SimulationCraft 1005-01

for World of Warcraft 10.0.5.48069 Live (hotfix 2023-02-22/48069, git build d588075200)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 43676 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
43675.5 43675.5 49.0 / 0.112% 8398.1 / 19.2% 3432.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.4 12.8 Runic Power 6.73% 51.4 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 43676
Abomination Limb 0 (527) 0.0% (1.2%) 3.0 120.48sec 52327 42503

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2311 0.0000 0.00 0.00 0.00% 42503.47 42503.47

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [e]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [f]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 527 1.2% 38.3 6.91sec 4092 0 Direct 38.3 3213 6474 4092 27.0% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.25 38.25 0.00 0.00 0.00 0.0000 0.0000 156540.28 156540.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.03% 27.94 12 37 3213.01 2279 5281 3212.97 2630 3784 89759 89759 0.00%
crit 26.97% 10.32 1 20 6474.15 4559 10691 6473.38 4695 9081 66781 66781 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2564 5.9% 192.9 1.81sec 3985 2209 Direct 192.9 3574 7193 3985 27.5% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 192.88 192.88 0.00 0.00 0.00 1.8041 0.0000 768694.12 1098162.45 30.00% 2209.16 2209.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.18% 108.36 65 152 3573.67 2435 6421 3573.52 3322 3851 387257 553238 30.00%
crit 27.49% 53.03 23 84 7192.88 4870 13078 7190.79 6317 8036 381437 544925 30.00%
miss 16.32% 31.48 13 57 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1247 2.9% 188.4 1.81sec 1985 1100 Direct 188.4 1786 3596 1985 27.5% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 188.36 188.36 0.00 0.00 0.00 1.8038 0.0000 373859.08 534098.02 30.00% 1100.35 1100.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.77% 105.05 54 147 1786.41 1217 3301 1786.25 1634 1921 187664 268099 30.00%
crit 27.49% 51.78 24 84 3596.03 2435 6616 3595.05 3232 3980 186195 265999 30.00%
miss 16.74% 31.53 12 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Breath of Sindragosa 0 (10995) 0.0% (25.2%) 2.9 120.90sec 1121004 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [i]:2.94
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 10995 25.2% 196.2 1.43sec 16805 0 Direct 196.2 13141 26396 16805 27.6% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 196.21 196.21 0.00 0.00 0.00 0.0000 0.0000 3297386.98 3297386.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.36% 141.97 69 227 13141.43 7338 24282 13153.79 11944 14530 1865753 1865753 0.00%
crit 27.64% 54.24 21 93 26395.88 14675 48550 26420.51 23755 29732 1431634 1431634 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 669 1.5% 2.8 119.94sec 71578 0 Direct 2.7 59583 120398 76126 27.2% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.82 2.65 0.00 0.00 0.00 0.0000 0.0000 201753.99 201753.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.80% 1.93 0 3 59583.49 22015 68019 57321.77 0 68019 114963 114963 0.00%
crit 27.20% 0.72 0 3 120397.85 44910 136038 67813.13 0 136038 86791 86791 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 20 0.0% 1.1 112.34sec 5650 4278 Direct 11.4 410 824 522 27.1% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.06 11.45 0.00 0.00 0.00 1.3211 0.0000 5980.30 5980.30 0.00% 4277.75 4277.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.87% 8.34 0 31 410.19 304 695 302.21 0 622 3422 3422 0.00%
crit 27.13% 3.11 0 16 823.51 608 1342 592.19 0 1325 2558 2558 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [W]:1.06
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 1069 2.4% 7.5 48.21sec 42454 0 Direct 7.5 33425 67178 42484 26.8% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.46 7.45 0.00 0.00 0.00 0.0000 0.0000 316693.33 452430.57 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.16% 5.45 1 9 33424.92 33171 34163 33422.18 33171 34163 182275 260399 30.00%
crit 26.84% 2.00 0 8 67177.72 66341 68326 59740.47 0 68326 134418 192031 26.68%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 2150 4.9% 67.9 4.40sec 9508 0 Periodic 98.7 5116 10277 6535 27.5% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.87 0.00 98.75 98.75 66.87 0.0000 2.9999 645356.00 645356.00 0.00% 2178.58 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 72.49% 71.58 46 99 5115.64 44 10102 5114.25 4750 5537 366191 366191 0.00%
crit 27.51% 27.16 9 48 10277.30 1547 19678 10275.17 8926 11775 279165 279165 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 898 (1347) 2.1% (3.1%) 23.9 7.31sec 16950 12722 Direct 23.9 (47.8) 8861 17782 11297 27.3% (27.4%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.91 23.91 0.00 0.00 0.00 1.3324 0.0000 270098.85 270098.85 0.00% 12721.70 12721.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.69% 17.38 1 43 8860.59 5633 16264 8827.47 6978 10930 154006 154006 0.00%
crit 27.31% 6.53 0 21 17782.18 11266 30734 17618.34 0 23543 116093 116093 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:25.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [H]:3.61
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [n]:10.12
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [r]:10.18
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 449 1.0% 23.9 7.31sec 5653 0 Direct 23.9 4430 8894 5653 27.4% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.91 23.91 0.00 0.00 0.00 0.0000 0.0000 135163.76 135163.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.59% 17.36 0 45 4429.77 2816 8132 4413.16 0 5328 76888 76888 0.00%
crit 27.41% 6.55 0 23 8893.69 5633 15832 8821.34 0 12558 58276 58276 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 6616 (8001) 15.1% (18.3%) 67.9 4.40sec 35318 28927 Direct 67.9 (135.6) 22824 45951 29205 27.6% (27.6%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.87 67.87 0.00 0.00 0.00 1.2210 0.0000 1982253.26 1982253.26 0.00% 28926.54 28926.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.41% 49.14 24 74 22823.63 3909 42458 22821.65 20874 25165 1121626 1121626 0.00%
crit 27.59% 18.73 5 38 45951.22 7818 83021 45944.61 38347 55034 860627 860627 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [S]:49.67
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [X]:0.54
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [Z]:0.72
  • if_expr:buff.rime.react
    single_target
    [m]:16.93
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1385 3.2% 67.7 4.41sec 6126 0 Direct 67.7 4794 9633 6126 27.5% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.72 67.72 0.00 0.00 0.00 0.0000 0.0000 414860.37 414860.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.48% 49.08 24 74 4794.10 2620 8936 4793.72 4320 5285 235306 235306 0.00%
crit 27.52% 18.64 6 37 9632.92 5241 17813 9633.32 7642 11182 179554 179554 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1521 (8392) 3.5% (19.2%) 63.9 4.64sec 39385 19042 Direct 63.9 (216.0) 5583 11247 7139 27.5% (57.1%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.88 63.88 0.00 0.00 0.00 2.0684 0.0000 456078.97 651558.00 30.00% 19041.61 19041.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.52% 46.33 21 72 5583.15 3658 9892 5584.55 5113 6243 258642 369498 30.00%
crit 27.48% 17.55 4 35 11246.89 7316 19366 11246.51 9377 13558 197437 282060 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [U]:24.76
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [V]:46.28
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Y]:9.60
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [l]:12.59
  • if_expr:!variable.pooling_runes&buff.killing_machine.react
    single_target
    [o]:14.77
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 760 1.7% 63.9 4.64sec 3569 0 Direct 63.9 2792 5621 3569 27.5% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.88 63.88 0.00 0.00 0.00 0.0000 0.0000 228003.28 325727.27 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.53% 46.33 21 72 2791.99 1829 4946 2792.82 2515 3092 129356 184799 30.00%
crit 27.47% 17.55 5 34 5621.18 3658 9531 5621.74 4617 6810 98648 140929 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 4074 9.3% 44.1 6.71sec 27683 0 Direct 44.1 0 27683 27683 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.11 44.11 0.00 0.00 0.00 0.0000 0.0000 1221219.32 1221219.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.11 24 65 27682.81 15185 53561 27667.88 24889 30510 1221219 1221219 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2037 4.7% 44.1 6.71sec 13841 0 Direct 44.1 0 13841 13841 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.11 44.11 0.00 0.00 0.00 0.0000 0.0000 610609.66 610609.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.11 24 65 13841.40 7593 26781 13833.94 12445 15255 610610 610610 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (5308) 0.0% (12.2%) 15.1 20.49sec 105455 84282

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.09 0.00 0.00 0.00 0.00 1.2512 0.0000 0.00 0.00 0.00% 84281.76 84281.76

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [R]:9.21
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [k]:5.88
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5308 12.2% 246.2 1.21sec 6465 0 Direct 246.2 5055 10174 6465 27.5% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 246.16 246.16 0.00 0.00 0.00 0.0000 0.0000 1591408.24 1591408.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.46% 178.36 122 241 5055.11 1070 12059 5052.26 4357 5729 901602 901602 0.00%
crit 27.54% 67.80 36 111 10173.74 2141 23481 10168.44 8017 12207 689806 689806 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 200 0.5% 20.3 14.32sec 2954 0 Direct 20.3 2314 4651 2954 27.4% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.29 20.29 0.00 0.00 0.00 0.0000 0.0000 59929.86 85616.27 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.60% 14.73 3 31 2313.56 2296 2365 2313.60 2296 2365 34074 48679 30.00%
crit 27.40% 5.56 0 15 4650.66 4593 4730 4637.69 0 4730 25856 36937 29.92%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 200 0.5% 20.3 14.35sec 2955 0 Direct 20.3 2314 4650 2955 27.5% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.30 20.30 0.00 0.00 0.00 0.0000 0.0000 60007.24 85726.81 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.53% 14.73 4 31 2313.59 2296 2365 2313.57 2296 2365 34074 48678 30.00%
crit 27.47% 5.58 0 16 4650.04 4593 4730 4632.62 0 4730 25933 37049 29.89%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 1807 / 986
Claw 595 0.7% 52.5 5.36sec 1853 1853 Direct 52.5 1451 2907 1853 27.6% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.47 52.47 0.00 0.00 0.00 1.0000 0.0000 97212.84 138879.03 30.00% 1852.84 1852.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.42% 38.00 15 52 1451.32 910 2404 1452.48 1308 1603 55146 78783 30.00%
crit 27.58% 14.47 3 28 2906.98 1820 4683 2909.74 2416 3496 42066 60096 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.47
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.73sec 64 64 Direct 2.9 50 100 64 27.3% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.00 1.0000 0.0000 185.86 265.52 30.00% 63.54 63.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.69% 2.13 0 3 49.91 33 66 48.65 0 64 106 152 29.20%
crit 27.31% 0.80 0 3 99.77 65 132 59.89 0 132 80 114 18.02%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.93
main_hand 1212 1.5% 95.3 2.91sec 2078 1344 Direct 95.3 1629 3261 2078 27.5% 0.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.33 95.33 0.00 0.00 0.00 1.5458 0.0000 198118.41 283033.51 30.00% 1344.47 1344.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.47% 69.08 39 91 1628.88 1011 2694 1630.51 1488 1802 112521 160748 30.00%
crit 27.53% 26.25 9 48 3261.20 2023 5203 3264.51 2845 3774 85598 122286 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Anti-Magic Shell 5.1 64.65sec

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 5.10 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [G]:5.10
  • if_expr:runic_power.deficit>40
Arcane Torrent 2.1 134.78sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.11 0.00 0.00 0.00 0.00 1.2890 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [a]:1.41
  • if_expr:runic_power<60
    single_target
    [q]:0.70
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 85.42sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [c]:0.37
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [d]:3.58
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.9 61.64sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.91 0.00 0.00 0.00 0.00 1.2180 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [T]:4.40
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [p]:0.50
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 8.0 39.60sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [g]:0.34
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [h]:7.62
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.4 306.29sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [b]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.73sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [j]:2.98
Unholy Strength 20.4 14.30sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.40 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5sec 120.5sec 11.8sec 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 122.4s
  • trigger_min/max:120.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Anti-Magic Shell 5.1 0.0 64.0sec 64.7sec 5.0sec 8.44% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 146.9s
  • trigger_min/max:60.0s / 146.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • antimagic_shell_1:8.44%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 12.1 32.0 25.1sec 6.7sec 19.4sec 78.54% 0.00% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.3s / 74.3s
  • trigger_min/max:0.9s / 48.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.3s

Stack Uptimes

  • bonegrinder_crit_1:24.55%
  • bonegrinder_crit_2:18.78%
  • bonegrinder_crit_3:14.52%
  • bonegrinder_crit_4:11.47%
  • bonegrinder_crit_5:9.22%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 4.1 0.0 63.5sec 63.5sec 9.8sec 13.52% 39.07% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 319.3s
  • trigger_min/max:12.2s / 319.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • bonegrinder_frost_1:13.52%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.8 13.9 120.8sec 14.9sec 19.4sec 18.21% 0.00% 1.8 (1.8) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 154.3s
  • trigger_min/max:0.0s / 134.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.86%
  • bound_by_fire_and_blaze_2:4.15%
  • bound_by_fire_and_blaze_3:3.95%
  • bound_by_fire_and_blaze_4:3.51%
  • bound_by_fire_and_blaze_5:2.60%
  • bound_by_fire_and_blaze_6:3.15%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.9sec 120.9sec 66.6sec 65.31% 0.00% 195.7 (195.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 207.1s
  • trigger_min/max:120.0s / 207.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 203.0s

Stack Uptimes

  • breath_of_sindragosa_1:65.31%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Dragon Games Equipment 3.0 0.0 120.5sec 120.5sec 0.7sec 0.69% 0.00% 7.5 (7.5) 3.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.61
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 122.4s
  • trigger_min/max:120.0s / 122.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s

Stack Uptimes

  • dragon_games_equipment_1:0.69%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.6sec 98.1sec 58.0sec 25.13% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 308.7s

Stack Uptimes

  • elemental_chaos_air_1:25.13%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.3sec 98.3sec 58.0sec 24.99% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:24.99%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 121.7sec 97.9sec 57.8sec 24.89% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:24.90%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.0sec 98.4sec 58.2sec 24.99% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:24.99%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.3sec 306.3sec 26.9sec 12.79% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.2s
  • trigger_min/max:300.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.79%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 85.4sec 85.4sec 19.5sec 25.91% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.1s / 236.9s
  • trigger_min/max:0.0s / 236.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:25.91%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 7.6 0.0 39.6sec 39.6sec 12.2sec 31.06% 0.00% 0.0 (0.0) 7.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.1s / 56.7s
  • trigger_min/max:26.1s / 56.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • enduring_strength_1:31.06%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 7.8 17.4 40.0sec 11.5sec 9.6sec 25.08% 98.47% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:22.3s / 124.5s
  • trigger_min/max:0.9s / 115.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:9.88%
  • enduring_strength_builder_2:7.75%
  • enduring_strength_builder_3:4.61%
  • enduring_strength_builder_4:1.99%
  • enduring_strength_builder_5:0.64%
  • enduring_strength_builder_6:0.17%
  • enduring_strength_builder_7:0.03%
  • enduring_strength_builder_8:0.00%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storm 13.4 130.4 23.1sec 2.1sec 15.4sec 69.14% 87.07% 70.3 (109.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.2s / 101.8s
  • trigger_min/max:0.9s / 32.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 98.6s

Stack Uptimes

  • gathering_storm_1:2.26%
  • gathering_storm_2:4.96%
  • gathering_storm_3:5.31%
  • gathering_storm_4:3.26%
  • gathering_storm_5:5.05%
  • gathering_storm_6:4.09%
  • gathering_storm_7:3.47%
  • gathering_storm_8:3.78%
  • gathering_storm_9:3.07%
  • gathering_storm_10:33.87%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.2 218.4 192.2sec 1.3sec 251.6sec 97.75% 82.61% 216.1 (216.1) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:115.7s / 288.3s
  • trigger_min/max:1.0s / 13.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.0s

Stack Uptimes

  • icy_talons_1:0.39%
  • icy_talons_2:0.39%
  • icy_talons_3:96.97%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 44.4 7.7 6.7sec 5.7sec 1.6sec 24.10% 40.88% 7.7 (7.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 47.3s
  • trigger_min/max:0.0s / 47.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • killing_machine_1:24.10%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.0 0.0 39.6sec 39.6sec 11.8sec 31.21% 28.82% 0.0 (0.0) 7.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.1s / 56.7s
  • trigger_min/max:26.1s / 56.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:31.21%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 7.9 58.3 39.6sec 4.4sec 11.5sec 30.54% 51.46% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.9s / 56.6s
  • trigger_min/max:0.9s / 46.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:2.03%
  • pillar_of_frost_bonus_2:2.46%
  • pillar_of_frost_bonus_3:2.97%
  • pillar_of_frost_bonus_4:2.43%
  • pillar_of_frost_bonus_5:2.56%
  • pillar_of_frost_bonus_6:2.72%
  • pillar_of_frost_bonus_7:2.40%
  • pillar_of_frost_bonus_8:2.34%
  • pillar_of_frost_bonus_9:2.15%
  • pillar_of_frost_bonus_10:1.80%
  • pillar_of_frost_bonus_11:1.66%
  • pillar_of_frost_bonus_12:1.44%
  • pillar_of_frost_bonus_13:1.14%
  • pillar_of_frost_bonus_14:0.83%
  • pillar_of_frost_bonus_15:0.50%
  • pillar_of_frost_bonus_16:0.31%
  • pillar_of_frost_bonus_17:0.24%
  • pillar_of_frost_bonus_18:0.19%
  • pillar_of_frost_bonus_19:0.17%
  • pillar_of_frost_bonus_20:0.12%
  • pillar_of_frost_bonus_21:0.05%
  • pillar_of_frost_bonus_22:0.01%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.5 1.6 23.0sec 20.5sec 17.0sec 76.80% 0.00% 225.1 (225.1) 12.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 101.5s
  • trigger_min/max:20.0s / 27.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 99.7s

Stack Uptimes

  • remorseless_winter_1:76.80%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 68.0 5.6 4.4sec 4.1sec 1.4sec 31.88% 99.78% 5.6 (5.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 52.6s
  • trigger_min/max:0.0s / 52.6s
  • trigger_pct:63.08%
  • duration_min/max:0.0s / 16.8s

Stack Uptimes

  • rime_1:31.88%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.7 15.1 21.9sec 10.2sec 12.0sec 54.64% 0.00% 15.1 (15.1) 13.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 130.1s
  • trigger_min/max:0.9s / 117.4s
  • trigger_pct:15.01%
  • duration_min/max:0.0s / 83.7s

Stack Uptimes

  • rune_mastery_1:54.64%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.6 23.4sec 14.3sec 10.3sec 43.63% 43.00% 7.6 (7.6) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 83.1s
  • trigger_min/max:0.0s / 59.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.8s

Stack Uptimes

  • rune_of_hysteria_1:43.63%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Strength 8.5 11.9 35.8sec 14.3sec 23.7sec 66.79% 0.00% 11.9 (11.9) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 170.7s
  • trigger_min/max:0.0s / 59.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 146.7s

Stack Uptimes

  • unholy_strength_1:66.79%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 1.2 218.4 192.2sec 1.3sec 251.6sec 97.75% 97.12% 216.1 (216.1) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:115.7s / 288.3s
  • trigger_min/max:1.0s / 13.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.0s

Stack Uptimes

  • unleashed_frenzy_1:0.39%
  • unleashed_frenzy_2:0.39%
  • unleashed_frenzy_3:96.97%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=10 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 27.0 9.0 48.0 10.8s 1.3s 167.6s
windfury_totem_extra_attack_oh 22.4 7.0 43.0 13.0s 1.3s 140.1s
Killing Machine spent on Obliterate 44.1 24.0 65.0 6.7s 0.9s 48.4s
Killing Machine: Critical auto attacks 44.4 25.0 66.0 6.7s 1.3s 47.3s
Killing Machine wasted: Critical auto attacks 7.7 0.0 20.0 34.4s 1.3s 284.1s
Rune ready 228.1 159.0 301.0 1.4s 0.0s 11.6s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 5.68% 0.00% 22.57% 1.1s 0.0s 10.4s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=332744)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0611.168 / 0.9373.10619.439
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
10.67827.66151.814 / 50.23481.778135.462

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Anti-Magic Shell4.7260.00186.94516.2570.00091.921
Remorseless Winter0.6280.0017.5247.0151.28225.307
Horn of Winter18.2070.001158.36065.2870.000176.760
Death and Decay83.6630.027237.11326.8540.000237.113
Empower Rune Weapon26.6457.17241.0030.0110.00041.003
Abomination Limb0.6000.0012.4330.9610.0004.112
Pillar of Frost1.8980.00114.63011.4370.55528.967
Breath of Sindragosa1.1120.00187.0941.6750.00087.094
Raise Dead0.7720.0012.8901.4440.2644.720

