360 234990 783 6.21 6455 12965 31.1 31.0 17.1% 0.0% 0.0% 0.0% 10.21sec 234990 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_offhand 390287 46480 155 2.31 4028 0 11.5 11.5 0.0% 0.0% 0.0% 0.0% 19.81sec 46480 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt_ti 188196 906184 3021 4.65 32157 64490 23.3 23.3 21.1% 0.0% 0.0% 0.0% 10.22sec 906184 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_greater_earth_elemental melee 0 26465 423 39.51 547 1095 41.2 41.2 17.4% 0.0% 0.0% 0.0% 2.40sec 37809 62.54sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_spirit_wolf melee 0 812800 7598 204.95 1896 3787 365.4 365.4 17.3% 0.0% 0.0% 0.0% 1.63sec 1161172 106.98sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.44sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance_damage 344548 95677 319 0.40 40270 80984 2.0 2.0 18.6% 0.0% 0.0% 0.0% 180.44sec 95677 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.72sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys doom_winds 384352 22971 77 0.74 6171 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.47sec 32817 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 306.95sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys elemental_blast 117014 1977983 6593 5.00 65290 131118 25.0 25.0 21.0% 0.0% 0.0% 0.0% 11.66sec 1977983 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys feral_spirit 51533 0 0 0.00 0 0 13.4 0.0 0.0% 0.0% 0.0% 0.0% 24.18sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock 188389 106568 355 6.72 2695 5413 33.6 33.6 17.5% 0.0% 0.0% 0.0% 8.71sec 457333 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock ticks -188389 350765 1169 36.97 1615 3241 33.6 184.9 17.4% 0.0% 0.0% 0.0% 8.71sec 457333 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_attack 10444 429826 1433 214.66 341 684 1073.3 1073.3 17.3% 0.0% 0.0% 0.0% 0.69sec 429826 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys forgestorm_ignited_damage 381700 331907 1106 5.76 9806 19717 28.8 28.8 17.4% 0.0% 0.0% 0.0% 7.64sec 331907 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys frost_shock 196840 364976 1217 4.09 15217 30527 20.4 20.4 17.2% 0.0% 0.0% 0.0% 13.70sec 364976 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ice_strike 342240 447284 1491 4.37 17372 34860 21.9 21.9 17.6% 0.0% 0.0% 0.0% 13.79sec 447284 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lava_lash 60103 410384 1368 3.89 17964 36098 19.4 19.4 17.4% 0.0% 0.0% 0.0% 14.81sec 410384 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt 188196 920244 3067 3.77 40160 80457 18.8 18.8 21.6% 0.0% 0.0% 0.0% 14.94sec 920244 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys main_hand 1 449682 1499 34.42 2581 5192 172.1 172.1 17.4% 16.4% 0.0% 0.0% 1.93sec 642420 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys offhand 2 227506 758 34.74 1295 2604 173.7 173.7 17.3% 16.4% 0.0% 0.0% 2.01sec 325016 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike 17364 0 0 0.00 0 0 87.8 0.0 0.0% 0.0% 0.0% 0.0% 3.23sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_mh 32175 1102148 3674 23.41 8011 16091 117.0 117.0 17.4% 0.0% 0.0% 0.0% 3.23sec 1574538 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_mh 390287 256633 855 11.51 4460 0 57.5 57.5 0.0% 0.0% 0.0% 0.0% 5.47sec 256633 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_offhand 32176 551168 1837 23.41 4004 8057 117.0 117.0 17.4% 0.0% 0.0% 0.0% 3.23sec 787403 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_offhand 390287 128282 428 11.51 2229 0 57.5 57.5 0.0% 0.0% 0.0% 0.0% 5.47sec 128282 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys sundering 197214 309831 1033 1.35 39126 78549 6.7 6.7 17.3% 0.0% 0.0% 0.0% 46.26sec 309831 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_attack 25504 2015591 6719 80.93 4252 8496 404.6 404.6 17.2% 0.0% 0.0% 0.0% 2.47sec 2879489 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash 114089 133296 444 4.82 4565 9172 24.1 24.1 20.9% 0.0% 0.0% 0.0% 10.15sec 133296 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash_offhand 114093 69865 233 5.05 2288 4598 25.2 25.2 20.8% 0.0% 0.0% 0.0% 9.69sec 69865 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike 115356 0 0 0.00 0 0 18.1 0.0 0.0% 0.0% 0.0% 0.0% 11.29sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_mh 115357 471858 1573 4.81 16790 33749 24.0 24.0 16.8% 0.0% 0.0% 0.0% 11.29sec 471858 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_mh 390287 115624 385 2.25 10258 0 11.3 11.3 0.0% 0.0% 0.0% 0.0% 18.45sec 115624 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_offhand 115360 235955 787 4.81 8396 16867 24.0 24.0 16.8% 0.0% 0.0% 0.0% 11.29sec 235955 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_offhand 390287 57647 192 2.25 5114 0 11.3 11.3 0.0% 0.0% 0.0% 0.0% 18.45sec 57647 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt_ti 188196 842721 2809 3.60 38710 77554 18.0 18.0 21.0% 0.0% 0.0% 0.0% 11.35sec 842721 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_greater_earth_elemental melee 0 25611 410 38.76 541 1082 40.3 40.3 17.4% 0.0% 0.0% 0.0% 2.56sec 36589 62.41sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_spirit_wolf melee 0 766570 9627 256.60 1920 3833 340.5 340.5 17.3% 0.0% 0.0% 0.0% 1.74sec 1095127 79.62sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
237710.6 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.7 2.2 22.2sec 18.7sec 5.5sec 23.10% 0.00% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 204.0s
  • trigger_min/max:2.2s / 204.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • brittle_1:23.10%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.4sec 18.9sec 5.5sec 23.06% 0.00% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 192.0s
  • trigger_min/max:3.0s / 192.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.06%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 120.6 148.6sec 2.4sec 293.8sec 98.64% 0.00% 111.6 (111.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 330.8s
  • trigger_min/max:0.0s / 15.0s
  • trigger_pct:100.00%
  • duration_min/max:1.8s / 356.0s