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Breath of SindragosaRune10.6510.604.64%0.990.050.50%
Empower Rune WeaponRunic Power19.1387.802.29%4.597.858.21%
Empower Rune WeaponRune19.1319.068.36%1.000.060.34%
Frost FeverRunic Power32.21147.973.86%4.5913.098.13%
Horn of WinterRunic Power4.91122.633.20%25.000.000.00%
Horn of WinterRune9.819.814.30%1.000.000.01%
Murderous EfficiencyRune22.1122.119.69%1.000.000.00%
Rage of the Frozen ChampionRunic Power67.72506.6413.23%7.4835.136.49%
Rune RegenerationRune92.2692.2640.44%1.000.000.00%
Rune of HysteriaRunic Power167.55333.448.71%1.9938.8010.42%
Runic AttenuationRunic Power71.75335.888.77%4.6822.886.38%
Runic EmpowermentRune74.5774.3032.57%1.000.270.37%
Arcane TorrentRunic Power2.1142.201.10%20.000.000.00%
Death and DecayRunic Power1.0610.580.28%10.000.000.00%
Howling BlastRunic Power67.871.500.04%0.020.000.00%
ObliterateRunic Power108.002100.7254.86%19.4559.222.74%
Remorseless WinterRunic Power15.09140.033.66%9.2810.887.21%
pet - ghoul
energy_regenEnergy1110.981933.21100.00%1.74171.608.15%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 195.663130.5916.0015.961053.28
Death and DecayRune 1.061.061.001.005650.36
Frost StrikeRunic Power 23.91597.6925.0025.00678.04
Howling BlastRune 67.870.150.000.0015954524.68
ObliterateRune 108.00215.992.003.3811648.10
Remorseless WinterRune 15.0915.091.001.00105454.68
pet - ghoul
ClawEnergy 52.472098.7740.0040.0046.32
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 12.76 12.43 187.9 101.1 0.0 144.0
Rune 6.0 0.76 0.77 0.0 1.8 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 43675.51
Minimum 34709.31
Maximum 51388.41
Spread ( max - min ) 16679.10
Range [ ( max - min ) / 2 * 100% ] 19.09%
Standard Deviation 2163.4521
5th Percentile 40116.55
95th Percentile 47174.04
( 95th Percentile - 5th Percentile ) 7057.48
Mean Distribution
Standard Deviation 24.9831
95.00% Confidence Interval ( 43626.55 - 43724.48 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9426
0.1 Scale Factor Error with Delta=300 39956
0.05 Scale Factor Error with Delta=300 159823
0.01 Scale Factor Error with Delta=300 3995566
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 43675.51
Minimum 34709.31
Maximum 51388.41
Spread ( max - min ) 16679.10
Range [ ( max - min ) / 2 * 100% ] 19.09%
Standard Deviation 2163.4521
5th Percentile 40116.55
95th Percentile 47174.04
( 95th Percentile - 5th Percentile ) 7057.48
Mean Distribution
Standard Deviation 24.9831
95.00% Confidence Interval ( 43626.55 - 43724.48 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9426
0.1 Scale Factor Error with Delta=300 39956
0.05 Scale Factor Error with Delta=300 159823
0.01 Scale Factor Error with Delta=300 3995566
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 43675.51
Minimum 34709.31
Maximum 51388.41
Spread ( max - min ) 16679.10
Range [ ( max - min ) / 2 * 100% ] 19.09%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 12795896.87
Minimum 8147878.45
Maximum 16856224.37
Spread ( max - min ) 8708345.92
Range [ ( max - min ) / 2 * 100% ] 34.03%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
5 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
B 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
C 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
D 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
E 0.00 variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
Default action list Executed every time the actor is available.
# count action,conditions
F 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=3,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
G 5.10 antimagic_shell,if=runic_power.deficit>40
0.00 antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa)
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
H 3.61 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
I 0.00 call_action_list,name=trinkets
Choose Action list to run
J 0.00 call_action_list,name=cooldowns
K 0.00 call_action_list,name=racials
L 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
M 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
N 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
O 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
P 0.00 call_action_list,name=aoe,if=active_enemies>=2
Q 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
R 9.21 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
S 49.67 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
T 4.40 horn_of_winter,if=rune<2&runic_power.deficit>25
U 24.76 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
V 46.28 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
W 1.06 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
X 0.54 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
Y 9.60 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
Z 0.72 howling_blast,if=buff.rime.react
a 1.41 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
b 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
c 0.37 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
d 3.58 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
e 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
f 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
g 0.34 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
h 7.62 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
i 2.94 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
j 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
k 5.88 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
0.00 frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
l 12.59 obliterate,if=!variable.pooling_runes&buff.killing_machine.react
m 16.93 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
n 10.12 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
o 14.77 obliterate,if=!variable.pooling_runes
p 0.50 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
q 0.70 arcane_torrent,if=runic_power.deficit>20
r 10.18 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
s 2.82 use_item,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
t 2.99 use_item,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABCDEFGtfjkmooidhbSVSVSVSUSVTVVSYsRYSUSYSUSYUVSdURSUhVUSUSVUVVTGVRVSVVSVaWomomkHhroorlmrrlmorrkoonrrrlmooHrGtfjmklihVSVUSSVVTYSsYRUVVSVSVSdVVSUhSURVVSVVSVVYSYSYSRTUSYYYSGVSVSURhVSUVVSUSVSaUSVRUSomorrrtfjlmkoidhSVSUVSUGVSVVSVsTRYYSYYSYSUSVVhRVSVZWlmomo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat 4 trinket_1_exclude PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat 5 trinket_2_exclude PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat 6 trinket_1_sync PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat 7 trinket_2_sync PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat A trinket_priority PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat B trinket_1_manual PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat C trinket_2_manual PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat D rw_buffs PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
Pre precombat E 2h_check PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
0:00.000 default F auto_attack Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_frost
0:00.000 default G antimagic_shell PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, elemental_chaos_frost
0:00.000 trinkets t use_item_dragon_games_equipment Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, elemental_chaos_frost
0:00.000 cooldowns f abomination_limb Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, dragon_games_equipment, elemental_chaos_frost
0:01.034 cooldowns j raise_dead Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, abomination_limb, rime, elemental_chaos_frost
0:01.034 single_target k remorseless_winter Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, abomination_limb, rime, elemental_chaos_frost
0:02.069 single_target m howling_blast Fluffy_Pillow 15.0/144: 10% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, abomination_limb, remorseless_winter, rime, elemental_chaos_frost
0:03.105 single_target o obliterate Fluffy_Pillow 23.0/144: 16% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, abomination_limb, gathering_storm, remorseless_winter, elemental_chaos_frost
0:04.139 single_target o obliterate Fluffy_Pillow 48.0/144: 33% runic_power
3.0/6: 50% rune
bloodlust, antimagic_shell, abomination_limb, gathering_storm(3), remorseless_winter, elemental_chaos_frost
0:05.174 cooldowns i breath_of_sindragosa Fluffy_Pillow 68.0/144: 47% runic_power
1.0/6: 17% rune
bloodlust, abomination_limb, gathering_storm(5), remorseless_winter, rime, elemental_chaos_frost
0:05.174 cooldowns d empower_rune_weapon Fluffy_Pillow 68.0/144: 47% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, elemental_chaos_frost
0:05.174 cooldowns h pillar_of_frost Fluffy_Pillow 73.0/144: 51% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), remorseless_winter, rime, elemental_chaos_frost
0:05.174 cooldowns b potion Fluffy_Pillow 73.0/144: 51% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, elemental_chaos_frost
0:05.174 breath S howling_blast Fluffy_Pillow 73.0/144: 51% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.076 breath V obliterate Fluffy_Pillow 86.0/144: 60% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.976 breath S howling_blast Fluffy_Pillow 90.0/144: 62% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, unleashed_frenzy, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.877 breath V obliterate Fluffy_Pillow 82.0/144: 57% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, unleashed_frenzy(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:08.779 breath S howling_blast Fluffy_Pillow 86.0/144: 60% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.678 breath V obliterate Fluffy_Pillow 83.0/144: 58% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:10.579 breath S howling_blast Fluffy_Pillow 92.0/144: 64% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:11.480 breath U obliterate Fluffy_Pillow 84.0/144: 58% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:12.380 breath S howling_blast Fluffy_Pillow 93.0/144: 65% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:13.282 breath V obliterate Fluffy_Pillow 85.0/144: 59% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.182 breath T horn_of_winter Fluffy_Pillow 89.0/144: 62% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.083 breath V obliterate Fluffy_Pillow 119.0/144: 83% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.984 breath V obliterate Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(4), unleashed_frenzy(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:16.886 breath S howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(19), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:17.785 Waiting     0.479 sec 128.1/144: 89% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:18.264 breath Y obliterate Fluffy_Pillow 112.1/144: 78% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:19.164 Waiting     0.890 sec 143.1/144: 99% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.054 trinkets s use_item_blazebinders_hoof Fluffy_Pillow 127.1/144: 88% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.054 Waiting     0.741 sec 127.1/144: 88% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.795 breath R remorseless_winter Fluffy_Pillow 123.5/144: 86% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:21.935 Waiting     0.294 sec 126.1/144: 88% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:22.229 breath Y obliterate Fluffy_Pillow 110.1/144: 76% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:23.129 breath S howling_blast Fluffy_Pillow 141.1/144: 98% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:24.030 breath U obliterate Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:24.932 breath S howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:25.833 Waiting     0.416 sec 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:26.249 breath Y obliterate Fluffy_Pillow 112.0/144: 78% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:27.284 breath S howling_blast Fluffy_Pillow 120.8/144: 84% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.319 Waiting     0.093 sec 114.7/144: 80% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.412 breath U obliterate Fluffy_Pillow 114.7/144: 80% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:29.447 breath S howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:30.483 Waiting     0.786 sec 121.9/144: 85% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:31.269 breath Y obliterate Fluffy_Pillow 105.9/144: 74% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:32.304 Waiting     2.234 sec 114.7/144: 80% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:34.538 breath U obliterate Fluffy_Pillow 88.9/144: 62% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:35.575 Waiting     0.648 sec 97.7/144: 68% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_frost
0:36.223 breath V obliterate Fluffy_Pillow 87.9/144: 61% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_frost
0:37.260 breath S howling_blast Fluffy_Pillow 96.7/144: 67% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_frost
0:38.297 Waiting     1.892 sec 96.8/144: 67% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_frost
0:40.189 cooldowns d empower_rune_weapon Fluffy_Pillow 64.8/144: 45% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:40.189 breath U obliterate Fluffy_Pillow 71.0/144: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:41.358 breath R remorseless_winter Fluffy_Pillow 86.0/144: 60% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:42.527 breath S howling_blast Fluffy_Pillow 88.6/144: 62% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:43.698 breath U obliterate Fluffy_Pillow 82.6/144: 57% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:44.868 cooldowns h pillar_of_frost Fluffy_Pillow 91.4/144: 63% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:44.868 breath V obliterate Fluffy_Pillow 91.4/144: 63% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:46.039 Waiting     3.147 sec 112.6/144: 78% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
0:49.186 breath U obliterate Fluffy_Pillow 61.0/144: 42% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost
0:50.357 breath S howling_blast Fluffy_Pillow 80.0/144: 56% runic_power
5.0/6: 83% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_frost
0:51.527 breath U obliterate Fluffy_Pillow 72.0/144: 50% runic_power
5.0/6: 83% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_frost
0:52.697 breath S howling_blast Fluffy_Pillow 81.0/144: 56% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost
0:53.867 breath V obliterate Fluffy_Pillow 78.0/144: 54% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost
0:55.037 Waiting     0.170 sec 87.0/144: 60% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost
0:55.207 breath U obliterate Fluffy_Pillow 76.0/144: 53% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_frost
0:56.379 breath V obliterate Fluffy_Pillow 80.0/144: 56% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(4), unleashed_frenzy(3), elemental_chaos_frost
0:57.549 breath V obliterate Fluffy_Pillow 84.0/144: 58% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
0:58.721 Waiting     0.321 sec 88.0/144: 61% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
0:59.042 breath T horn_of_winter Fluffy_Pillow 88.0/144: 61% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
1:00.353 default G antimagic_shell PR_Death_Knight_Frost 91.0/144: 63% runic_power
5.0/6: 83% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:00.353 breath V obliterate Fluffy_Pillow 91.0/144: 63% runic_power
5.0/6: 83% rune
antimagic_shell, rune_mastery, breath_of_sindragosa, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:01.698 breath R remorseless_winter Fluffy_Pillow 95.0/144: 66% runic_power
3.0/6: 50% rune
antimagic_shell, breath_of_sindragosa, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:03.041 breath V obliterate Fluffy_Pillow 94.0/144: 65% runic_power
3.0/6: 50% rune
antimagic_shell, breath_of_sindragosa, icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:04.384 breath S howling_blast Fluffy_Pillow 87.0/144: 60% runic_power
2.0/6: 33% rune
antimagic_shell, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:05.728 breath V obliterate Fluffy_Pillow 84.0/144: 58% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:07.072 Waiting     1.097 sec 88.0/144: 61% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:08.169 breath V obliterate Fluffy_Pillow 72.0/144: 50% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:09.512 breath S howling_blast Fluffy_Pillow 60.0/144: 42% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:10.856 breath V obliterate Fluffy_Pillow 52.0/144: 36% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:12.201 breath a arcane_torrent Fluffy_Pillow 45.0/144: 31% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:13.544 Waiting     1.672 sec 54.0/144: 37% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
1:15.216 breath W death_and_decay Fluffy_Pillow 27.0/144: 19% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
1:16.561 Waiting     0.655 sec 21.0/144: 15% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), unleashed_frenzy(3), elemental_chaos_earth
1:17.216 single_target o obliterate Fluffy_Pillow 5.0/144: 3% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:18.560 single_target m howling_blast Fluffy_Pillow 29.8/144: 21% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), rime, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:19.904 single_target o obliterate Fluffy_Pillow 39.7/144: 28% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:21.248 single_target m howling_blast Fluffy_Pillow 64.5/144: 45% runic_power
1.0/6: 17% rune
icy_talons(3), rime, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:22.592 single_target k remorseless_winter Fluffy_Pillow 74.4/144: 52% runic_power
1.0/6: 17% rune
icy_talons(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:23.937 default H frost_strike Fluffy_Pillow 93.0/144: 65% runic_power
0.0/6: 0% rune
icy_talons(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:25.281 cooldowns h pillar_of_frost Fluffy_Pillow 68.0/144: 47% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:25.281 single_target r frost_strike Fluffy_Pillow 68.0/144: 47% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), pillar_of_frost, remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:26.624 single_target o obliterate Fluffy_Pillow 43.0/144: 30% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), pillar_of_frost, remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:27.969 single_target o obliterate Fluffy_Pillow 68.0/144: 47% runic_power
3.0/6: 50% rune
unholy_strength, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:29.314 single_target r frost_strike Fluffy_Pillow 93.0/144: 65% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(4), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:30.659 single_target l obliterate Fluffy_Pillow 68.0/144: 47% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(4), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:32.004 single_target m howling_blast Fluffy_Pillow 93.0/144: 65% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_earth
1:33.349 single_target r frost_strike Fluffy_Pillow 101.0/144: 70% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_earth
1:34.693 single_target r frost_strike Fluffy_Pillow 76.0/144: 53% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_earth
1:36.038 single_target l obliterate Fluffy_Pillow 56.0/144: 39% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_earth
1:37.382 single_target m howling_blast Fluffy_Pillow 76.0/144: 53% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:38.726 single_target o obliterate Fluffy_Pillow 84.0/144: 58% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:40.071 single_target r frost_strike Fluffy_Pillow 104.0/144: 72% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:41.415 single_target r frost_strike Fluffy_Pillow 85.2/144: 59% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:42.759 single_target k remorseless_winter Fluffy_Pillow 60.2/144: 42% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:44.102 single_target o obliterate Fluffy_Pillow 78.8/144: 55% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:45.446 single_target o obliterate Fluffy_Pillow 109.8/144: 76% runic_power
2.0/6: 33% rune
gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:46.790 single_target n frost_strike Fluffy_Pillow 140.8/144: 98% runic_power
0.0/6: 0% rune
gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:48.135 single_target r frost_strike Fluffy_Pillow 115.8/144: 80% runic_power
1.0/6: 17% rune
gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:49.479 single_target r frost_strike Fluffy_Pillow 97.0/144: 67% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:50.823 single_target r frost_strike Fluffy_Pillow 72.0/144: 50% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:52.168 single_target l obliterate Fluffy_Pillow 47.0/144: 33% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:53.513 single_target m howling_blast Fluffy_Pillow 78.0/144: 54% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(6), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:54.856 single_target o obliterate Fluffy_Pillow 87.9/144: 61% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
1:56.199 single_target o obliterate Fluffy_Pillow 107.9/144: 75% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
1:57.542 default H frost_strike Fluffy_Pillow 132.9/144: 92% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
1:58.886 single_target r frost_strike Fluffy_Pillow 107.9/144: 75% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
2:00.230 default G antimagic_shell PR_Death_Knight_Frost 87.9/144: 61% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
2:00.353 trinkets t use_item_dragon_games_equipment Fluffy_Pillow 87.9/144: 61% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
2:00.353 cooldowns f abomination_limb Fluffy_Pillow 87.9/144: 61% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), dragon_games_equipment, elemental_chaos_earth
2:01.696 cooldowns j raise_dead Fluffy_Pillow 87.9/144: 61% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
2:01.696 single_target m howling_blast Fluffy_Pillow 87.9/144: 61% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
2:03.042 single_target k remorseless_winter Fluffy_Pillow 95.9/144: 67% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, abomination_limb, icy_talons(3), killing_machine, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:04.388 single_target l obliterate Fluffy_Pillow 114.5/144: 80% runic_power
3.0/6: 50% rune
antimagic_shell, abomination_limb, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:05.732 cooldowns i breath_of_sindragosa Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
rune_mastery, abomination_limb, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:05.732 cooldowns h pillar_of_frost Fluffy_Pillow 144.0/144: 100% runic_power
3.0/6: 50% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:05.732 Waiting     1.093 sec 144.0/144: 100% runic_power
3.0/6: 50% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:06.825 breath V obliterate Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:08.170 breath S howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:09.514 breath V obliterate Fluffy_Pillow 121.9/144: 85% runic_power
3.0/6: 50% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:10.858 breath U obliterate Fluffy_Pillow 118.2/144: 82% runic_power
2.0/6: 33% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth
2:12.202 breath S howling_blast Fluffy_Pillow 127.2/144: 88% runic_power
1.0/6: 17% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_earth
2:13.548 breath S howling_blast Fluffy_Pillow 124.2/144: 86% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_earth
2:14.892 breath V obliterate Fluffy_Pillow 105.2/144: 73% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_earth
2:16.237 breath V obliterate Fluffy_Pillow 114.2/144: 79% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), elemental_chaos_earth
2:17.582 breath T horn_of_winter Fluffy_Pillow 118.2/144: 82% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), elemental_chaos_earth
2:18.927 breath Y obliterate Fluffy_Pillow 111.2/144: 77% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:20.272 breath S howling_blast Fluffy_Pillow 126.2/144: 88% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:21.617 trinkets s use_item_blazebinders_hoof Fluffy_Pillow 120.1/144: 83% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:21.617 Waiting     0.196 sec 120.1/144: 83% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, elemental_chaos_earth
2:21.813 breath Y obliterate Fluffy_Pillow 104.1/144: 72% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_earth
2:23.159 breath R remorseless_winter Fluffy_Pillow 119.1/144: 83% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_earth
2:24.504 breath U obliterate Fluffy_Pillow 115.5/144: 80% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_earth
2:25.849 Waiting     0.888 sec 108.3/144: 75% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_earth
2:26.737 breath V obliterate Fluffy_Pillow 92.3/144: 64% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth
2:28.081 breath V obliterate Fluffy_Pillow 96.3/144: 67% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth
2:29.423 breath S howling_blast Fluffy_Pillow 100.3/144: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(6), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth
2:30.768 breath V obliterate Fluffy_Pillow 81.3/144: 56% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth
2:32.113 breath S howling_blast Fluffy_Pillow 90.3/144: 63% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth
2:33.458 breath V obliterate Fluffy_Pillow 82.3/144: 57% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_earth
2:34.803 breath S howling_blast Fluffy_Pillow 70.3/144: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_chaos_earth
2:35.801 cooldowns d empower_rune_weapon Fluffy_Pillow 62.3/144: 43% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_chaos_earth
2:36.147 breath V obliterate Fluffy_Pillow 72.3/144: 50% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth
2:37.319 breath V obliterate Fluffy_Pillow 81.1/144: 56% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth
2:38.488 breath S howling_blast Fluffy_Pillow 89.9/144: 62% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth
2:39.660 breath U obliterate Fluffy_Pillow 90.0/144: 63% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_earth
2:40.831 cooldowns h pillar_of_frost Fluffy_Pillow 89.0/144: 62% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_earth
2:40.831 breath S howling_blast Fluffy_Pillow 89.0/144: 62% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_earth
2:42.001 breath U obliterate Fluffy_Pillow 83.0/144: 58% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:43.171 breath R remorseless_winter Fluffy_Pillow 91.8/144: 64% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:44.342 breath V obliterate Fluffy_Pillow 88.2/144: 61% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:45.512 Waiting     0.284 sec 97.0/144: 67% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:45.796 breath V obliterate Fluffy_Pillow 81.0/144: 56% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:46.967 breath S howling_blast Fluffy_Pillow 96.0/144: 67% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:48.136 breath V obliterate Fluffy_Pillow 102.3/144: 71% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:49.307 Waiting     0.493 sec 111.1/144: 77% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:49.800 breath V obliterate Fluffy_Pillow 95.1/144: 66% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:50.970 breath S howling_blast Fluffy_Pillow 110.1/144: 76% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:52.139 breath V obliterate Fluffy_Pillow 110.2/144: 77% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:53.311 Waiting     0.534 sec 119.0/144: 83% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:53.845 breath V obliterate Fluffy_Pillow 103.0/144: 72% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:55.017 breath Y obliterate Fluffy_Pillow 118.0/144: 82% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:56.187 breath S howling_blast Fluffy_Pillow 133.0/144: 92% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:57.530 Waiting     0.291 sec 128.0/144: 89% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:57.821 breath Y obliterate Fluffy_Pillow 112.0/144: 78% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
2:59.166 breath S howling_blast Fluffy_Pillow 127.0/144: 88% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
3:00.510 Waiting     0.297 sec 120.9/144: 84% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:00.807 breath Y obliterate Fluffy_Pillow 104.9/144: 73% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:02.151 breath S howling_blast Fluffy_Pillow 119.9/144: 83% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:03.495 breath R remorseless_winter Fluffy_Pillow 120.0/144: 83% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:04.842 breath T horn_of_winter Fluffy_Pillow 106.6/144: 74% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:06.186 breath U obliterate Fluffy_Pillow 121.6/144: 84% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:07.531 breath S howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:08.877 breath Y obliterate Fluffy_Pillow 118.3/144: 82% runic_power
6.0/6: 100% rune
unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_frost
3:10.222 Waiting     0.602 sec 122.3/144: 85% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_frost
3:10.824 breath Y obliterate Fluffy_Pillow 111.3/144: 77% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_frost
3:12.170 breath Y obliterate Fluffy_Pillow 115.3/144: 80% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:13.515 breath S howling_blast Fluffy_Pillow 124.3/144: 86% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(9), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:14.858 default G antimagic_shell PR_Death_Knight_Frost 100.3/144: 70% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:14.858 breath V obliterate Fluffy_Pillow 100.3/144: 70% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:16.203 breath S howling_blast Fluffy_Pillow 109.3/144: 76% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:17.547 breath V obliterate Fluffy_Pillow 101.3/144: 70% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:18.890 breath S howling_blast Fluffy_Pillow 94.3/144: 65% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:20.234 breath U obliterate Fluffy_Pillow 91.3/144: 63% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:21.580 Waiting     1.700 sec 95.3/144: 66% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_frost
3:23.280 breath R remorseless_winter Fluffy_Pillow 63.3/144: 44% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_frost
3:24.838 cooldowns h pillar_of_frost Fluffy_Pillow 41.3/144: 29% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_frost
3:24.838 breath V obliterate Fluffy_Pillow 41.3/144: 29% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_frost
3:26.183 breath S howling_blast Fluffy_Pillow 51.5/144: 36% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:27.528 breath U obliterate Fluffy_Pillow 45.4/144: 32% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:28.871 breath V obliterate Fluffy_Pillow 44.4/144: 31% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:30.216 breath V obliterate Fluffy_Pillow 53.2/144: 37% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:31.561 breath S howling_blast Fluffy_Pillow 62.0/144: 43% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:32.905 breath U obliterate Fluffy_Pillow 52.4/144: 36% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:34.248 breath S howling_blast Fluffy_Pillow 67.4/144: 47% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:35.592 Waiting     0.174 sec 61.3/144: 43% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:35.766 breath V obliterate Fluffy_Pillow 45.3/144: 31% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:37.112 breath S howling_blast Fluffy_Pillow 54.1/144: 38% runic_power
0.0/6: 0% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:38.456 breath a arcane_torrent Fluffy_Pillow 54.2/144: 38% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:39.799 breath U obliterate Fluffy_Pillow 47.0/144: 33% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:41.144 breath S howling_blast Fluffy_Pillow 55.8/144: 39% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:42.489 breath V obliterate Fluffy_Pillow 47.8/144: 33% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:43.834 breath R remorseless_winter Fluffy_Pillow 40.8/144: 28% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:45.177 breath U obliterate Fluffy_Pillow 34.8/144: 24% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:46.523 breath S howling_blast Fluffy_Pillow 38.8/144: 27% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:47.867 Waiting     0.962 sec 19.8/144: 14% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:48.829 single_target o obliterate Fluffy_Pillow 3.8/144: 3% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:50.174 single_target m howling_blast Fluffy_Pillow 23.8/144: 17% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:51.518 single_target o obliterate Fluffy_Pillow 33.7/144: 23% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:52.865 single_target r frost_strike Fluffy_Pillow 64.7/144: 45% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(8), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:54.209 single_target r frost_strike Fluffy_Pillow 39.7/144: 28% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(8), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:55.554 Waiting     3.565 sec 20.9/144: 15% runic_power
1.0/6: 17% rune
gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:59.119 single_target r frost_strike Fluffy_Pillow 25.9/144: 18% runic_power
1.0/6: 17% rune
icy_talons(3), killing_machine, unleashed_frenzy(3), elemental_chaos_frost
4:00.464 trinkets t use_item_dragon_games_equipment Fluffy_Pillow 0.9/144: 1% runic_power
4.0/6: 67% rune
icy_talons(3), killing_machine, unleashed_frenzy(3), elemental_chaos_fire
4:00.464 cooldowns f abomination_limb Fluffy_Pillow 0.9/144: 1% runic_power
4.0/6: 67% rune
icy_talons(3), killing_machine, unleashed_frenzy(3), dragon_games_equipment, elemental_chaos_fire
4:01.809 cooldowns j raise_dead Fluffy_Pillow 0.9/144: 1% runic_power
4.0/6: 67% rune
abomination_limb, icy_talons(3), killing_machine, rime, unleashed_frenzy(3), elemental_chaos_fire
4:01.809 single_target l obliterate Fluffy_Pillow 0.9/144: 1% runic_power
4.0/6: 67% rune
abomination_limb, icy_talons(3), killing_machine, rime, unleashed_frenzy(3), elemental_chaos_fire
4:03.154 single_target m howling_blast Fluffy_Pillow 20.9/144: 15% runic_power
3.0/6: 50% rune
abomination_limb, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:04.498 single_target k remorseless_winter Fluffy_Pillow 33.9/144: 24% runic_power
3.0/6: 50% rune
abomination_limb, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:05.843 single_target o obliterate Fluffy_Pillow 48.9/144: 34% runic_power
2.0/6: 33% rune
abomination_limb, icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:07.187 cooldowns i breath_of_sindragosa Fluffy_Pillow 68.9/144: 48% runic_power
0.0/6: 0% rune
abomination_limb, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:07.187 cooldowns d empower_rune_weapon Fluffy_Pillow 68.9/144: 48% runic_power
2.0/6: 33% rune
abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:07.187 cooldowns h pillar_of_frost Fluffy_Pillow 73.9/144: 51% runic_power
3.0/6: 50% rune
abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:07.187 breath S howling_blast Fluffy_Pillow 73.9/144: 51% runic_power
3.0/6: 50% rune
abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:08.359 breath V obliterate Fluffy_Pillow 65.9/144: 46% runic_power
5.0/6: 83% rune
abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_fire
4:09.528 breath S howling_blast Fluffy_Pillow 74.9/144: 52% runic_power
4.0/6: 67% rune
abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_fire
4:10.699 breath U obliterate Fluffy_Pillow 66.9/144: 46% runic_power
4.0/6: 67% rune
rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_fire
4:11.868 breath V obliterate Fluffy_Pillow 77.1/144: 54% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:13.039 breath S howling_blast Fluffy_Pillow 98.3/144: 68% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:14.208 breath U obliterate Fluffy_Pillow 76.2/144: 53% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:15.378 default G antimagic_shell PR_Death_Knight_Frost 85.0/144: 59% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:15.378 breath V obliterate Fluffy_Pillow 85.0/144: 59% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:16.549 breath S howling_blast Fluffy_Pillow 100.0/144: 69% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:17.720 breath V obliterate Fluffy_Pillow 100.2/144: 70% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:18.889 breath V obliterate Fluffy_Pillow 109.0/144: 76% runic_power
2.0/6: 33% rune
antimagic_shell, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(4), unleashed_frenzy(3), elemental_chaos_fire
4:20.059 breath S howling_blast Fluffy_Pillow 118.0/144: 82% runic_power
1.0/6: 17% rune
antimagic_shell, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
4:21.231 breath V obliterate Fluffy_Pillow 99.0/144: 69% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
4:22.403 trinkets s use_item_blazebinders_hoof Fluffy_Pillow 108.0/144: 75% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
4:22.403 breath T horn_of_winter Fluffy_Pillow 108.0/144: 75% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze, elemental_chaos_fire
4:23.576 Waiting     0.693 sec 123.2/144: 86% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
4:24.269 breath R remorseless_winter Fluffy_Pillow 107.2/144: 74% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
4:25.668 breath Y obliterate Fluffy_Pillow 109.8/144: 76% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
4:26.838 breath Y obliterate Fluffy_Pillow 118.6/144: 82% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
4:28.008 breath S howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
4:29.354 breath Y obliterate Fluffy_Pillow 112.1/144: 78% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
4:30.699 Waiting     0.488 sec 120.9/144: 84% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
4:31.187 breath Y obliterate Fluffy_Pillow 104.9/144: 73% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
4:32.531 breath S howling_blast Fluffy_Pillow 126.1/144: 88% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
4:33.876 Waiting     0.396 sec 120.0/144: 83% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
4:34.272 breath Y obliterate Fluffy_Pillow 104.0/144: 72% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
4:35.615 breath S howling_blast Fluffy_Pillow 112.8/144: 78% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_fire
4:36.958 breath U obliterate Fluffy_Pillow 104.8/144: 73% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_fire
4:38.301 breath S howling_blast Fluffy_Pillow 97.6/144: 68% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_fire
4:39.646 breath V obliterate Fluffy_Pillow 91.6/144: 64% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_fire
4:40.992 Waiting     1.022 sec 100.4/144: 70% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_fire
4:42.014 breath V obliterate Fluffy_Pillow 96.8/144: 67% runic_power
2.0/6: 33% rune
breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_fire
4:43.358 cooldowns h pillar_of_frost Fluffy_Pillow 89.6/144: 62% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:43.358 Waiting     0.917 sec 89.6/144: 62% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), pillar_of_frost, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
4:44.275 breath R remorseless_winter Fluffy_Pillow 84.8/144: 59% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), pillar_of_frost, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_fire
4:45.843 Waiting     1.489 sec 78.8/144: 55% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_fire
4:47.332 breath V obliterate Fluffy_Pillow 51.8/144: 36% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_fire
4:48.678 breath S howling_blast Fluffy_Pillow 55.8/144: 39% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_fire
4:50.023 Waiting     0.193 sec 47.8/144: 33% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_fire
4:50.216 breath V obliterate Fluffy_Pillow 31.8/144: 22% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_fire
4:51.559 breath Z howling_blast Fluffy_Pillow 35.8/144: 25% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_fire
4:52.903 Waiting     0.305 sec 32.8/144: 23% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, unleashed_frenzy(3), elemental_chaos_fire
4:53.208 breath W death_and_decay Fluffy_Pillow 16.8/144: 12% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, unleashed_frenzy(3), elemental_chaos_fire
4:54.554 single_target l obliterate Fluffy_Pillow 15.8/144: 11% runic_power
4.0/6: 67% rune
gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, unleashed_frenzy(3), elemental_chaos_fire
4:55.900 single_target m howling_blast Fluffy_Pillow 40.8/144: 28% runic_power
2.0/6: 33% rune
gathering_storm(9), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
4:57.245 single_target o obliterate Fluffy_Pillow 48.8/144: 34% runic_power
3.0/6: 50% rune
gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
4:58.591 single_target m howling_blast Fluffy_Pillow 73.8/144: 51% runic_power
1.0/6: 17% rune
icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
4:59.936 single_target o obliterate Fluffy_Pillow 81.8/144: 57% runic_power
2.0/6: 33% rune
icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5770 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3463 0 13076 12453 6915
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 261520 249060 0
Runic Power 144 144 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 24.64% 24.64% 2995
Haste 15.69% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 6058 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 8 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +687 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +89 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +386 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit&!variable.trinket_1_exclude)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit&!variable.trinket_2_exclude)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd.max*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd.max*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd.max)%((rune+3)*(runic_power+5))*100,value_else=3,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd.max)%((rune+1)*(runic_power+20))*100,value_else=3,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=rune<4&talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> is up, as well as <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> or on cooldown if <a href='https://www.wowhead.com/spell=51271/pillar-of-frost'>Pillar of Frost</a> and <a href='https://www.wowhead.com/spell=152279/breath-of-sindragosa'>Breath of Sindragosa</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=runic_power.deficit>40
actions+=/antimagic_zone,if=death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa)
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&!buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

actions.trinkets=use_item,name=algethar_puzzle_box,if=!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains<2&(!talent.breath_of_sindragosa|runic_power>60&(buff.breath_of_sindragosa.up|cooldown.breath_of_sindragosa.remains<2))
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,slot=trinket1,if=variable.trinket_1_buffs&!variable.trinket_1_manual&(!buff.pillar_of_frost.up&trinket.1.cast_time>0|!trinket.1.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=variable.trinket_2_buffs&!variable.trinket_2_manual&(!buff.pillar_of_frost.up&trinket.2.cast_time>0|!trinket.2.cast_time>0)&(buff.breath_of_sindragosa.up|buff.pillar_of_frost.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=!variable.trinket_1_buffs&!variable.trinket_1_manual&(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|(trinket.1.cast_time>0&!buff.pillar_of_frost.up|!trinket.1.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=!variable.trinket_2_buffs&!variable.trinket_2_manual&(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|(trinket.2.cast_time>0&!buff.pillar_of_frost.up|!trinket.2.cast_time>0)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=6915
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 46218 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
46217.8 46217.8 44.9 / 0.097% 7379.0 / 16.0% 2630.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.9 7.9 Runic Power 2.50% 54.2 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 46218
Apocalypse 211 0.5% 6.9 45.70sec 9110 7186 Direct 6.9 7829 15727 9110 16.2%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 0.00 1.2677 0.0000 63237.29 63237.29 0.00% 7186.06 7186.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.78% 5.82 1 8 7829.03 6259 10950 7823.65 6871 8763 45534 45534 0.00%
crit 16.22% 1.13 0 6 15727.26 12518 21234 10981.74 0 20164 17703 17703 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    garg_setup
    [T]:6.94
  • if_expr:buff.commander_of_the_dead_window.up|cooldown.dark_transformation.remains>20|!talent.commander_of_the_dead&debuff.festering_wound.stack>=4
auto_attack_mh 2787 6.1% 153.6 2.35sec 5440 2328 Direct 153.6 4674 9400 5440 16.2%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.62 153.62 0.00 0.00 0.00 2.3372 0.0000 835766.60 1193982.72 30.00% 2327.77 2327.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.79% 128.72 91 169 4674.17 3725 6659 4673.42 4439 4905 601651 859523 30.00%
crit 16.21% 24.91 8 48 9400.26 7451 13193 9397.95 8626 10597 234116 334459 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Dark Transformation 191 0.4% 7.0 45.84sec 8188 6459 Direct 7.0 7025 14098 8188 16.5%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 1.2678 0.0000 57160.02 57160.02 0.00% 6459.49 6459.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.55% 5.83 1 8 7024.85 5546 9796 7019.51 6088 8108 40970 40970 0.00%
crit 16.45% 1.15 0 6 14098.20 10984 19301 10017.73 0 19301 16190 16190 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [P]:4.74
  • if_expr:variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd*2|cooldown.apocalypse.remains>30|!talent.commander_of_the_dead)
    garg_setup
    [Y]:2.25
  • if_expr:talent.commander_of_the_dead&debuff.festering_wound.stack>=4|!talent.commander_of_the_dead
Death Coil 4620 (5983) 10.0% (13.0%) 99.3 2.99sec 18036 15603 Direct 99.3 (234.6) 11963 24064 13933 16.3% (16.3%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 99.34 99.30 0.00 0.00 0.00 1.1559 0.0000 1383543.08 1383543.08 0.00% 15602.86 15602.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.72% 83.13 57 109 11962.58 7432 20046 11971.45 11051 12852 994506 994506 0.00%
crit 16.28% 16.17 3 36 24064.38 15827 39539 24083.86 19975 29761 389037 389037 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    default
    [G]:4.80
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd*1.1&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
    garg_setup
    [a]:1.25
  • if_expr:rune<=1
    generic
    [c]:93.29
  • if_expr:!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10
    Coil of Devastation 1363 3.0% 0.0 0.00sec 0 0 Periodic 135.3 3018 0 3018 0.0% 90.2%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 135.25 135.25 84.58 0.0000 2.0000 408133.44 408133.44 0.00% 1508.81 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 135.25 100 171 3017.63 1115 13958 3023.56 2561 3757 408133 408133 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 1081 2.4% 8.3 29.13sec 39143 0 Direct 8.3 33622 67616 39171 16.3%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.29 8.28 0.00 0.00 0.00 0.0000 0.0000 324431.18 463484.93 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.68% 6.93 1 9 33622.29 33373 34365 33621.94 33373 34365 233029 332908 30.00%
crit 16.32% 1.35 0 7 67615.93 66746 68730 51693.62 0 68730 91402 130577 22.94%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1117 2.4% 26.2 11.08sec 12775 10602 Direct 26.2 10976 22082 12775 16.2%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.24 26.24 0.00 0.00 0.00 1.2050 0.0000 335235.89 478920.62 30.00% 10602.02 10602.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.80% 21.99 11 33 10975.81 8211 17610 10969.32 9991 11913 241366 344818 30.00%
crit 16.20% 4.25 0 13 22082.35 16421 35744 21815.29 0 32163 93870 134103 29.65%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [Z]:2.19
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack<4&talent.apocalypse|!variable.pop_wounds&debuff.festering_wound.stack<1&!talent.apocalypse
  • target_if_expr:debuff.festering_wound.stack
    generic
    [e]:24.05
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1796 3.9% 105.8 3.46sec 5092 0 Direct 105.8 4374 8784 5092 16.3%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 105.76 105.76 0.00 0.00 0.00 0.0000 0.0000 538479.60 538479.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.72% 88.54 57 118 4373.77 3080 7607 4374.30 4092 4704 387276 387276 0.00%
crit 16.28% 17.21 5 35 8784.20 6219 15161 8785.53 7490 10607 151203 151203 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 79 0.2% 11.6 27.04sec 2032 1730 Direct 11.6 1744 3494 2032 16.5%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.1748 0.0000 23622.93 23622.93 0.00% 1729.98 1729.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.54% 9.71 3 14 1744.26 1216 2937 1744.41 1470 2086 16936 16936 0.00%
crit 16.46% 1.91 0 8 3493.85 2431 5874 3045.60 0 5789 6687 6687 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    default
    [H]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
Scourge Strike 995 (2318) 2.2% (5.0%) 78.9 3.70sec 8807 7736 Direct 78.9 (157.9) 3247 6533 3780 16.2% (16.3%)

Stats Details: Scourge Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 78.95 78.95 0.00 0.00 0.00 1.1385 0.0000 298406.65 426306.09 30.00% 7735.55 7735.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.78% 66.14 43 92 3246.91 2381 5108 3246.37 3055 3453 214759 306807 30.00%
crit 16.22% 12.80 2 30 6533.05 4763 10215 6532.20 5565 7822 83647 119499 30.00%

Action Details: Scourge Strike

  • id:55090
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:
  • description:An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.