Stack Uptimes

  • death_rot_1:0.28%
  • death_rot_2:0.29%
  • death_rot_3:0.80%
  • death_rot_4:0.42%
  • death_rot_5:0.64%
  • death_rot_6:0.57%
  • death_rot_7:0.45%
  • death_rot_8:0.49%
  • death_rot_9:0.45%
  • death_rot_10:94.26%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 6.5 232.5 49.2sec 1.2sec 45.1sec 97.74% 0.00% 175.2 (175.2) 5.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 226.1s
  • trigger_min/max:0.0s / 15.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 224.6s

Stack Uptimes

  • everfrost_1:2.17%
  • everfrost_2:2.16%
  • everfrost_3:2.15%
  • everfrost_4:2.14%
  • everfrost_5:2.13%
  • everfrost_6:2.12%
  • everfrost_7:2.11%
  • everfrost_8:2.10%
  • everfrost_9:2.09%
  • everfrost_10:78.58%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 21.8 39.3 13.7sec 4.9sec 11.7sec 85.20% 0.00% 4.8 (6.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 111.7s
  • trigger_min/max:0.0s / 28.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 109.9s

Stack Uptimes

  • festering_wound_1:20.05%
  • festering_wound_2:26.36%
  • festering_wound_3:19.31%
  • festering_wound_4:9.04%
  • festering_wound_5:4.88%
  • festering_wound_6:5.57%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 66.9 4.5sec 4.4sec 295.4sec 98.45% 98.19% 66.9 (66.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 7.3s
  • trigger_min/max:0.8s / 15.4s
  • trigger_pct:100.00%
  • duration_min/max:232.3s / 359.0s

Stack Uptimes

  • lashing_flames_1:98.45%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 60.3 181.3sec 4.9sec 285.5sec 99.16% 0.00% 56.1 (56.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 347.3s
  • trigger_min/max:0.9s / 60.5s
  • trigger_pct:100.00%
  • duration_min/max:1.4s / 358.0s

Stack Uptimes

  • razorice_1:1.03%
  • razorice_2:0.83%
  • razorice_3:0.93%
  • razorice_4:0.85%
  • razorice_5:95.52%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Rotten Touch 11.7 9.6 25.7sec 13.7sec 13.9sec 54.08% 59.33% 9.6 (9.6) 11.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rotten_touch
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 102.6s
  • trigger_min/max:0.8s / 58.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 82.5s

Stack Uptimes

  • rotten_touch_1:54.08%

Spelldata

  • id:390276
  • name:Rotten Touch
  • tooltip:Scourge Strike damage taken from {$@=}auracaster is increased by {$s1=50}%.
  • description:{$@spelldesc390275=Sudden Doom causes your next Death Coil to also increase your {$?s207311=true}[Clawing Shadows][Scourge Strike] damage against the target by {$390276s1=50}% for {$390276d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 240354.32
Minimum 220309.87
Maximum 264156.08
Spread ( max - min ) 43846.21
Range [ ( max - min ) / 2 * 100% ] 9.12%
Standard Deviation 6533.6376
5th Percentile 229972.13
95th Percentile 251328.30
( 95th Percentile - 5th Percentile ) 21356.17
Mean Distribution
Standard Deviation 75.4490
95.00% Confidence Interval ( 240206.44 - 240502.19 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2839
0.1 Scale Factor Error with Delta=300 364413
0.05 Scale Factor Error with Delta=300 1457652
0.01 Scale Factor Error with Delta=300 36441292
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3756
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 57658869 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.