Action Priority List

    garg_setup
    [b]:1.42
  • if_expr:debuff.festering_wound.stack>4|debuff.festering_wound.stack>=1&!talent.apocalypse
  • target_if_expr:debuff.festering_wound.stack
    generic
    [d]:77.53
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    Scourge Strike (_shadow) 1324 2.9% 0.0 0.00sec 0 0 Direct 78.9 4317 8678 5027 16.3%

Stats Details: Scourge Strike Shadow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 78.95 0.00 0.00 0.00 0.0000 0.0000 396872.33 396872.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.71% 66.09 43 90 4316.55 2784 7191 4318.53 4027 4727 285262 285262 0.00%
crit 16.29% 12.86 1 28 8678.39 5515 14180 8684.34 6866 11435 111610 111610 0.00%

Action Details: Scourge Strike Shadow

  • id:70890
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:70890
  • name:Scourge Strike
  • school:shadow
  • tooltip:
  • description:{$@spelldesc55090=An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.}
Soul Reaper 483 (2802) 1.0% (6.1%) 15.5 6.92sec 53981 44234 Direct 15.5 (31.1) 8005 16078 9298 16.0% (16.2%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.54 15.54 0.00 0.00 0.00 1.2204 0.0000 144525.46 144525.46 0.00% 44234.43 44234.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.99% 13.06 6 19 8005.44 5001 12051 8017.70 7175 9020 104516 104516 0.00%
crit 16.01% 2.49 0 9 16078.37 10002 23846 15025.64 0 23168 40010 40010 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [S]:15.20
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
    garg_setup
    [V]:0.35
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
    Soul Reaper (_execute) 2319 5.0% 15.5 6.92sec 44709 0 Direct 15.5 38373 77157 44709 16.3%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.54 15.54 0.00 0.00 0.00 0.0000 0.0000 694557.53 694557.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.66% 13.00 6 19 38373.41 28271 55871 38415.02 34512 43859 498744 498744 0.00%
crit 16.34% 2.54 0 10 77157.37 59919 109819 71612.58 0 108651 195813 195813 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 197 0.4% 3.6 91.63sec 16179 14053 Direct 3.6 13917 27963 16179 16.1%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 0.00 1.1515 0.0000 58954.20 58954.20 0.00% 14053.45 14053.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.90% 3.06 0 4 13917.37 11318 16955 13892.06 0 16955 42546 42546 0.00%
crit 16.10% 0.59 0 4 27963.36 22636 33911 13146.12 0 33911 16408 16408 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [R]:3.64
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
Unholy Pact 1276 2.8% 122.8 2.65sec 3115 0 Direct 122.8 2676 5377 3115 16.3%

Stats Details: Unholy Pact

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.81 122.81 0.00 0.00 0.00 0.0000 0.0000 382610.91 382610.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.74% 102.84 68 133 2676.28 1819 4354 2676.65 2447 2885 275232 275232 0.00%
crit 16.26% 19.97 5 40 5377.20 3711 8662 5378.64 4733 6495 107379 107379 0.00%

Action Details: Unholy Pact

  • id:319236
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:319236
  • name:Unholy Pact
  • school:shadow
  • tooltip:Deals {$s1=0} Shadow damage.
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
Virulent Plague 842 1.8% 11.6 27.04sec 21732 0 Periodic 99.5 2179 4381 2539 16.3% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.49 99.49 10.60 0.0000 3.0000 252598.97 252598.97 0.00% 846.30 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.67% 83.24 57 112 2179.39 1535 3828 2179.53 2024 2295 181417 181417 0.00%
crit 16.33% 16.25 4 33 4380.53 3039 7629 4381.26 3761 5284 71182 71182 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 5782 / 5782
Claw 297 0.6% 37.8 7.86sec 2362 2352 Direct 37.8 2031 4058 2362 16.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.79 37.79 0.00 0.00 0.00 1.0045 0.0000 89259.55 127516.89 30.00% 2351.66 2351.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.68% 31.62 16 47 2031.40 1654 2924 2029.67 1860 2202 64229 91758 30.00%
crit 16.32% 6.17 0 16 4057.81 3308 5515 4047.96 0 5012 25031 35759 29.95%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:37.79
  • if_expr:energy>70
Gnaw 0 0.0% 0.3 90.12sec 80 79 Direct 0.3 69 138 80 15.9%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.29 0.29 0.00 0.00 0.00 1.0087 0.0000 23.47 33.52 30.00% 79.28 79.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.11% 0.25 0 3 68.98 58 85 12.31 0 83 17 24 5.37%
crit 15.89% 0.05 0 2 137.61 117 164 6.23 0 161 6 9 1.36%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:0.29
main_hand 4134 9.0% 193.2 1.54sec 6402 4155 Direct 193.2 5505 11012 6402 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.22 193.22 0.00 0.00 0.00 1.5407 0.0000 1237015.02 1767209.37 30.00% 4155.35 4155.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.72% 161.76 113 205 5505.39 1838 12800 5514.83 4897 6213 890552 1272249 30.00%
crit 16.28% 31.46 10 54 11012.26 3676 25601 11034.76 6955 15072 346463 494960 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Monstrous Blow 30 0.1% 3.4 91.18sec 2707 2695 Direct 3.4 2330 4653 2707 16.2%

Stats Details: Monstrous Blow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.38 3.38 0.00 0.00 0.00 1.0045 0.0000 9145.57 13065.43 30.00% 2695.42 2695.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.76% 2.83 0 4 2330.19 1842 3062 2317.38 0 2970 6593 9419 29.78%
crit 16.24% 0.55 0 4 4652.66 3685 5950 2056.62 0 5939 2552 3646 13.27%

Action Details: Monstrous Blow

  • id:91797
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91797
  • name:Monstrous Blow
  • school:physical
  • tooltip:Stunned.
  • description:Strike an enemy with a smashing attack, dealing {$s2=0} Physical damage and stunning for {$d=2 seconds}.

Action Priority List

    default
    [ ]:3.38
Sweeping Claws 1321 2.9% 69.0 4.24sec 5725 5700 Direct 69.0 4924 9841 5725 16.3%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.98 68.98 0.00 0.00 0.00 1.0045 0.0000 394948.01 394948.01 0.00% 5699.60 5699.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.70% 57.74 38 76 4923.61 3545 8229 4926.25 4570 5301 284284 284284 0.00%
crit 16.30% 11.24 2 23 9841.20 7090 16458 9852.36 8012 14386 110664 110664 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:68.98
pet - gargoyle 31435 / 5306
Gargoyle Strike 31435 11.4% 40.4 5.16sec 38896 36480 Direct 40.4 33468 66763 38896 16.3%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.41 40.41 0.00 0.00 0.00 1.0663 0.0000 1571725.14 1571725.14 0.00% 36479.64 36479.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.70% 33.82 23 41 33468.06 5674 76002 33460.90 27818 40215 1131910 1131910 0.00%
crit 16.30% 6.59 0 17 66763.23 12028 144528 66630.78 0 116425 439815 439815 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.

Action Priority List

    default
    [ ]:42.41
pet - risen_skulker 1133 / 1133
Skulker Shot 1133 2.5% 155.2 1.93sec 2188 1136 Direct 155.1 1884 3766 2189 16.2%

Stats Details: Skulker Shot

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.17 155.10 0.00 0.00 0.00 1.9269 0.0000 339567.83 485109.27 30.00% 1135.74 1135.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.77% 129.93 94 167 1883.88 1395 3238 1884.61 1783 2011 244768 349677 30.00%
crit 16.23% 25.17 8 46 3765.80 2789 6475 3768.61 3315 4483 94800 135432 30.00%

Action Details: Skulker Shot

  • id:212423
  • school:physical
  • range:35.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:212423
  • name:Skulker Shot
  • school:physical
  • tooltip:
  • description:A ranged shot that causes Physical damage.

Action Priority List

    default
    [ ]:156.17
pet - army_ghoul 24468 / 5412
Claw 3988 1.9% 215.3 1.00sec 1213 1213 Direct 215.3 1043 2085 1213 16.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 215.27 215.27 0.00 0.00 0.00 1.0000 0.0000 261204.66 373159.03 30.00% 1213.41 1213.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.66% 180.10 153 204 1043.28 482 1511 1043.06 877 1149 187889 268420 30.00%
crit 16.34% 35.17 12 60 2084.55 964 3023 2085.11 1562 2370 73315 104739 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:26.86
    default
    [ ]:26.86
    default
    [ ]:26.90
    default
    [ ]:26.92
    default
    [ ]:26.92
    default
    [ ]:26.94
    default
    [ ]:26.93
    default
    [ ]:26.94
main_hand 20480 9.7% 353.6 0.60sec 3794 3421 Direct 353.6 3264 6519 3794 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 353.55 353.55 0.00 0.00 0.00 1.1090 0.0000 1341422.04 1916366.06 30.00% 3421.28 3421.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.72% 296.00 239 334 3264.28 1443 4523 3263.95 2714 3543 966215 1380342 30.00%
crit 16.28% 57.55 33 90 6519.20 2886 9046 6521.99 4878 7338 375207 536024 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - magus_of_the_dead 7807 / 3989
Frostbolt 2274 2.5% 41.6 7.11sec 8336 5833 Direct 41.6 7179 14335 8339 16.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.65 41.63 0.00 0.00 0.00 1.4292 0.0000 347183.95 347183.95 0.00% 5833.06 5833.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.80% 34.89 22 47 7179.42 3694 11419 7182.07 6455 7998 250479 250479 0.00%
crit 16.20% 6.75 0 17 14334.76 7387 22839 14323.61 0 22137 96705 96705 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:23.29
    default
    [ ]:21.49
Shadow Bolt 5532 6.1% 99.5 2.92sec 8466 6610 Direct 99.5 7290 14555 8468 16.2%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 99.50 99.48 0.00 0.00 0.00 1.2809 0.0000 842392.22 842392.22 0.00% 6609.59 6609.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.79% 83.35 63 103 7290.26 3474 10886 7292.77 6647 7959 607619 607619 0.00%
crit 16.21% 16.13 2 34 14555.41 6947 21772 14562.44 9911 17311 234773 234773 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:54.39
    default
    [ ]:50.92
pet - apoc_ghoul 8720 / 3917
Claw 1629 1.6% 197.4 1.43sec 1110 1110 Direct 197.4 955 1908 1110 16.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 197.36 197.36 0.00 0.00 0.00 1.0000 0.0000 219149.25 313078.34 30.00% 1110.40 1110.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.72% 165.24 110 216 955.36 627 1511 956.28 857 1049 157860 225521 30.00%
crit 16.28% 32.12 9 58 1907.92 1216 3023 1910.22 1644 2192 61289 87558 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:49.34
    default
    [ ]:49.48
    default
    [ ]:49.40
    default
    [ ]:49.14
main_hand 7091 6.9% 279.4 1.00sec 3413 2474 Direct 279.4 2936 5867 3413 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 279.41 279.41 0.00 0.00 0.00 1.3797 0.0000 953721.34 1362493.80 30.00% 2474.02 2474.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.73% 233.94 169 303 2936.43 1876 4523 2940.04 2657 3194 686955 981389 30.00%
crit 16.27% 45.47 20 74 5867.07 3752 9014 5875.25 5058 7048 266766 381104 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Algeth'ar Puzzle (_box_channel) 2.0 183.77sec

Stats Details: Algethar Puzzle Box Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 2.00 0.00 0.00 1.1366 1.1366 0.00 0.00 0.00% 0.00 0.00

Action Details: Algethar Puzzle Box Channel

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
Anti-Magic Shell 7.0 45.11sec

Stats Details: Antimagic Shell

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 6.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Antimagic Shell

  • id:48707
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • school:shadow
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]

Action Priority List

    default
    [E]:6.98
  • if_expr:(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
Army of the Dead 2.0 0.00sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6576 0.4688 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    default
    [F]:1.00
  • if_expr:talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=34
    garg_setup
    [U]:0.00
  • if_expr:talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 183.84sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [f]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 167.88sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.41 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [Q]:2.41
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 306.92sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [O]:0.49
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
    garg_setup
    [X]:1.00
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Summon Gargoyle 2.0 183.52sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    garg_setup
    [W]:2.00
  • if_expr:buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>40
Unholy Strength 21.7 13.39sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 184.1sec 184.1sec 20.0sec 13.52% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3273.11
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3273.11

Trigger Details

  • interval_min/max:181.3s / 201.0s
  • trigger_min/max:181.3s / 201.0s
  • trigger_pct:100.00%
  • duration_min/max:20.0s / 20.0s

Stack Uptimes

  • algethar_puzzle_1:13.52%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Anti-Magic Shell 7.0 0.0 45.1sec 45.1sec 6.9sec 16.13% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_antimagic_shell
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:40.0s / 107.6s
  • trigger_min/max:40.0s / 107.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s

Stack Uptimes

  • antimagic_shell_1:16.13%

Spelldata

  • id:48707
  • name:Anti-Magic Shell
  • tooltip:Absorbing up to {$=}w1 magic damage. Immune to harmful magic effects.
  • description:Surrounds you in an Anti-Magic Shell for {$d=5 seconds}, absorbing up to {$=}<shield> magic damage and preventing application of harmful magical effects.{$?s207188=false}[][ Damage absorbed generates Runic Power.]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:101.00%
Berserking 2.0 0.0 183.8sec 183.8sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 196.4s
  • trigger_min/max:180.0s / 196.4s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dark Transformation 7.0 0.0 45.8sec 45.8sec 22.5sec 52.46% 59.23% 0.0 (0.0) 6.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 63.9s
  • trigger_min/max:45.0s / 63.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.0s

Stack Uptimes

  • dark_transformation_1:52.46%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.0sec 120.0sec 0.8sec 0.72% 0.00% 8.3 (8.3) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.79
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.0s
  • trigger_min/max:120.0s / 120.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s

Stack Uptimes

  • dragon_games_equipment_1:0.72%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 122.8sec 99.3sec 57.8sec 24.52% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 348.4s

Stack Uptimes

  • elemental_chaos_air_1:24.52%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.1sec 99.7sec 57.7sec 24.90% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 344.1s

Stack Uptimes

  • elemental_chaos_earth_1:24.90%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 125.7sec 99.2sec 58.3sec 25.33% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:25.33%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 122.3sec 98.2sec 58.1sec 25.25% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.25%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0sec 307.0sec 27.4sec 13.32% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 336.6s
  • trigger_min/max:300.0s / 336.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.32%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 167.9sec 167.9sec 19.3sec 15.43% 0.00% 7.0 (7.0) 2.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 200.6s
  • trigger_min/max:120.0s / 200.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.43%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Festermight 13.3 71.9 23.0sec 3.5sec 19.3sec 85.65% 0.00% 0.0 (0.0) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 45.6s
  • trigger_min/max:0.8s / 31.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:7.32%
  • festermight_2:7.64%
  • festermight_3:8.94%
  • festermight_4:14.96%
  • festermight_5:11.47%
  • festermight_6:9.06%
  • festermight_7:7.61%
  • festermight_8:6.33%
  • festermight_9:4.92%
  • festermight_10:3.39%
  • festermight_11:1.98%
  • festermight_12:1.03%
  • festermight_13:0.58%
  • festermight_14:0.33%
  • festermight_15:0.08%
  • festermight_16:0.01%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 99.3 139.5sec 3.0sec 288.8sec 99.97% 90.21% 97.2 (97.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:42.5s / 329.9s
  • trigger_min/max:0.8s / 17.8s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 360.0s

Stack Uptimes

  • icy_talons_1:1.35%
  • icy_talons_2:0.38%
  • icy_talons_3:98.24%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 12.0 8.1 24.8sec 14.5sec 10.6sec 42.55% 0.00% 8.1 (8.1) 11.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 171.4s
  • trigger_min/max:0.8s / 171.4s
  • trigger_pct:14.99%
  • duration_min/max:0.0s / 61.5s

Stack Uptimes

  • rune_mastery_1:42.55%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 41.7 6.0 7.1sec 6.2sec 2.6sec 36.21% 0.00% 6.0 (6.0) 41.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 85.3s
  • trigger_min/max:0.8s / 85.3s
  • trigger_pct:47.47%
  • duration_min/max:0.0s / 18.3s

Stack Uptimes

  • runic_corruption_1:36.21%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 20.9 0.2 14.0sec 13.8sec 1.0sec 6.98% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.3s / 57.6s
  • trigger_min/max:1.3s / 57.6s
  • trigger_pct:14.17%
  • duration_min/max:0.0s / 9.2s

Stack Uptimes

  • sudden_doom_1:6.98%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.6sec 91.6sec 19.6sec 23.80% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 109.4s
  • trigger_min/max:90.0s / 109.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • unholy_assault_1:23.80%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Pact 7.0 0.0 45.8sec 45.8sec 14.7sec 34.23% 36.79% 95.8 (95.8) 6.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_pact
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:45.0s / 63.9s
  • trigger_min/max:45.0s / 63.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • unholy_pact_1:34.23%

Spelldata

  • id:319233
  • name:Unholy Pact
  • tooltip:
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 13.3 36.1sec 13.5sec 24.7sec 69.37% 0.00% 13.3 (13.3) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 167.4s
  • trigger_min/max:0.0s / 56.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 152.6s

Stack Uptimes

  • unholy_strength_1:69.37%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.8 0.0 46.0sec 46.0sec 19.5sec 99.94% 99.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 139.8s
  • trigger_min/max:45.0s / 139.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.94%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 45.8sec 45.8sec 19.5sec 99.94% 99.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 135.3s
  • trigger_min/max:45.0s / 135.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.94%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 45.9sec 45.9sec 19.4sec 99.94% 99.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 136.1s
  • trigger_min/max:45.0s / 136.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.94%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 45.8sec 45.8sec 19.5sec 99.94% 99.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 135.4s
  • trigger_min/max:45.0s / 135.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.94%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 184.7sec 184.7sec 27.5sec 90.32% 96.18% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 232.9s
  • trigger_min/max:180.8s / 232.9s
  • trigger_pct:100.00%
  • duration_min/max:12.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.32%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 184.5sec 184.5sec 27.6sec 90.15% 96.78% 0.0 (0.0) 0.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 232.4s
  • trigger_min/max:180.8s / 232.4s
  • trigger_pct:100.00%
  • duration_min/max:13.1s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.15%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 184.3sec 184.3sec 27.7sec 89.91% 96.60% 0.0 (0.0) 0.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 231.9s
  • trigger_min/max:180.9s / 231.9s
  • trigger_pct:100.00%
  • duration_min/max:12.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:89.91%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.1sec 184.1sec 27.9sec 90.79% 97.56% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 231.7s
  • trigger_min/max:180.6s / 231.7s
  • trigger_pct:100.00%
  • duration_min/max:12.1s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.79%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.1sec 184.1sec 27.9sec 90.97% 97.40% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 231.7s
  • trigger_min/max:180.6s / 231.7s
  • trigger_pct:100.00%
  • duration_min/max:11.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.97%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 183.9sec 183.9sec 28.0sec 91.20% 97.47% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 231.7s
  • trigger_min/max:180.6s / 231.7s
  • trigger_pct:100.00%
  • duration_min/max:11.1s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.20%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 183.9sec 183.9sec 28.1sec 93.23% 98.99% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 231.7s
  • trigger_min/max:180.6s / 231.7s
  • trigger_pct:100.00%
  • duration_min/max:10.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:93.23%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 183.9sec 183.9sec 28.1sec 93.29% 98.84% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 231.7s
  • trigger_min/max:180.6s / 231.7s
  • trigger_pct:100.00%
  • duration_min/max:10.1s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:93.29%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Commander of the Dead 2.0 0.0 183.5sec 183.5sec 25.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.6s / 200.6s
  • trigger_min/max:180.6s / 200.6s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 183.9sec 183.9sec 23.8sec 95.14% 99.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 200.9s
  • trigger_min/max:180.8s / 200.9s
  • trigger_pct:100.00%
  • duration_min/max:16.8s / 24.0s

Stack Uptimes

  • dark_empowerment_1:95.14%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.6 0.0 63.6sec 63.6sec 20.9sec 97.55% 98.53% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:42.0s / 229.6s
  • trigger_min/max:42.0s / 229.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.55%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.3 0.0 68.5sec 68.5sec 20.8sec 97.91% 98.76% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:41.5s / 230.5s
  • trigger_min/max:41.5s / 230.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.91%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 25.6 10.0 47.0 11.4s 1.3s 140.6s
Rune ready 158.1 119.0 200.0 2.0s 0.0s 14.0s
Runic Corruption from Runic Power Spent 47.7 25.0 75.0 6.2s 0.8s 85.3s
Festering Wound from Festering Strike 65.6 42.0 91.0 11.1s 1.0s 69.5s
Festering Wound from Infected Claws 32.1 12.0 56.0 9.2s 1.0s 102.9s
Festering Wound from Unholy Assault 14.6 12.0 16.0 91.6s 90.0s 109.4s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 3.26% 0.00% 14.50% 2.0s 0.0s 18.0s
ghoul - Energy Cap 0.52% 0.18% 1.48% 0.2s 0.0s 1.0s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=310727)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0981.966 / 1.0877.28723.009
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
34.89957.63781.452 / 80.264109.106152.629

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Army of the Dead6.1860.00352.3706.0540.00052.370
Anti-Magic Shell6.6410.00167.59430.52118.273104.731
Unholy Assault1.6450.00119.4224.3000.75620.626
Summon Gargoyle3.5130.56220.6013.5130.56220.601
Dark Transformation0.9100.00118.8675.0191.03321.415
Apocalypse0.8630.00119.4234.1540.15921.104
Empower Rune Weapon49.3370.00280.62667.63660.52193.490
Soul Reaper1.0150.00113.39713.3644.62028.504

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
ApocalypseRune13.8813.688.66%0.990.201.43%
Empower Rune WeaponRunic Power11.5556.412.37%4.881.362.35%
Empower Rune WeaponRune11.5511.087.01%0.960.474.06%
Festering WoundRunic Power105.76309.1012.99%2.928.172.58%
Rune RegenerationRune133.31133.3184.33%1.000.000.00%
Runic AttenuationRunic Power74.84363.1315.27%4.8511.072.96%
Army of the DeadRunic Power2.0019.880.84%9.940.120.59%
Festering StrikeRunic Power26.24509.3621.41%19.4115.472.95%
OutbreakRunic Power11.62113.154.76%9.733.092.66%
Scourge StrikeRunic Power78.95775.0632.58%9.8214.401.82%
Soul ReaperRunic Power15.54147.086.18%9.468.365.38%
Summon GargoyleRunic Power2.0085.613.60%42.8014.3914.39%
pet - ghoul
Dark TransformationEnergy6.98364.748.68%52.25333.3147.75%
energy_regenEnergy1346.693839.3691.32%2.8557.471.47%
pet - army_ghoul
energy_regenEnergy902.297175.67100.00%7.95966.9311.87%
pet - apoc_ghoul
energy_regenEnergy708.595678.87100.00%8.011721.7823.27%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.001.000.00
Death CoilRunic Power 99.342354.5523.7023.70760.94
Festering StrikeRune 26.2452.482.002.006387.46
OutbreakRune 11.6211.621.001.002032.32
Scourge StrikeRune 78.9578.951.001.008807.03
Soul ReaperRune 15.5415.541.001.0053980.94
pet - ghoul
ClawEnergy 37.791511.4340.0040.0059.06
Sweeping ClawsEnergy 68.982759.3940.0040.00143.13
pet - army_ghoul
ClawEnergy 215.278610.6440.0040.0030.34
pet - apoc_ghoul
ClawEnergy 197.367894.5640.0040.0027.76
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 8.0 7.93 7.86 76.4 22.2 0.0 100.0
Rune 5.0 0.53 0.54 0.0 3.5 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 46217.85
Minimum 40786.25
Maximum 52775.36
Spread ( max - min ) 11989.12
Range [ ( max - min ) / 2 * 100% ] 12.97%
Standard Deviation 1985.7044
5th Percentile 43324.87
95th Percentile 49785.88
( 95th Percentile - 5th Percentile ) 6461.01
Mean Distribution
Standard Deviation 22.9305
95.00% Confidence Interval ( 46172.91 - 46262.79 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7091
0.1 Scale Factor Error with Delta=300 33660
0.05 Scale Factor Error with Delta=300 134640
0.01 Scale Factor Error with Delta=300 3365991
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 46217.85
Minimum 40786.25
Maximum 52775.36
Spread ( max - min ) 11989.12
Range [ ( max - min ) / 2 * 100% ] 12.97%
Standard Deviation 1985.7044
5th Percentile 43324.87
95th Percentile 49785.88
( 95th Percentile - 5th Percentile ) 6461.01
Mean Distribution
Standard Deviation 22.9305
95.00% Confidence Interval ( 46172.91 - 46262.79 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7091
0.1 Scale Factor Error with Delta=300 33660
0.05 Scale Factor Error with Delta=300 134640
0.01 Scale Factor Error with Delta=300 3365991
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 46217.85
Minimum 40786.25
Maximum 52775.36
Spread ( max - min ) 11989.12
Range [ ( max - min ) / 2 * 100% ] 12.97%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 6198136.07
Minimum 4776622.70
Maximum 7651345.90
Spread ( max - min ) 2874723.21
Range [ ( max - min ) / 2 * 100% ] 23.19%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2
6 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
7 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
A 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
B 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
C 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
D 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
E 6.98 antimagic_shell,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
0.00 antimagic_zone,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
0.00 variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle
Variables
0.00 variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd.max))>=1
0.00 variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4)|fight_remains<10
0.00 variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&cooldown.apocalypse.remains|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration)|fight_remains<=21
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
F 1.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=34
Prioritize Army, Outbreak and Maintaining Plaguebringer
0.00 wait_for_cooldown,name=apocalypse,if=cooldown.apocalypse.remains<gcd&buff.commander_of_the_dead_window.up
G 4.80 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd*1.1&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 unholy_blight,if=!buff.commander_of_the_dead_window.up&(variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21)
H 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
0.00 wound_spender,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
I 0.00 run_action_list,name=garg_setup,if=variable.garg_setup=0
Call Action Lists
J 0.00 call_action_list,name=cooldowns
K 0.00 call_action_list,name=trinkets
L 0.00 call_action_list,name=racials
M 0.00 run_action_list,name=aoe,if=active_enemies>=4
N 0.00 run_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
O 0.49 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Potion
0.00 vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
Cooldowns
0.00 summon_gargoyle,if=active_enemies>=3
0.00 abomination_limb,if=rune<2&variable.adds_remain
0.00 raise_dead,if=!pet.ghoul.active
P 4.74 dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd*2|cooldown.apocalypse.remains>30|!talent.commander_of_the_dead)
0.00 dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
0.00 apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&(buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead|cooldown.dark_transformation.remains>30)
0.00 apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
Q 2.41 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
0.00 abomination_limb,if=rune<3&variable.st_planning
R 3.64 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
S 15.20 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
0.00 sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd
actions.garg_setup
# count action,conditions
T 6.94 apocalypse,if=buff.commander_of_the_dead_window.up|cooldown.dark_transformation.remains>20|!talent.commander_of_the_dead&debuff.festering_wound.stack>=4
Garg Setup
U 0.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
V 0.35 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
W 2.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>40
X 1.00 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
Y 2.25 dark_transformation,if=talent.commander_of_the_dead&debuff.festering_wound.stack>=4|!talent.commander_of_the_dead
Z 2.19 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4&talent.apocalypse|!variable.pop_wounds&debuff.festering_wound.stack<1&!talent.apocalypse
a 1.25 death_coil,if=rune<=1
b 1.42 wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>4|debuff.festering_wound.stack>=1&!talent.apocalypse
actions.generic
# count action,conditions
c 93.29 death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10
Generic
0.00 any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground)&death_knight.fwounded_targets=active_enemies
d 77.53 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
e 24.05 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
f 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
g 2.00 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60)&(pet.apoc_ghoul.active|!talent.apocalypse&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60)&(pet.apoc_ghoul.active|!talent.apocalypse&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
h 2.77 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

Sample Sequence

012456789ABCDHXZZYWGGTQRgccEccdcccfdccddcdHcddcdecdcddhdeccddcecdcdceecHcPbTEdecdcdcdceccdcddHcecdcddceecdEPcTRdHcddccdddcdeccddcddecccHddceEcedcPbTcddehccdcHdcdcdecdcdcedcecdcecFHYWGTQRgSccEcdcSfdcddccSdccdccHSddccSddceScecdSPbTcHSddceSccEcdSddcdScdcHScdehcSccePeTRSGdcddScHcccEScccdc

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 5 army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 6 trinket_1_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat 7 trinket_2_exclude PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat 8 trinket_1_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat 9 trinket_2_buffs PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat A trinket_1_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat B trinket_2_sync PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat C trinket_priority PR_Death_Knight_Unholy 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
0:00.000 default D auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
0:00.000 default H outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, icy_talons, elemental_chaos_earth
0:01.022 garg_setup X potion Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, icy_talons, elemental_chaos_earth
0:01.022 garg_setup Z festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, icy_talons, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.044 garg_setup Z festering_strike Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
bloodlust, icy_talons, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.065 garg_setup Y dark_transformation Fluffy_Pillow 63.0/100: 63% runic_power
0.0/6: 0% rune
bloodlust, icy_talons, sudden_doom, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.065 garg_setup W summon_gargoyle Fluffy_Pillow 63.0/100: 63% runic_power
0.0/6: 0% rune
bloodlust, icy_talons, dark_transformation, sudden_doom, unholy_pact, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.086 default G death_coil Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune
bloodlust, icy_talons, dark_transformation, sudden_doom, unholy_pact, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.106 default G death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
bloodlust, icy_talons(2), dark_transformation, runic_corruption, sudden_doom, unholy_pact, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.126 garg_setup T apocalypse Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
bloodlust, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.145 cooldowns Q empower_rune_weapon Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
bloodlust, icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.145 cooldowns R unholy_assault Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune
bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.145 trinkets g use_item_algethar_puzzle_box Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune
bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.132 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune
bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.885 generic c death_coil Fluffy_Pillow 75.0/100: 75% runic_power
6.0/6: 100% rune
bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.638 default E antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
6.0/6: 100% rune
bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.638 generic c death_coil Fluffy_Pillow 45.0/100: 45% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.392 generic c death_coil Fluffy_Pillow 15.0/100: 15% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.146 generic d scourge_strike Fluffy_Pillow 15.0/100: 15% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.900 generic c death_coil Fluffy_Pillow 33.0/100: 33% runic_power
5.0/6: 83% rune
bloodlust, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.653 generic c death_coil Fluffy_Pillow 38.0/100: 38% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.407 generic c death_coil Fluffy_Pillow 13.0/100: 13% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.162 racials f berserking Fluffy_Pillow 13.0/100: 13% runic_power
6.0/6: 100% rune
bloodlust, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.162 generic d scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
6.0/6: 100% rune
bloodlust, berserking, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.916 generic c death_coil Fluffy_Pillow 31.0/100: 31% runic_power
5.0/6: 83% rune
bloodlust, berserking, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.671 generic c death_coil Fluffy_Pillow 31.0/100: 31% runic_power
5.0/6: 83% rune
bloodlust, berserking, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.425 generic d scourge_strike Fluffy_Pillow 1.0/100: 1% runic_power
5.0/6: 83% rune
bloodlust, berserking, antimagic_shell, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.180 generic d scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
5.0/6: 83% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.933 generic c death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.688 generic d scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
4.0/6: 67% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.442 default H outbreak Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.197 generic c death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.952 generic d scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power
3.0/6: 50% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.707 generic d scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.462 generic c death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.218 generic d scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.974 generic e festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.729 generic c death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.484 generic d scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.238 generic c death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.994 generic d scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.747 generic d scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.139 trinkets h use_item_dragon_games_equipment Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.769 generic d scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(2), dragon_games_equipment, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.788 generic e festering_strike Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.809 generic c death_coil Fluffy_Pillow 76.0/100: 76% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:31.828 generic c death_coil Fluffy_Pillow 46.0/100: 46% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(3), elemental_chaos_earth
0:32.849 generic d scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(3), elemental_chaos_earth
0:33.871 generic d scourge_strike Fluffy_Pillow 34.0/100: 34% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), elemental_chaos_earth
0:34.892 generic c death_coil Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(5), elemental_chaos_earth
0:35.914 generic e festering_strike Fluffy_Pillow 22.0/100: 22% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(5), elemental_chaos_earth
0:36.934 generic c death_coil Fluffy_Pillow 42.0/100: 42% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(5), elemental_chaos_earth
0:37.952 generic d scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(5), elemental_chaos_earth
0:38.972 generic c death_coil Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(6), elemental_chaos_earth
0:39.994 generic d scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
0:41.014 generic c death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(7), elemental_chaos_earth
0:42.339 generic e festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(7), elemental_chaos_earth
0:43.666 generic e festering_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(7), elemental_chaos_earth
0:44.991 generic c death_coil Fluffy_Pillow 53.0/100: 53% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(7), elemental_chaos_earth
0:46.316 default H outbreak Fluffy_Pillow 23.0/100: 23% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(7), elemental_chaos_earth
0:47.642 generic c death_coil Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune
icy_talons(3), elemental_chaos_earth
0:48.968 cooldowns P dark_transformation Fluffy_Pillow 3.0/100: 3% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, elemental_chaos_earth
0:50.295 garg_setup b scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_earth
0:51.621 garg_setup T apocalypse Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight, elemental_chaos_earth
0:52.946 default E antimagic_shell PR_Death_Knight_Unholy 38.0/100: 38% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight(5), elemental_chaos_earth
0:52.946 generic d scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight(5), elemental_chaos_earth
0:54.272 generic e festering_strike Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight(6), elemental_chaos_earth
0:55.596 generic c death_coil Fluffy_Pillow 71.0/100: 71% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight(6), elemental_chaos_earth
0:56.923 generic d scourge_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
antimagic_shell, rune_mastery, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(6), elemental_chaos_earth
0:58.248 generic c death_coil Fluffy_Pillow 54.0/100: 54% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_earth
0:59.573 generic d scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_earth
1:00.898 generic c death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_earth
1:02.224 generic d scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_earth
1:03.551 generic c death_coil Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(9), elemental_chaos_earth
1:04.877 generic e festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), elemental_chaos_earth
1:06.203 generic c death_coil Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(9), elemental_chaos_earth
1:07.528 generic c death_coil Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), elemental_chaos_earth
1:08.855 generic d scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), elemental_chaos_earth
1:10.180 generic c death_coil Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(10), elemental_chaos_earth
1:11.508 generic d scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_earth
1:12.834 generic d scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, elemental_chaos_earth
1:14.161 default H outbreak Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), elemental_chaos_earth
1:15.485 generic c death_coil Fluffy_Pillow 49.0/100: 49% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(2), elemental_chaos_earth
1:16.812 generic e festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight(2), elemental_chaos_earth
1:18.139 generic c death_coil Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(2), elemental_chaos_earth
1:19.463 generic d scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(2), elemental_chaos_earth
1:20.788 generic c death_coil Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(3), elemental_chaos_earth
1:22.114 generic d scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(3), elemental_chaos_earth
1:23.440 generic d scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(4), elemental_chaos_earth
1:24.766 generic c death_coil Fluffy_Pillow 33.0/100: 33% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(5), elemental_chaos_earth
1:26.092 generic e festering_strike Fluffy_Pillow 3.0/100: 3% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(5), elemental_chaos_earth
1:27.417 generic e festering_strike Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(5), elemental_chaos_earth
1:28.740 generic c death_coil Fluffy_Pillow 43.0/100: 43% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(5), elemental_chaos_earth
1:30.065 Waiting     2.595 sec 18.0/100: 18% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(5), elemental_chaos_earth
1:32.660 generic d scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
1.0/6: 17% rune
icy_talons(3), elemental_chaos_earth
1:33.986 default E antimagic_shell PR_Death_Knight_Unholy 36.0/100: 36% runic_power
0.0/6: 0% rune
icy_talons(3), festermight, elemental_chaos_earth
1:33.986 cooldowns P dark_transformation Fluffy_Pillow 36.0/100: 36% runic_power
0.0/6: 0% rune
antimagic_shell, icy_talons(3), festermight, elemental_chaos_earth
1:35.314 generic c death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune
antimagic_shell, icy_talons(3), dark_transformation, unholy_pact, festermight, elemental_chaos_earth
1:36.638 garg_setup T apocalypse Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight, elemental_chaos_earth
1:37.965 cooldowns R unholy_assault Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
antimagic_shell, icy_talons(3), dark_transformation, unholy_pact, festermight(5), elemental_chaos_earth
1:39.291 generic d scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
antimagic_shell, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), elemental_chaos_earth
1:40.396 default H outbreak Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune
antimagic_shell, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(6), elemental_chaos_earth
1:41.501 generic c death_coil Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(6), elemental_chaos_earth
1:42.606 generic d scourge_strike Fluffy_Pillow 51.0/100: 51% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_chaos_earth
1:43.711 generic d scourge_strike Fluffy_Pillow 64.0/100: 64% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), elemental_chaos_earth
1:44.819 generic c death_coil Fluffy_Pillow 77.0/100: 77% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), elemental_chaos_earth
1:45.925 generic c death_coil Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), elemental_chaos_earth
1:47.032 generic d scourge_strike Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(8), elemental_chaos_earth
1:48.137 generic d scourge_strike Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), elemental_chaos_earth
1:49.243 generic d scourge_strike Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(10), elemental_chaos_earth
1:50.351 generic c death_coil Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(11), elemental_chaos_earth
1:51.455 generic d scourge_strike Fluffy_Pillow 71.0/100: 71% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), elemental_chaos_earth
1:52.560 generic e festering_strike Fluffy_Pillow 84.0/100: 84% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(12), elemental_chaos_earth
1:53.665 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, elemental_chaos_earth
1:54.770 generic c death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, elemental_chaos_earth
1:55.875 generic d scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, elemental_chaos_earth
1:56.980 generic d scourge_strike Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight, elemental_chaos_earth
1:58.085 generic c death_coil Fluffy_Pillow 71.0/100: 71% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
1:59.411 generic d scourge_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), elemental_chaos_earth
2:00.736 generic d scourge_strike Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), elemental_chaos_earth
2:02.061 generic e festering_strike Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
2:03.388 generic c death_coil Fluffy_Pillow 92.0/100: 92% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
2:04.713 generic c death_coil Fluffy_Pillow 62.0/100: 62% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
2:06.040 generic c death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
2:07.365 default H outbreak Fluffy_Pillow 2.0/100: 2% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_earth
2:08.689 generic d scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
2:10.014 generic d scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), elemental_chaos_earth
2:11.338 generic c death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
2:12.663 generic e festering_strike Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(6), elemental_chaos_earth
2:13.990 default E antimagic_shell PR_Death_Knight_Unholy 33.0/100: 33% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
2:13.990 generic c death_coil Fluffy_Pillow 33.0/100: 33% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
2:15.314 generic e festering_strike Fluffy_Pillow 3.0/100: 3% runic_power
2.0/6: 33% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
2:16.639 Waiting     0.409 sec 28.0/100: 28% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_earth
2:17.048 generic d scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_earth
2:18.375 generic c death_coil Fluffy_Pillow 41.0/100: 41% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), festermight, elemental_chaos_earth
2:19.701 cooldowns P dark_transformation Fluffy_Pillow 16.0/100: 16% runic_power
0.0/6: 0% rune
antimagic_shell, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, elemental_chaos_earth
2:21.027 garg_setup b scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight, elemental_chaos_earth
2:22.353 garg_setup T apocalypse Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(2), elemental_chaos_earth
2:23.678 generic c death_coil Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(6), elemental_chaos_earth
2:25.004 generic d scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), elemental_chaos_earth
2:26.331 generic d scourge_strike Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_earth
2:27.656 generic e festering_strike Fluffy_Pillow 77.0/100: 77% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_earth
2:28.139 trinkets h use_item_dragon_games_equipment Fluffy_Pillow 97.0/100: 97% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_earth
2:28.983 generic c death_coil Fluffy_Pillow 97.0/100: 97% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_earth
2:30.309 generic c death_coil Fluffy_Pillow 72.0/100: 72% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(8), elemental_chaos_earth
2:31.633 generic d scourge_strike Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_earth
2:32.959 generic c death_coil Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(9), elemental_chaos_earth
2:34.284 default H outbreak Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(9), elemental_chaos_earth
2:35.611 generic d scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(9), elemental_chaos_earth
2:36.937 generic c death_coil Fluffy_Pillow 53.0/100: 53% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(10), elemental_chaos_earth
2:38.262 generic d scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, elemental_chaos_earth
2:39.587 generic c death_coil Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight, elemental_chaos_earth
2:40.913 generic d scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight, elemental_chaos_earth
2:42.239 generic e festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(2), elemental_chaos_earth
2:43.564 generic c death_coil Fluffy_Pillow 49.0/100: 49% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(2), elemental_chaos_earth
2:44.892 generic d scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(2), elemental_chaos_earth
2:46.218 generic c death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(3), elemental_chaos_earth
2:47.544 generic d scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight(3), elemental_chaos_earth
2:48.870 generic c death_coil Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
icy_talons(3), sudden_doom, festermight(4), elemental_chaos_earth
2:50.196 generic e festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight(4), elemental_chaos_earth
2:51.521 generic d scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(4), elemental_chaos_earth
2:52.846 generic c death_coil Fluffy_Pillow 53.0/100: 53% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(5), elemental_chaos_earth
2:54.172 generic e festering_strike Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(5), elemental_chaos_earth
2:55.499 generic c death_coil Fluffy_Pillow 43.0/100: 43% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(5), elemental_chaos_earth
2:56.824 generic d scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(5), elemental_chaos_earth
2:58.150 generic c death_coil Fluffy_Pillow 31.0/100: 31% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
2:59.476 generic e festering_strike Fluffy_Pillow 1.0/100: 1% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_earth
3:00.801 generic c death_coil Fluffy_Pillow 26.0/100: 26% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), sudden_doom, elemental_chaos_fire
3:02.127 default F army_of_the_dead Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_fire
3:03.454 default H outbreak Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), sudden_doom, elemental_chaos_fire
3:04.779 garg_setup Y dark_transformation Fluffy_Pillow 46.0/100: 46% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), sudden_doom, elemental_chaos_fire
3:04.779 garg_setup W summon_gargoyle Fluffy_Pillow 46.0/100: 46% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, elemental_chaos_fire
3:06.105 default G death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, elemental_chaos_fire
3:07.432 garg_setup T apocalypse Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, elemental_chaos_fire
3:08.758 cooldowns Q empower_rune_weapon Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_fire
3:08.758 cooldowns R unholy_assault Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_fire
3:08.758 trinkets g use_item_algethar_puzzle_box Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), elemental_chaos_fire
3:10.041 cooldowns S soul_reaper Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_fire
3:11.005 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_fire
3:11.967 generic c death_coil Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_fire
3:12.929 default E antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_fire
3:12.929 generic c death_coil Fluffy_Pillow 45.0/100: 45% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_fire
3:13.890 generic d scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_fire
3:14.850 generic c death_coil Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_fire
3:15.812 cooldowns S soul_reaper Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_fire
3:17.003 racials f berserking Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_fire
3:17.003 generic d scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
berserking, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_fire
3:17.878 generic c death_coil Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune
berserking, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, elemental_chaos_fire
3:18.752 generic d scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
berserking, antimagic_shell, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, elemental_chaos_fire
3:19.626 generic d scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune
berserking, antimagic_shell, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, elemental_chaos_fire
3:20.503 generic c death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), algethar_puzzle, elemental_chaos_fire
3:21.379 generic c death_coil Fluffy_Pillow 12.0/100: 12% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(8), algethar_puzzle, elemental_chaos_fire
3:22.252 cooldowns S soul_reaper Fluffy_Pillow 12.0/100: 12% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), algethar_puzzle, elemental_chaos_fire
3:23.126 generic d scourge_strike Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), algethar_puzzle, elemental_chaos_fire
3:24.000 generic c death_coil Fluffy_Pillow 40.0/100: 40% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), algethar_puzzle, elemental_chaos_fire
3:24.874 generic c death_coil Fluffy_Pillow 15.0/100: 15% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(9), algethar_puzzle, elemental_chaos_fire
3:25.750 generic d scourge_strike Fluffy_Pillow 15.0/100: 15% runic_power
5.0/6: 83% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(9), algethar_puzzle, elemental_chaos_fire
3:26.622 generic c death_coil Fluffy_Pillow 33.0/100: 33% runic_power
4.0/6: 67% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(10), algethar_puzzle, elemental_chaos_fire
3:27.497 generic c death_coil Fluffy_Pillow 33.0/100: 33% runic_power
5.0/6: 83% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, algethar_puzzle, elemental_chaos_fire
3:28.371 default H outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, algethar_puzzle, elemental_chaos_fire
3:29.246 cooldowns S soul_reaper Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune
rune_mastery, icy_talons(3), dark_transformation, algethar_puzzle, elemental_chaos_fire
3:30.573 generic d scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), dark_transformation, elemental_chaos_fire
3:31.899 generic d scourge_strike Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune
icy_talons(3), festermight, elemental_chaos_fire
3:33.224 generic c death_coil Fluffy_Pillow 64.0/100: 64% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), elemental_chaos_fire
3:34.548 generic c death_coil Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(2), elemental_chaos_fire
3:35.874 cooldowns S soul_reaper Fluffy_Pillow 4.0/100: 4% runic_power
4.0/6: 67% rune
icy_talons(3), runic_corruption, festermight(2), elemental_chaos_fire
3:37.201 generic d scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), elemental_chaos_fire
3:38.527 generic d scourge_strike Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
3:39.851 generic c death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
3:41.177 generic e festering_strike Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_fire
3:42.502 cooldowns S soul_reaper Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
3:43.829 generic c death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
3:45.154 generic e festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_fire
3:46.481 generic c death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
3:47.804 generic d scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_fire
3:49.129 cooldowns S soul_reaper Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), elemental_chaos_fire
3:50.455 cooldowns P dark_transformation Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), elemental_chaos_fire
3:51.780 garg_setup b scourge_strike Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_fire
3:53.105 garg_setup T apocalypse Fluffy_Pillow 51.0/100: 51% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight, elemental_chaos_fire
3:54.431 generic c death_coil Fluffy_Pillow 63.0/100: 63% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(5), elemental_chaos_fire
3:55.757 default H outbreak Fluffy_Pillow 63.0/100: 63% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(5), elemental_chaos_fire
3:57.082 cooldowns S soul_reaper Fluffy_Pillow 73.0/100: 73% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), elemental_chaos_fire
3:58.407 generic d scourge_strike Fluffy_Pillow 88.0/100: 88% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), elemental_chaos_fire
3:59.733 generic d scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), elemental_chaos_fire
4:01.060 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_fire
4:02.385 generic e festering_strike Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), elemental_chaos_fire
4:03.711 cooldowns S soul_reaper Fluffy_Pillow 95.0/100: 95% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_fire
4:05.037 generic c death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_fire
4:06.362 generic c death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, festermight(7), elemental_chaos_fire
4:07.687 default E antimagic_shell PR_Death_Knight_Unholy 45.0/100: 45% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, runic_corruption, festermight(7), elemental_chaos_fire
4:07.687 generic c death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, festermight(7), elemental_chaos_fire
4:09.013 generic d scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, festermight(7), elemental_chaos_fire
4:10.339 cooldowns S soul_reaper Fluffy_Pillow 33.0/100: 33% runic_power
4.0/6: 67% rune
antimagic_shell, icy_talons(3), dark_transformation, runic_corruption, festermight(8), elemental_chaos_fire
4:11.664 generic d scourge_strike Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), festermight(8), elemental_chaos_fire
4:12.989 generic d scourge_strike Fluffy_Pillow 61.0/100: 61% runic_power
3.0/6: 50% rune
antimagic_shell, icy_talons(3), elemental_chaos_fire
4:14.315 generic c death_coil Fluffy_Pillow 74.0/100: 74% runic_power
2.0/6: 33% rune
antimagic_shell, icy_talons(3), festermight, elemental_chaos_fire
4:15.640 generic d scourge_strike Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight, elemental_chaos_fire
4:16.966 cooldowns S soul_reaper Fluffy_Pillow 62.0/100: 62% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(2), elemental_chaos_fire
4:18.291 generic c death_coil Fluffy_Pillow 72.0/100: 72% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), elemental_chaos_fire
4:19.616 generic d scourge_strike Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_fire
4:20.941 generic c death_coil Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
4:22.267 default H outbreak Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_fire
4:23.592 cooldowns S soul_reaper Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
4:24.917 generic c death_coil Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
4:26.243 generic d scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_fire
4:27.568 generic e festering_strike Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
4:28.139 trinkets h use_item_dragon_games_equipment Fluffy_Pillow 58.0/100: 58% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
4:28.894 generic c death_coil Fluffy_Pillow 58.0/100: 58% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), dragon_games_equipment, elemental_chaos_fire
4:30.220 cooldowns S soul_reaper Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(4), elemental_chaos_fire
4:31.544 generic c death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4), elemental_chaos_fire
4:32.868 generic c death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_fire
4:34.193 generic e festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), elemental_chaos_fire
4:35.518 cooldowns P dark_transformation Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), elemental_chaos_fire
4:36.843 generic e festering_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_fire
4:38.168 garg_setup T apocalypse Fluffy_Pillow 53.0/100: 53% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_fire
4:39.493 cooldowns R unholy_assault Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_pact, festermight(4), elemental_chaos_fire
4:40.818 cooldowns S soul_reaper Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), elemental_chaos_fire
4:41.923 default G death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), elemental_chaos_fire
4:43.030 generic d scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), elemental_chaos_fire
4:44.134 generic c death_coil Fluffy_Pillow 63.0/100: 63% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), elemental_chaos_fire
4:45.240 generic d scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(5), elemental_chaos_fire
4:46.346 generic d scourge_strike Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_chaos_fire
4:47.451 cooldowns S soul_reaper Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(7), elemental_chaos_fire
4:48.558 generic c death_coil Fluffy_Pillow 79.0/100: 79% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(7), elemental_chaos_fire
4:49.664 default H outbreak Fluffy_Pillow 84.0/100: 84% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(7), elemental_chaos_fire
4:50.771 generic c death_coil Fluffy_Pillow 94.0/100: 94% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), elemental_chaos_fire
4:51.877 generic c death_coil Fluffy_Pillow 94.0/100: 94% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), elemental_chaos_fire
4:52.983 generic c death_coil Fluffy_Pillow 64.0/100: 64% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), elemental_chaos_fire
4:54.088 default E antimagic_shell PR_Death_Knight_Unholy 39.0/100: 39% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(7), elemental_chaos_fire
4:54.088 cooldowns S soul_reaper Fluffy_Pillow 39.0/100: 39% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(7), elemental_chaos_fire
4:55.192 generic c death_coil Fluffy_Pillow 49.0/100: 49% runic_power
4.0/6: 67% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), elemental_chaos_fire
4:56.298 generic c death_coil Fluffy_Pillow 54.0/100: 54% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(7), elemental_chaos_fire
4:57.405 generic c death_coil Fluffy_Pillow 54.0/100: 54% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(7), elemental_chaos_fire
4:58.511 generic d scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
6.0/6: 100% rune
antimagic_shell, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, elemental_chaos_fire
4:59.616 generic c death_coil Fluffy_Pillow 42.0/100: 42% runic_power
5.0/6: 83% rune
antimagic_shell, unholy_strength, icy_talons(3), festermight, elemental_chaos_fire

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6095 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3463 0 12965 12348 6827
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 259300 246960 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 15.36% 15.36% 1504
Haste 17.32% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6400 5922 0
Mastery 44.26% 44.26% 2986
Armor 5338 5338 5338
Run Speed 8 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +687 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +687 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)&!variable.trinket_1_exclude
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)&!variable.trinket_2_exclude
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
actions+=/antimagic_shell,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&runic_power.deficit>40&(pet.gargoyle.active|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>cooldown.antimagic_shell.duration)
actions+=/antimagic_zone,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&death_knight.amz_absorb_percent>0&runic_power.deficit>70&talent.assimilation&(pet.gargoyle.active|!talent.summon_gargoyle)
# Variables
actions+=/variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle
actions+=/variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd.max))>=1
actions+=/variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4)|fight_remains<10
actions+=/variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> is up, as well as <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or with <a href='https://www.wowhead.com/spell=63560/dark-transformation'>Dark Transformation</a> if <a href='https://www.wowhead.com/spell=275699/apocalypse'>Apocalypse</a> or <a href='https://www.wowhead.com/spell=49206/summon-gargoyle'>Gargoyle</a> are not talented
actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&cooldown.apocalypse.remains|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration)|fight_remains<=21
# Prioritize Army, Outbreak and Maintaining Plaguebringer
actions+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=34
actions+=/wait_for_cooldown,name=apocalypse,if=cooldown.apocalypse.remains<gcd&buff.commander_of_the_dead_window.up
actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd*1.1&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions+=/epidemic,if=active_enemies>=4&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions+=/unholy_blight,if=!buff.commander_of_the_dead_window.up&(variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)|variable.adds_remain|fight_remains<21)
actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)+(talent.ebon_fever*2)))
actions+=/wound_spender,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
# Call Action Lists
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup=0
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=aoe,if=active_enemies>=4
actions+=/run_action_list,name=generic,if=active_enemies<=3

# AoE Action List
actions.aoe=any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(talent.festermight&buff.festermight.remains<3|!talent.festermight)&(death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets=8|!talent.bursting_sores&!talent.vile_contagion|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5|(cooldown.vile_contagion.remains|!talent.vile_contagion)&buff.dark_transformation.up&talent.infected_claws&(buff.empower_rune_weapon.up|buff.unholy_assault.up))|fight_remains<10
actions.aoe+=/scourge_strike,if=talent.superstrain&talent.ebon_fever&talent.plaguebringer&buff.plaguebringer.remains<gcd
actions.aoe+=/epidemic,if=(!talent.bursting_sores|rune<1|talent.bursting_sores&debuff.festering_wound.stack=0)&!variable.pooling_runic_power&(active_enemies>=6|runic_power.deficit<30)
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!death_and_decay.ticking&(debuff.festering_wound.stack<4&cooldown.apocalypse.ready&cooldown.any_dnd.remains|debuff.festering_wound.stack<2&talent.bursting_sores)
actions.aoe+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!death_and_decay.ticking&(cooldown.vile_contagion.remains>5|!talent.vile_contagion)
actions.aoe+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.adds_remain&debuff.festering_wound.stack<=2
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=death_and_decay.ticking
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe+=/epidemic,if=!variable.pooling_runic_power
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=cooldown.death_and_decay.remains>10|cooldown.death_and_decay.remains>5&death_knight.fwounded_targets=active_enemies

# Potion
actions.cooldowns=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
# Cooldowns
actions.cooldowns+=/vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.cooldowns+=/summon_gargoyle,if=active_enemies>=3
actions.cooldowns+=/abomination_limb,if=rune<2&variable.adds_remain
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd*2|cooldown.apocalypse.remains>30|!talent.commander_of_the_dead)
actions.cooldowns+=/dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&(buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead|cooldown.dark_transformation.remains>30)
actions.cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.cooldowns+=/sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# Garg Setup
actions.garg_setup=apocalypse,if=buff.commander_of_the_dead_window.up|cooldown.dark_transformation.remains>20|!talent.commander_of_the_dead&debuff.festering_wound.stack>=4
actions.garg_setup+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>40
actions.garg_setup+=/potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&debuff.festering_wound.stack>=4|!talent.commander_of_the_dead
actions.garg_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4&talent.apocalypse|!variable.pop_wounds&debuff.festering_wound.stack<1&!talent.apocalypse
actions.garg_setup+=/death_coil,if=rune<=1
actions.garg_setup+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>4|debuff.festering_wound.stack>=1&!talent.apocalypse

# Generic
actions.generic=death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10
actions.generic+=/any_dnd,if=!death_and_decay.ticking&(active_enemies>=2|talent.unholy_ground)&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60)&(pet.apoc_ghoul.active|!talent.apocalypse&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&((!talent.summon_gargoyle&((!talent.army_of_the_dead|cooldown.army_of_the_dead.remains_expected>60)&(pet.apoc_ghoul.active|!talent.apocalypse&buff.dark_transformation.up)|pet.army_ghoul.active)|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle&!talent.army_of_the_dead|!talent.summon_gargoyle&talent.army_of_the_dead&cooldown.army_of_the_dead.remains_expected>20|!talent.summon_gargoyle&!talent.army_of_the_dead&cooldown.dark_transformation.remains>20|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=6827
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 50319 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
50318.9 50318.9 33.5 / 0.067% 5844.9 / 11.6% 239.1
APS APS Error APS Range APR
476.1 1.9 / 0.406% 239.2 / 50.3% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
176.9 175.8 Mana 0.00% 45.4 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIk0CBAAAAAAAAAAAAQikkSkmU0iEJlESEkGJJJShgEESTahkAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 50319
Devouring Plague 11607 23.1% 50.3 5.96sec 69207 62588 Direct 50.3 24311 52037 29627 19.2%
Periodic 128.6 13047 26841 15482 17.6% 85.9%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.30 50.30 128.59 128.59 29.66 1.1058 2.0035 3480850.29 3480850.29 0.00% 11112.44 62588.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 40.65 23 56 24311.30 16755 38247 24298.29 22401 26867 988336 988336 0.00%
crit 19.17% 9.64 1 27 52036.89 33509 76493 52075.17 41189 69751 501788 501788 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.35% 105.89 72 141 13047.04 91 32848 13048.18 11649 14522 1381555 1381555 0.00%
crit 17.65% 22.70 7 42 26841.15 210 62509 26858.67 19944 34794 609172 609172 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.887036
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.75

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.737256
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 88.7%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [W]:50.30
  • if_expr:(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
Halo 0 (255) 0.0% (0.5%) 3.5 77.44sec 21780 18811

Stats Details: Halo

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.52 0.00 0.00 0.00 0.00 1.1579 0.0000 0.00 0.00 0.00% 18811.02 18811.02

Action Details: Halo

  • id:120644
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:10.0

Spelldata

  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$=}<shadowhalodamage> Shadow damage to enemies. Healing reduced beyond {$s1=6} targets.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m2=1000}/100} Insanity.|r][]

Action Priority List

    filler
    [P]:3.53
  • if_expr:raid_event.adds.in>20
    Halo (_damage) 255 0.5% 3.5 77.44sec 21780 0 Direct 3.5 19150 39585 21966 13.8%

Stats Details: Halo Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.52 3.49 0.00 0.00 0.00 0.0000 0.0000 76598.49 76598.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.21% 3.01 0 6 19149.88 15741 33829 19003.88 0 29684 57569 57569 0.00%
crit 13.79% 0.48 0 4 39585.00 31482 67657 15715.23 0 67657 19030 19030 0.00%

Action Details: Halo Damage

  • id:390964
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.442000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390964
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$=}<holyhalodamage> Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Idol of C'Thun 0 (2763) 0.0% (5.5%) 0.0 0.00sec 0 0

Stats Details: Idol Of Cthun

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Idol Of Cthun

  • id:377349
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377349
  • name:Idol of C'Thun
  • school:physical
  • tooltip:
  • description:Mind Flay and Mind Sear have a chance to spawn a Void Tendril or Void Lasher that channels at your target for {$377355d=15 seconds}, generating {$s1=3} insanity every {$193473t1=1} sec.
    Mind Flay (void_tendril) 7088  / 2763 5.5% 19.0 14.41sec 43570 5820 Periodic 142.5 4994 10118 5820 16.1% 47.5%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.04 0.00 142.52 142.52 0.00 7.4866 1.0000 829424.12 829424.12 0.00% 5819.78 5819.78
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.89% 119.55 26 285 4994.10 3703 6701 4992.12 4655 5552 597058 597058 0.00%
crit 16.11% 22.97 2 62 10117.87 7407 13402 10104.12 8921 11336 232366 232366 0.00%

Action Details: Mind Flay

  • id:193473
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:1667.76
  • base_td_mult:1.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:{$?=}{$=}w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=30}%.

Action Priority List

    default
    [ ]:3.26
Mind Blast 5671 11.3% 62.1 4.81sec 27386 24855 Direct 62.1 21978 46564 27385 22.0%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.06 62.06 0.00 0.00 0.00 1.1018 0.0000 1699629.87 1699629.87 0.00% 24854.57 24854.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.01% 48.41 29 70 21978.00 11787 38043 21976.22 19226 24696 1064005 1064005 0.00%
crit 21.99% 13.65 3 27 46563.56 23573 76086 46596.03 34780 61014 635625 635625 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.52

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage{$?s137033=true}[ |cFFFFFFFFGenerates {$/100;s2=0} Insanity|r][]{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [V]:7.37
  • if_expr:(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
    main
    [a]:54.85
  • if_expr:variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
Mind Flay 356 0.7% 3.1 61.12sec 34030 9551 Periodic 18.7 4983 10108 5707 14.1% 3.6%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.14 0.00 18.75 18.75 0.00 3.5631 0.5836 106998.52 106998.52 0.00% 9550.88 9550.88
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 85.88% 16.10 0 51 4983.32 3901 7377 4833.13 0 7127 80242 80242 0.00%
crit 14.12% 2.65 0 13 10107.95 7801 14754 8595.49 0 14754 26756 26756 0.00%

Action Details: Mind Flay

  • id:15407
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:2.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.324852
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.50
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=4.500 seconds} and slowing their movement speed by {$s2=50}%. |cFFFFFFFFGenerates {$=}{{$s4=6}*{$s3=200}/100} Insanity over the duration.|r

Action Priority List

    filler
    [N]:14.41
  • if_expr:buff.mind_flay_insanity.up&dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
    filler
    [R]:3.17
  • interrupt_if_expr:ticks>=2
    main
    [Y]:22.84
  • if_expr:buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
Mind Flay: Insanity 6953 13.8% 37.3 7.93sec 55947 25331 Periodic 148.4 11971 24446 14047 16.6% 27.4%

Stats Details: Mind Flay Insanity

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.27 0.00 148.45 148.45 0.00 2.2086 0.5545 2085187.48 2085187.48 0.00% 25331.19 25331.19
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.36% 123.75 78 175 11971.20 8485 17045 11967.50 11428 12644 1481394 1481394 0.00%
crit 16.64% 24.70 7 47 24445.89 16970 34090 24443.50 22449 27065 603793 603793 0.00%

Action Details: Mind Flay Insanity

  • id:391403
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.714674
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:391403
  • name:Mind Flay: Insanity
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=70}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r
Mind Spike 875 1.7% 8.5 28.51sec 30828 27076 Direct 8.5 26514 56199 30827 14.5%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.51 8.51 0.00 0.00 0.00 1.1387 0.0000 262366.20 262366.20 0.00% 27075.98 27075.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.47% 7.27 0 20 26513.95 18077 55554 26554.50 0 50172 192866 192866 0.00%
crit 14.53% 1.24 0 7 56198.93 39322 111108 39608.26 0 111108 69500 69500 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.607200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage.{$?s391090=true}[ Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times.][] |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity|r{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    filler
    [O]:8.51
  • if_expr:buff.surge_of_darkness.up
Mindgames 1367 2.7% 7.7 40.64sec 53546 48909 Direct 7.7 (7.7) 43330 94431 53547 20.0% (20.0%)

Stats Details: Mindgames

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.65 7.65 0.00 0.00 0.00 1.0949 0.0000 409664.55 409664.55 0.00% 48909.33 48909.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.01% 6.12 1 10 43330.01 27910 69296 43268.83 32802 60880 265231 265231 0.00%
crit 19.99% 1.53 0 7 94430.63 55821 138592 77861.80 0 138592 144433 144433 0.00%

Action Details: Mindgames

  • id:375901
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:375901
  • name:Mindgames
  • school:shadow
  • tooltip:The next {$=}w2 damage and {$=}w5 healing dealt will be reversed.
  • description:Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m8=1000}/100} Insanity.|r][]

Action Priority List

    main
    [b]:7.68
  • if_expr:spell_targets.mind_sear<5&variable.all_dots_up
Shadow Crash 0 (1071) 0.0% (2.1%) 8.0 35.59sec 40249 35222

Stats Details: Shadow Crash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.98 0.00 0.00 0.00 0.00 1.1428 0.0000 0.00 0.00 0.00% 35221.63 35221.63

Action Details: Shadow Crash

  • id:205385
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:15.0

Spelldata

  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r

Action Priority List

    main
    [c]:7.98
  • if_expr:!variable.holding_crash
    Shadow Crash (_damage) 1071 2.1% 8.9 35.51sec 35993 0 Direct 8.9 30116 64372 35994 17.2%

Stats Details: Shadow Crash Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.92 8.92 0.00 0.00 0.00 0.0000 0.0000 321221.29 321221.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.84% 7.39 2 12 30115.52 20814 49353 30042.46 23590 37971 222661 222661 0.00%
crit 17.16% 1.53 0 7 64372.32 41627 98706 52252.38 0 98706 98560 98560 0.00%

Action Details: Shadow Crash Damage

  • id:205386
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.103750
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadow Weaving 659 1.3% 130.6 2.23sec 1509 0 Direct 129.5 1522 0 1522 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 130.65 129.55 0.00 0.00 0.00 0.0000 0.0000 197149.31 197149.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 129.55 91 161 1521.80 353 4883 1522.71 1249 2096 197149 197149 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2363.11
  • base_dd_max:2363.11
  • base_dd_mult:1.00

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}
Shadow Word: Death 1176 2.3% 11.8 26.36sec 29781 26524 Direct 11.8 24577 50574 29781 20.0%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.85 11.85 0.00 0.00 0.00 1.1228 0.0000 352854.07 352854.07 0.00% 26524.40 26524.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.98% 9.48 3 15 24577.10 10916 54892 24541.59 14000 35835 232914 232914 0.00%
crit 20.02% 2.37 0 8 50574.23 21832 109783 46867.11 0 109783 119941 119941 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target. {$?=}A364675[Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]

Action Priority List

    filler
    [Q]:0.08
  • if_expr:target.health.pct<20&(spell_targets.mind_sear<4|talent.inescapable_torment.rank=2&pet.fiend.active)
  • target_if_expr:target.time_to_die
    main
    [Z]:11.77
  • target_if_expr:(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
Shadow Word: Pain 3040 6.0% 17.2 17.54sec 53083 0 Periodic 251.8 3057 6253 3621 17.6% 98.8%

Stats Details: Shadow Word Pain

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.17 0.00 251.77 251.77 15.59 0.0000 1.1771 911590.99 911590.99 0.00% 3075.85 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.36% 207.36 150 267 3057.03 2 4358 3056.16 2927 3213 633905 633905 0.00%
crit 17.64% 44.41 17 75 6252.69 4 8716 6252.80 5762 6859 277686 277686 0.00%

Action Details: Shadow Word Pain

  • id:589
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:3.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.095880
  • base_td:0.00
  • base_td_mult:1.91
  • dot_duration:21.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=2} sec.
  • description:A word of darkness that causes {$?a390707=false}[{$=}{{$s1=0}*(1+{$390707s1=15}/100)}][{$s1=0}] Shadow damage instantly, and an additional {$?a390707=false}[{$=}{{$=}o2*(1+{$390707s1=15}/100)}][{$=}o2] Shadow damage over {$d=16 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m3=300}/100} Insanity.|r][]
Shadowy Apparitions 0 (1320) 0.0% (2.6%) 112.0 2.66sec 3538 0

Stats Details: Shadowy Apparitions

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 111.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowy Apparitions

  • id:341491
  • school:physical
  • range:0.0
  • travel_speed:6.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:341491
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:Mind Blast, Devouring Plague, and Void Bolt have a {$s4=100}% chance to conjure Shadowy Apparitions and Mind Sear has a {$s3=50}% chance to conjure Shadowy Apparitions. Shadowy Apparitions float towards all targets afflicted by your Vampiric Touch for {$148859s1=0} Shadow damage. Critical strikes with Mind Blast, Devouring Plague, and Void Bolt increase the damage of the Shadowy Apparitions they conjure by {$s2=100}%.
    Shadowy Apparition 1320 2.6% 110.4 2.66sec 3588 0 Direct 108.6 3647 0 3647 0.0%

Stats Details: Shadowy Apparition

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 110.37 108.61 0.00 0.00 0.00 0.0000 0.0000 396052.00 396052.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 108.61 79 141 3646.51 2347 5828 3644.72 3429 3873 396052 396052 0.00%

Action Details: Shadowy Apparition

  • id:148859
  • school:shadow
  • range:100.0
  • travel_speed:6.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205700
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Spelldata

  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals $148859sw1 Shadow damage.}
Soulseeker Arrow 1260 2.5% 7.3 37.19sec 51944 0 Periodic 86.8 4352 0 4352 0.0% 39.1%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.27 0.00 86.83 86.83 2.45 0.0000 1.3500 377851.50 377851.50 0.00% 3223.38 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 86.83 17 171 4351.62 30 4896 4349.15 4212 4700 377851 377851 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:4032.41
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1922}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 3632 7.2% 17.2 17.54sec 63426 117829 Periodic 165.2 5568 11385 6592 17.6% 98.7%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.17 0.00 165.24 165.24 15.59 0.5383 1.7917 1089212.58 1089212.58 0.00% 3567.67 117829.14
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.40% 136.15 94 177 5567.98 2 7948 5566.32 5317 5891 758107 758107 0.00%
crit 17.60% 29.08 11 49 11384.96 9 15895 11385.71 10191 12926 331105 331105 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [X]:8.25
  • if_expr:refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
  • target_if_expr:remains
Void Torrent 3072 6.1% 4.9 65.77sec 188369 58235 Periodic 28.7 26335 53731 32069 20.9% 4.9%

Stats Details: Void Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.88 0.00 28.68 28.68 0.00 3.2348 0.5079 919814.58 919814.58 0.00% 58234.54 58234.54
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.07% 22.68 8 34 26335.00 693 38467 26319.29 21477 31047 597234 597234 0.00%
crit 20.93% 6.00 0 17 53730.64 1386 76934 53649.42 0 76934 322581 322581 0.00%

Action Details: Void Torrent

  • id:263165
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:15.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.612870
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:263165
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=0} Shadow damage to the target every {$t1=1} sec.
  • description:Channel a torrent of void energy into the target, dealing {$=}o Shadow damage over {$d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$289577s1=1500}*{$289577s2=4}/100} Insanity over the duration.|r

Action Priority List

    main
    [d]:4.88
  • if_expr:insanity<=35&!variable.holding_crash
  • target_if_expr:variable.all_dots_up
pet - mindbender 11387 / 5241
Inescapable Torment 0 (2833) 0.0% (5.6%) 41.1 7.12sec 20648 0

Stats Details: Inescapable Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.09 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Inescapable Torment

  • id:373427
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:373427
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.
    Inescapable Torment (_damage) 6151 5.6% 41.1 7.12sec 20648 0 Direct 41.1 16408 34219 20648 23.8%

Stats Details: Inescapable Torment Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.09 41.09 0.00 0.00 0.00 0.0000 0.0000 848359.56 848359.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.20% 31.31 12 52 16407.70 9259 24138 16402.82 14454 18867 513681 513681 0.00%
crit 23.80% 9.78 1 22 34218.78 18518 48275 34237.23 26104 43836 334679 334679 0.00%

Action Details: Inescapable Torment Damage

  • id:373442
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.923780
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:373442
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:{$@spelldesc373427=Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.}
melee 5236 4.8% 130.6 2.23sec 5517 5341 Direct 130.6 4483 9100 5517 22.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 130.65 130.65 0.00 0.00 0.00 1.0331 0.0000 720790.60 720790.60 0.00% 5340.65 5340.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.60% 101.38 64 133 4483.01 3944 6103 4481.39 4240 4907 454506 454506 0.00%
crit 22.40% 29.26 10 53 9100.16 7887 12205 9101.36 8333 10338 266284 266284 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 0
Mental Fortitude 477 100.1% 330.0 0.90sec 433 0 Direct 340.9 419 0 419 0.0%

Stats Details: Mental Fortitude

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 329.98 340.88 0.00 0.00 0.00 0.0000 0.0000 142811.21 6875139.99 97.92% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 340.88 253 427 418.95 0 27823 419.36 242 657 142811 6875140 97.92%

Action Details: Mental Fortitude

  • id:377065
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9555.00
  • base_dd_max:9555.00
  • base_dd_mult:1.00

Spelldata

  • id:377065
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 2.9 123.43sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    cds
    [I]:2.95
  • if_expr:buff.power_infusion.up|fight_remains<=15
Dark Ascension 5.3 61.81sec

Stats Details: Dark Ascension

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 103.17 0.00 0.00 1.1671 1.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Dark Ascension

  • id:391109
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:30.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:391109
  • name:Dark Ascension
  • school:shadow
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r

Action Priority List

    cds
    [K]:5.35
  • if_expr:pet.fiend.active|!talent.mindbender&!cooldown.fiend.up|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2
Desperate Prayer 0.3 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.30 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [M]:0.30
  • if_expr:health.pct<=75
Devouring Plague (_heal) 178.9 1.67sec

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 178.88 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 88.7%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Halo (_heal) 3.5 77.44sec

Stats Details: Halo Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.52 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Halo Heal

  • id:390971
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.610000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390971
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$=}<holyhalodamage> Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Mindbender 5.4 60.83sec

Stats Details: Mindbender

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.44 0.00 0.00 0.00 0.00 1.1688 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindbender

  • id:200174
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$=}{{$200010s1=300}/100} Insanity each time the Mindbender attacks.|r

Action Priority List

    main
    [U]:5.44
  • if_expr:(variable.dots_up|action.shadow_crash.in_flight)&(fight_remains<30|time_to_die>15)
Mindgames (_damage_reversal) 7.7 40.64sec

Stats Details: Mindgames Damage Reversal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 7.65 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindgames Damage Reversal

  • id:323706
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:323706
  • name:Mindgames
  • school:shadow
  • tooltip:
  • description:{$@spelldesc323673=Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. {$?=}c3[For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing generate up to {$=}{{$323706s2=10}*2} Insanity.|r] ][For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing restore up to {$=}{{$323706s3=2}*2}% mana.|r]}
Elemental Potion of Ultimate Power 1.5 304.10sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [H]:1.48
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Power Infusion 2.9 123.64sec

Stats Details: Power Infusion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Power Infusion

  • id:10060
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%. Can only be cast on players.

Action Priority List

    cds
    [J]:2.92
  • if_expr:(buff.voidform.up|buff.dark_ascension.up)
Shadow Crash (_dots) 8.0 35.59sec

Stats Details: Shadow Crash Dots

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadow Crash Dots

  • id:391286
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:391286
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 2.9 123.39sec

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 165.2 1.80sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 165.24 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3564.95
  • base_dd_max:3564.95
  • base_dd_mult:1.00

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{({$=}e2+{$137033s1=0}7+{$137033s1=0}8)*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ancient Madness 5.3 0.0 61.8sec 61.8sec 19.4sec 34.44% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_ancient_madness
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.1s / 64.6s
  • trigger_min/max:61.1s / 64.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • ancient_madness_1:1.67%
  • ancient_madness_2:1.67%
  • ancient_madness_3:1.68%
  • ancient_madness_4:1.68%
  • ancient_madness_5:1.69%
  • ancient_madness_6:1.70%
  • ancient_madness_7:1.70%
  • ancient_madness_8:1.71%
  • ancient_madness_9:1.71%
  • ancient_madness_10:1.72%
  • ancient_madness_11:1.72%
  • ancient_madness_12:1.73%
  • ancient_madness_13:1.74%
  • ancient_madness_14:1.74%
  • ancient_madness_15:1.75%
  • ancient_madness_16:1.75%
  • ancient_madness_17:1.76%
  • ancient_madness_18:1.77%
  • ancient_madness_19:1.77%
  • ancient_madness_20:1.78%

Spelldata

  • id:341240
  • name:Ancient Madness
  • tooltip:
  • description:Voidform and Dark Ascension increase your critical strike chance by {$s1=10}% for {$194249d=20 seconds}, reducing by {$=}{{$s3=5}/10}.1% every sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.9 0.0 123.4sec 123.4sec 14.7sec 14.51% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:120.0s / 127.4s
  • trigger_min/max:120.0s / 127.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.51%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Coalescing Shadows 53.9 142.3 5.6sec 1.5sec 3.5sec 62.75% 75.62% 68.5 (68.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 41.5s
  • trigger_min/max:0.0s / 36.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.8s

Stack Uptimes

  • coalescing_shadows_1:21.25%
  • coalescing_shadows_2:14.08%
  • coalescing_shadows_3:27.41%

Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Coalescing Shadows (_dot) 2.1 51.1 121.9sec 5.6sec 136.8sec 97.77% 98.70% 51.1 (51.1) 1.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows_dot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 353.9s
  • trigger_min/max:0.0s / 38.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.3s

Stack Uptimes

  • coalescing_shadows_dot_1:97.77%

Spelldata

  • id:391244
  • name:Coalescing Shadows
  • tooltip:Your periodic damage is increased by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Ascension 5.3 0.0 61.8sec 61.8sec 19.4sec 34.44% 40.88% 98.2 (98.2) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_ascension
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.1s / 64.6s
  • trigger_min/max:61.1s / 64.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • dark_ascension_1:34.44%

Spelldata

  • id:391109
  • name:Dark Ascension
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Dark Evangelism 1.0 194.9 183.0sec 1.5sec 292.8sec 97.80% 98.21% 190.9 (190.9) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_evangelism
  • max_stacks:5
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:69.2s / 323.8s
  • trigger_min/max:0.0s / 29.9s
  • trigger_pct:100.00%
  • duration_min/max:1.8s / 354.0s

Stack Uptimes

  • dark_evangelism_1:0.13%
  • dark_evangelism_2:0.13%
  • dark_evangelism_3:0.13%
  • dark_evangelism_4:0.56%
  • dark_evangelism_5:96.86%

Spelldata

  • id:391099
  • name:Dark Evangelism
  • tooltip:Periodic Shadow damage increased by {$=}w1%.
  • description:{$@spelldesc391095=Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391095
  • name:Dark Evangelism
  • tooltip:
  • description:Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Death and Madness (_insanity_gain) 0.4 0.0 0.0sec 0.0sec 0.0sec 0.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_insanity_gain
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s

Stack Uptimes

Spelldata

  • id:321973
  • name:Death and Madness
  • tooltip:{$=}{{$m1=750}/100} Insanity generated every {$t1=1} sec.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_reset) 2.6 0.0 24.1sec 24.1sec 16.9sec 14.42% 0.00% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_reset
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.9s / 44.0s
  • trigger_min/max:20.9s / 44.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • death_and_madness_reset_1:14.42%

Spelldata

  • id:390628
  • name:Death and Madness
  • tooltip:
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:321291
  • name:Death and Madness
  • tooltip:
  • description:If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Desperate Prayer 0.3 0.0 0.0sec 0.0sec 9.2sec 0.92% 0.00% 2.5 (2.5) 0.3

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.0s

Stack Uptimes

  • desperate_prayer_1:0.93%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Devoured Pride 1.5 0.0 60.5sec 0.0sec 22.5sec 10.89% 12.74% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 63.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.0s / 34.0s

Stack Uptimes

  • devoured_pride_1:10.89%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 304.1sec 304.1sec 27.4sec 13.27% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 313.5s
  • trigger_min/max:300.0s / 313.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.27%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Mental Fortitude 4.3 325.7 85.5sec 0.9sec 65.6sec 94.08% 100.00% 325.7 (325.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.3s / 341.1s
  • trigger_min/max:0.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 347.3s

Stack Uptimes

  • mental_fortitude_1:94.08%

Spelldata

  • id:377065
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Mind Flay: Insanity 37.8 12.5 8.0sec 6.0sec 3.5sec 43.90% 0.00% 12.5 (12.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_flay_insanity
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 37.6s
  • trigger_min/max:0.9s / 19.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.0s

Stack Uptimes

  • mind_flay_insanity_1:43.90%

Spelldata

  • id:391401
  • name:Mind Flay: Insanity
  • tooltip:Mind Flay is temporarily empowered.
  • description:{$@spelldesc391399=Devouring Plague transforms your next Mind Flay into Mind Flay: Insanity. Lasts {$391401d=10 seconds}. {$@=}spellicon391403 {$@=}spellname391403 {$@spelldesc391403=Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Mind Melt 6.8 1.7 37.1sec 28.6sec 5.0sec 11.35% 9.02% 0.2 (0.2) 0.3

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_melt
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 297.7s
  • trigger_min/max:0.8s / 297.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.7s

Stack Uptimes

  • mind_melt_1:9.13%
  • mind_melt_2:2.22%

Spelldata

  • id:391092
  • name:Mind Melt
  • tooltip:The cast time of your next Mind Blast is reduced by {$=}w1% and its critical strike chance is increased by {$s2=25}%.
  • description:{$@spelldesc391090=Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times. Lasts {$391092d=10 seconds}.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Power Infusion 2.9 0.0 123.6sec 123.6sec 19.4sec 19.00% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:122.4s / 127.4s
  • trigger_min/max:122.4s / 127.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • power_infusion_1:19.00%

Spelldata

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%. Can only be cast on players.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 16.8 1.2 17.3sec 16.1sec 1.9sec 10.57% 27.30% 1.2 (1.2) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:2.40
  • modifier:1.00

Trigger Details

  • interval_min/max:0.5s / 71.2s
  • trigger_min/max:0.0s / 71.2s
  • trigger_pct:7.16%
  • duration_min/max:0.0s / 12.2s

Stack Uptimes

  • shadowy_insight_1:10.57%

Spelldata

  • id:375981
  • name:Shadowy Insight
  • tooltip:Your next Mind Blast is instant cast.
  • description:{$@spelldesc375888=Mind Blast gains an additional charge. Shadow Word: Pain periodic damage has a chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.8sec 45.6sec 16.5sec 23.73% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 213.9s
  • trigger_min/max:0.0s / 213.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 61.3s

Stack Uptimes

  • sophic_devotion_1:23.73%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.7 0.0 155.2sec 155.2sec 19.4sec 4.76% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 251.3s
  • trigger_min/max:120.0s / 251.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:4.76%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.7 0.0 156.4sec 156.4sec 19.4sec 4.82% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 250.5s
  • trigger_min/max:120.0s / 250.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:4.82%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.7 0.0 156.0sec 156.0sec 19.4sec 4.75% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 251.1s
  • trigger_min/max:120.0s / 251.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:4.75%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.7 0.0 156.4sec 156.4sec 19.5sec 4.84% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 251.4s
  • trigger_min/max:120.0s / 251.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:4.84%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Surge of Darkness 12.5 15.0 23.8sec 10.5sec 13.0sec 54.09% 100.00% 4.1 (4.1) 8.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_surge_of_darkness
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 146.0s
  • trigger_min/max:0.0s / 110.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 104.5s

Stack Uptimes

  • surge_of_darkness_1:25.27%
  • surge_of_darkness_2:14.49%
  • surge_of_darkness_3:14.33%

Spelldata

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike is instant cast, and deals {$s2=200}% additional damage.
  • description:{$@spelldesc162448=Your Vampiric Touch and Devouring Plague damage has a chance to cause your next Mind Spike to be instant cast and deal {$87160s2=200}% additional damage. Stacks up to {$87160u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Twist of Fate 1.0 205.9 0.0sec 0.5sec 104.4sec 34.78% 32.83% 205.9 (205.9) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 4.7s
  • trigger_pct:100.00%
  • duration_min/max:81.3s / 125.9s

Stack Uptimes

  • twist_of_fate_1:34.78%

Spelldata

  • id:390978
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$=}w1%.
  • description:{$@spelldesc390972=After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390972
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Void Torrent 4.9 0.0 65.8sec 65.8sec 3.0sec 4.86% 0.00% 0.0 (0.0) 4.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 109.3s
  • trigger_min/max:60.0s / 109.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s

Stack Uptimes

  • void_torrent_1:4.86%

Spelldata

  • id:263165
  • name:Void Torrent
  • tooltip:Dealing {$s1=0} Shadow damage to the target every {$t1=1} sec.
  • description:Channel a torrent of void energy into the target, dealing {$=}o Shadow damage over {$d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$289577s1=1500}*{$289577s2=4}/100} Insanity over the duration.|r
  • max_stacks:0
  • duration:3.00
  • cooldown:60.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Shadowy Apparition from Devouring Plague 50.1 37.0 63.0 6.0s 0.9s 28.0s
Shadowy Apparition from Mind Blast 61.9 44.0 85.0 4.8s 0.0s 20.7s
Void Tendril proc from Idol of C'Thun 9.7 2.0 23.0 28.5s 0.3s 135.0s
Shadowy Insight procs 16.8 7.0 34.0 17.3s 0.5s 71.2s
Shadowy Insight procs lost to overflow 1.2 0.0 7.0 78.5s 0.5s 327.9s
Shadowy Insight procs not consumed 0.0 0.0 1.0 0.0s 0.0s 0.0s
Coalescing Shadows from Mind Fay 41.8 19.0 69.0 6.9s 0.3s 89.3s
Coalescing Shadows from Shadow Word: Pain 15.1 2.0 35.0 18.7s 0.0s 223.7s
Coalescing Shadows from Shadowy Apparition 8.7 1.0 21.0 29.9s 0.0s 266.6s
Surge of Darkness from Vampiric Touch 13.3 2.0 31.0 21.1s 0.1s 279.3s
Surge of Darkness from Devouring Plague 14.2 2.0 30.0 19.8s 0.0s 230.2s
Mind Blast that consumed Mind Melt and Shadowy Insight 1.5 0.0 8.0 82.8s 2.4s 325.2s
Mind Flay: Insanity casts that did not channel for full ticks 0.3 0.0 1.0 0.0s 0.0s 0.0s
Idol of Y'Shaarj Devoured Violence procs 4.0 3.0 5.0 60.8s 60.0s 65.4s
Void Torrent ticks without full Mastery value 1.0 0.0 8.0 13.7s 0.0s 276.0s
Mindgames casts without full Mastery value 1.7 0.0 6.0 88.0s 32.8s 314.4s
Inescapable Torment expired when Mind Blast was ready 3.6 0.0 8.0 93.2s 0.0s 336.7s
Inescapable Torment expired when Shadow Word: Death was ready 1.2 0.0 6.0 119.3s 0.2s 335.9s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 84.35% 74.35% 89.63% 13.8s 0.0s 63.6s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Auspicious SpiritsInsanity111.96109.014.27%0.972.952.63%
Insanity Gained from Idol of C'thun Mind Flay'sInsanity142.53282.7511.06%1.982.310.81%
MindbenderInsanity130.65381.4814.93%2.9210.452.67%
Throes of PainInsanity0.884.400.17%4.980.020.39%
Dark AscensionInsanity5.33158.656.21%29.761.310.82%
HaloInsanity3.5235.171.38%10.000.000.00%
mana_regenMana833.1752732.39100.00%63.29426615.0489.00%
Mind BlastInsanity62.06370.8414.51%5.981.540.41%
Mind FlayInsanity18.7537.471.47%2.000.030.08%
Mind Flay: InsanityInsanity148.45593.6523.23%4.000.130.02%
Mind SpikeInsanity8.5134.041.33%4.000.000.00%
MindgamesInsanity7.6576.512.99%10.000.000.00%
Shadow CrashInsanity8.98134.725.27%15.000.000.00%
Vampiric TouchInsanity8.2532.991.29%4.000.000.00%
Void TorrentInsanity23.84303.6911.88%12.7453.9415.08%
Usage Type Count Total Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 50.302514.8350.0050.001384.13
MindgamesMana 7.6538252.905000.004999.8910.71
Shadow Word: DeathMana 11.8514810.531250.001250.0023.82
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 216100.0 306.94 302.17 1621226.4 211401.3 59446.5 216100.0
Mana 49999.0 175.78 176.88 426614.2 49667.9 43755.4 49999.0
Insanity 15.0 8.52 8.38 72.7 40.5 0.0 100.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 50318.86
Minimum 44606.36
Maximum 57008.48
Spread ( max - min ) 12402.11
Range [ ( max - min ) / 2 * 100% ] 12.32%
Standard Deviation 1481.2239
5th Percentile 47989.25
95th Percentile 52875.13
( 95th Percentile - 5th Percentile ) 4885.88
Mean Distribution
Standard Deviation 17.1048
95.00% Confidence Interval ( 50285.33 - 50352.38 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3329
0.1 Scale Factor Error with Delta=300 18730
0.05 Scale Factor Error with Delta=300 74918
0.01 Scale Factor Error with Delta=300 1872946
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 50318.86
Minimum 44606.36
Maximum 57008.48
Spread ( max - min ) 12402.11
Range [ ( max - min ) / 2 * 100% ] 12.32%
Standard Deviation 1481.2239
5th Percentile 47989.25
95th Percentile 52875.13
( 95th Percentile - 5th Percentile ) 4885.88
Mean Distribution
Standard Deviation 17.1048
95.00% Confidence Interval ( 50285.33 - 50352.38 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3329
0.1 Scale Factor Error with Delta=300 18730
0.05 Scale Factor Error with Delta=300 74918
0.01 Scale Factor Error with Delta=300 1872946
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 50318.86
Minimum 44606.36
Maximum 57008.48
Spread ( max - min ) 12402.11
Range [ ( max - min ) / 2 * 100% ] 12.32%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 12687041.71
Minimum 9594192.22
Maximum 15549997.34
Spread ( max - min ) 5955805.12
Range [ ( max - min ) / 2 * 100% ] 23.47%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 301.62
Minimum 0.00
Maximum 1220.50
Spread ( max - min ) 1220.50
Range [ ( max - min ) / 2 * 100% ] 202.32%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 305.92
Minimum 0.00
Maximum 1094.46
Spread ( max - min ) 1094.46
Range [ ( max - min ) / 2 * 100% ] 178.88%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
otion=elemental_potion_of_ultimate_power_ lask=phial_of_tepid_versatility_ ood=fated_fortune_cooki ugmentation=draconic_augment_run emporary_enchant=main_hand:howling_rune_
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 shadowform,if=!buff.shadowform.up
5 0.00 arcane_torrent
6 0.00 variable,name=mind_sear_cutoff,op=set,value=2
7 0.00 variable,name=pool_amount,op=set,value=60
8 0.00 shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice
9 0.00 mind_blast,if=talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in>=25&spell_targets.shadow_crash<=8|fight_style.dungeonslice)
A 0.00 vampiric_touch,if=!talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice)
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
0.00 variable,name=holding_crash,op=set,value=raid_event.adds.in<20
B 0.00 run_action_list,name=aoe,if=spell_targets.mind_sear>2|spell_targets.vampiric_touch>3
C 0.00 run_action_list,name=main
actions.cds
# count action,conditions
H 1.48 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
Todo Check VE/DA enter conditions based on dots
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
I 2.95 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
J 2.92 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
Sync Power Infusion with Voidform or Dark Ascension
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
K 5.35 dark_ascension,if=pet.fiend.active|!talent.mindbender&!cooldown.fiend.up|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2
Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
L 0.00 call_action_list,name=trinkets
M 0.30 desperate_prayer,if=health.pct<=75
Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.filler
# count action,conditions
N 14.41 mind_flay,if=buff.mind_flay_insanity.up&dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
0.00 vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
O 8.51 mind_spike,if=buff.surge_of_darkness.up
0.00 lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75|spell_targets.lights_judgment>1
P 3.53 halo,if=raid_event.adds.in>20
Save up to 20s if adds are coming soon.
Q 0.08 shadow_word_death,target_if=min:target.time_to_die,if=target.health.pct<20&(spell_targets.mind_sear<4|talent.inescapable_torment.rank=2&pet.fiend.active)
0.00 divine_star,if=raid_event.adds.in>10
Save up to 10s if adds are coming soon.
0.00 mind_spike,if=(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
R 3.17 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>30
Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain,target_if=min:remains
Use Shadow Word: Pain while moving as a low-priority action
actions.main
# count action,conditions
S 0.00 call_action_list,name=main_variables
T 0.00 call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
U 5.44 mindbender,if=(variable.dots_up|action.shadow_crash.in_flight)&(fight_remains<30|time_to_die>15)
V 7.37 mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
High priority Mind Blast action when using Inescapable Torment
0.00 damnation,target_if=dot.vampiric_touch.refreshable|dot.shadow_word_pain.refreshable
0.00 void_bolt,if=variable.dots_up&insanity<=85
0.00 mind_sear,target_if=spell_targets.mind_sear>1&buff.mind_devourer.up
Use Mind Devourer Procs on Mind Sear when facing 2 or more targets
W 50.30 devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
X 8.25 vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
0.00 shadow_word_pain,target_if=min:remains,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
Y 22.84 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
Z 11.77 shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
a 54.85 mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
b 7.68 mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
TODO: Dont use if add events are coming soon when talented into PL
c 7.98 shadow_crash,if=!variable.holding_crash
0.00 dark_void,if=raid_event.adds.in>20
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
d 4.88 void_torrent,if=insanity<=35&!variable.holding_crash,target_if=variable.all_dots_up
TODO: Dont use if add events are coming soon when talented into PL
e 0.00 call_action_list,name=filler
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance
f 2.95 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=fight_remains<20|!talent.ancient_madness|(cooldown.dark_ascension.remains>10&talent.dark_ascension)|(cooldown.void_eruption.remains>10&talent.void_eruption)|(!talent.void_eruption&!talent.dark_ascension)
Sync with cooldowns for Ancient Madness or use when the fight will end soon or at full stacks

Sample Sequence

0124678UKJHIfVWZabNWadWaNWNXWaVNVWaYaWYcOaWYbPaWYRWYaWaYXaRUKWVVWZabaWacdWaNWNaWYPXaWYaRacWYabOWYaOUZKJIfWaaaNWXaaWNaWcNWaZaVWabWdWYaOOWXYaaaWYaacWYaUZaKWaVbWaaNWXaNWZacNWdWYWaaYaWYXWYabWYaUZZaKJIfWVcaWNaOaWNPaWaZZNWabXVWaadWYaWYZZacWYa

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 4 shadowform PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 6 mind_sear_cutoff PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
Pre precombat 7 pool_amount PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
Pre precombat 8 shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
shadowform, static_empowerment
0:00.000 main U mindbender Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
bloodlust, shadowform, static_empowerment
0:00.940 cds K dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
bloodlust, shadowform, coalescing_shadows, static_empowerment
0:01.879 cds J power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, shadowform, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2)
0:01.879 cds H potion Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, power_infusion, shadowform, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2)
0:01.879 cds I blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, power_infusion, shadowform, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2), elemental_potion_of_ultimate_power
0:01.879 trinkets f use_items Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2), elemental_potion_of_ultimate_power
0:01.879 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(20), coalescing_shadows(2), dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(2), elemental_potion_of_ultimate_power
0:02.632 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(20), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(3), elemental_potion_of_ultimate_power
0:03.386 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(19), surge_of_darkness, mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(4), elemental_potion_of_ultimate_power
0:04.140 main a mind_blast Fluffy_Pillow 49955.4/49999: 100% mana
15.0/100: 15% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(18), surge_of_darkness, mental_fortitude, coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:04.896 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(17), surge_of_darkness, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.649 filler N mind_flay Fluffy_Pillow 45007.0/49999: 90% mana
38.0/100: 38% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(17), surge_of_darkness, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.149 main W devouring_plague Fluffy_Pillow 47407.0/49999: 95% mana
60.0/100: 60% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(15), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.904 main a mind_blast Fluffy_Pillow 48615.0/49999: 97% mana
14.0/100: 14% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.658 main d void_torrent Fluffy_Pillow 49821.4/49999: 100% mana
24.0/100: 24% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.924 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(10), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.679 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(10), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.434 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(9), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.933 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
87.0/100: 87% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(7), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.688 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
bloodlust, blood_fury, power_infusion, shadowform, ancient_madness(7), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.187 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
bloodlust, power_infusion, shadowform, ancient_madness(5), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.941 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
bloodlust, power_infusion, shadowform, ancient_madness(4), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.695 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
bloodlust, power_infusion, shadowform, ancient_madness(4), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.447 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
bloodlust, power_infusion, shadowform, ancient_madness(3), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.203 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
bloodlust, power_infusion, shadowform, ancient_madness(2), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.702 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
bloodlust, power_infusion, shadowform, ancient_madness, surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.456 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
bloodlust, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.396 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
bloodlust, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.334 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.206 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity
bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.144 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.085 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.959 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.940 filler O mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
bloodlust, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.880 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
bloodlust, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
0:32.819 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
bloodlust, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:33.759 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
bloodlust, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:35.632 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
bloodlust, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
0:36.571 filler P halo Fluffy_Pillow 45005.4/49999: 90% mana
59.0/100: 59% insanity
bloodlust, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
0:37.510 main a mind_blast Fluffy_Pillow 46507.8/49999: 93% mana
71.0/100: 71% insanity
bloodlust, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
0:38.449 main W devouring_plague Fluffy_Pillow 48010.2/49999: 96% mana
80.0/100: 80% insanity
bloodlust, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:39.390 main Y mind_flay Fluffy_Pillow 49515.8/49999: 99% mana
33.0/100: 33% insanity
bloodlust, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:41.262 filler R mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:44.915 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
shadowform, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:46.136 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
shadowform, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
0:48.572 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
shadowform, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:49.793 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:51.014 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
6.0/100: 6% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
0:52.233 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
13.0/100: 13% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
0:54.670 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:55.892 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:57.112 filler R mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:00.765 main U mindbender Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
1:01.986 cds K dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:03.207 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
88.0/100: 88% insanity
shadowform, ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:04.428 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
shadowform, ancient_madness(19), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:05.649 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
shadowform, ancient_madness(18), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:06.870 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
shadowform, ancient_madness(17), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:08.092 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
16.0/100: 16% insanity
shadowform, ancient_madness(16), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:09.310 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
shadowform, ancient_madness(14), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:10.528 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
shadowform, ancient_madness(13), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:11.749 main a mind_blast Fluffy_Pillow 45007.0/49999: 90% mana
42.0/100: 42% insanity
shadowform, ancient_madness(12), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:12.968 main W devouring_plague Fluffy_Pillow 46957.4/49999: 94% mana
52.0/100: 52% insanity
shadowform, ancient_madness(11), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:14.189 main a mind_blast Fluffy_Pillow 48911.0/49999: 98% mana
6.0/100: 6% insanity
shadowform, ancient_madness(10), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:15.410 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
16.0/100: 16% insanity
shadowform, ancient_madness(8), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:16.630 main d void_torrent Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
shadowform, ancient_madness(7), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:19.999 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
shadowform, ancient_madness(4), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:21.221 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
shadowform, ancient_madness(2), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:22.682 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
shadowform, ancient_madness, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:25.120 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
88.0/100: 88% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:26.339 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:28.775 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:29.994 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:31.214 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:33.651 filler P halo Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:34.873 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:36.095 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
1:37.315 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:38.534 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
7.0/100: 7% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:40.971 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
1:42.192 filler R mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:45.845 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:47.066 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:48.286 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:49.507 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:51.944 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:53.164 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:54.385 filler O mind_spike Fluffy_Pillow 45007.0/49999: 90% mana
48.0/100: 48% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:55.605 main W devouring_plague Fluffy_Pillow 46959.0/49999: 94% mana
52.0/100: 52% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
1:56.826 main Y mind_flay Fluffy_Pillow 48912.6/49999: 98% mana
3.0/100: 3% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, mind_flay_insanity, static_empowerment(5)
1:59.259 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_melt, static_empowerment(5)
2:00.480 filler O mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:01.700 main U mindbender Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
2:02.919 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_melt, static_empowerment(5)
2:04.141 cds K dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_melt, static_empowerment(5)
2:05.360 cds J power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
shadowform, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_melt, dark_ascension, static_empowerment(5)
2:05.360 cds I blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
power_infusion, shadowform, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_melt, dark_ascension, static_empowerment(5)
2:05.360 trinkets f use_items Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
blood_fury, power_infusion, shadowform, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_melt, dark_ascension, static_empowerment(5)
2:05.360 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
blood_fury, power_infusion, shadowform, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_melt, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:06.252 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
blood_fury, power_infusion, shadowform, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_melt, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:07.143 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
blood_fury, power_infusion, shadowform, ancient_madness(19), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:08.035 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
blood_fury, power_infusion, shadowform, ancient_madness(18), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:08.926 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
blood_fury, power_infusion, shadowform, ancient_madness(17), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:10.702 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
blood_fury, power_infusion, shadowform, ancient_madness(15), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:11.593 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
blood_fury, power_infusion, shadowform, ancient_madness(14), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:12.485 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
blood_fury, power_infusion, shadowform, ancient_madness(13), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:13.379 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
blood_fury, power_infusion, shadowform, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:14.270 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
blood_fury, power_infusion, shadowform, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:15.160 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
blood_fury, power_infusion, shadowform, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:16.937 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
blood_fury, power_infusion, shadowform, ancient_madness(9), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:17.830 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
blood_fury, power_infusion, shadowform, ancient_madness(8), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:18.722 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
blood_fury, power_infusion, shadowform, ancient_madness(7), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:19.614 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
blood_fury, power_infusion, shadowform, ancient_madness(6), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:21.393 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
power_infusion, shadowform, ancient_madness(4), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:22.284 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity
power_infusion, shadowform, ancient_madness(4), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:23.177 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
power_infusion, shadowform, ancient_madness(3), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:24.069 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
power_infusion, shadowform, ancient_madness(2), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:24.960 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
power_infusion, shadowform, ancient_madness, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:25.852 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:27.071 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:28.290 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:29.512 main W devouring_plague Fluffy_Pillow 45008.6/49999: 90% mana
53.0/100: 53% insanity
shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:30.731 main d void_torrent Fluffy_Pillow 46959.0/49999: 94% mana
11.0/100: 11% insanity
shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:33.986 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity
shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:35.207 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:37.644 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:38.865 filler O mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:40.084 filler O mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
2:41.304 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt(2), static_empowerment(5)
2:42.526 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
13.0/100: 13% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt(2), mind_flay_insanity, static_empowerment(5)
2:43.748 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt(2), mind_flay_insanity, static_empowerment(5)
2:46.184 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_melt(2), sophic_devotion, static_empowerment(5)
2:47.406 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
2:48.628 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
2:49.849 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
2:51.070 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
5.0/100: 5% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
2:53.507 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity
shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
2:54.729 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
2:55.948 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
2:57.166 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
2:58.386 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
1.0/100: 1% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:00.822 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:02.042 main U mindbender Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:03.263 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:04.484 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:05.704 cds K dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:06.925 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
shadowform, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
3:08.144 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
shadowform, ancient_madness(19), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:09.365 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
shadowform, ancient_madness(18), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:10.585 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
shadowform, ancient_madness(17), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:11.807 main W devouring_plague Fluffy_Pillow 45008.6/49999: 90% mana
60.0/100: 60% insanity
shadowform, ancient_madness(16), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:13.026 main a mind_blast Fluffy_Pillow 46959.0/49999: 94% mana
14.0/100: 14% insanity
shadowform, ancient_madness(14), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:14.246 main a mind_blast Fluffy_Pillow 48911.0/49999: 98% mana
24.0/100: 24% insanity
shadowform, ancient_madness(13), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:15.468 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
twist_of_fate, shadowform, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:17.906 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, shadowform, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
3:19.129 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
twist_of_fate, shadowform, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:20.351 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
twist_of_fate, shadowform, ancient_madness(7), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:21.573 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
twist_of_fate, shadowform, ancient_madness(6), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:24.009 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
twist_of_fate, shadowform, ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
3:25.231 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity
twist_of_fate, shadowform, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:26.452 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
twist_of_fate, shadowform, ancient_madness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:27.674 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:28.893 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:31.329 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:32.550 main d void_torrent Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:35.826 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
twist_of_fate, shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:37.046 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
twist_of_fate, shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:39.482 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
twist_of_fate, shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:40.702 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
twist_of_fate, shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:41.921 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:43.142 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:45.579 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:46.798 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity
twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:48.019 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:50.457 main X vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
3:51.676 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:52.897 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:55.334 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
twist_of_fate, shadowform, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:56.555 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:57.777 main W devouring_plague Fluffy_Pillow 45008.6/49999: 90% mana
57.0/100: 57% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:58.997 main Y mind_flay Fluffy_Pillow 46960.6/49999: 94% mana
10.0/100: 10% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:01.432 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:02.652 main U mindbender Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
twist_of_fate, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:03.874 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
twist_of_fate, shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:05.092 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
twist_of_fate, death_and_madness_reset, shadowform, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
4:06.312 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
twist_of_fate, death_and_madness_reset, shadowform, shadowy_insight, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:07.532 cds K dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:08.755 cds J power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(20), surge_of_darkness, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
4:08.755 cds I blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(20), surge_of_darkness, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
4:08.755 trinkets f use_items Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(20), surge_of_darkness, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
4:08.755 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(20), surge_of_darkness, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:09.733 main V mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:10.712 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(19), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:11.690 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(18), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:12.667 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(17), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:13.644 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(16), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:15.593 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(14), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:16.569 filler O mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(13), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:17.547 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_melt, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:18.526 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:19.503 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:21.451 filler P halo Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:22.430 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(7), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:23.407 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(6), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:24.382 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
power_infusion, twist_of_fate, shadowform, ancient_madness(5), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:25.357 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
power_infusion, twist_of_fate, shadowform, ancient_madness(4), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:26.334 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(3), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:27.313 filler N mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
power_infusion, twist_of_fate, death_and_madness_reset, shadowform, ancient_madness(2), surge_of_darkness, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:29.261 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:30.484 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:31.703 main b mindgames Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:32.924 main X vampiric_touch Fluffy_Pillow 45007.0/49999: 90% mana
49.0/100: 49% insanity
twist_of_fate, death_and_madness_reset, shadowform, shadowy_insight, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:34.144 main V mind_blast Fluffy_Pillow 46959.0/49999: 94% mana
56.0/100: 56% insanity
twist_of_fate, death_and_madness_reset, shadowform, shadowy_insight, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:35.365 main W devouring_plague Fluffy_Pillow 48912.6/49999: 98% mana
66.0/100: 66% insanity
twist_of_fate, death_and_madness_reset, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:36.586 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:37.808 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:39.029 main d void_torrent Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:42.293 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
94.0/100: 94% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:43.513 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:45.948 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
4:47.169 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:48.389 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:50.825 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
twist_of_fate, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:52.044 main Z shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:53.265 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(3), dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:54.485 main c shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
twist_of_fate, death_and_madness_reset, shadowform, surge_of_darkness(3), dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:55.706 main W devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
twist_of_fate, death_and_madness_reset, shadowform, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:56.927 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity
twist_of_fate, death_and_madness_reset, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:59.363 main a mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
twist_of_fate, death_and_madness_reset, shadowform, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3463 1 10805 10291 6827
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 216100 205820 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +687 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +515 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +687 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +687 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +89 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +515 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +386 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +386 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +687 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIk0CBAAAAAAAAAAAAQikkSkmU0iEJlESEkGJJJShgEESTahkAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
# otion=elemental_potion_of_ultimate_power_ lask=phial_of_tepid_versatility_ ood=fated_fortune_cooki ugmentation=draconic_augment_run emporary_enchant=main_hand:howling_rune_
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/variable,name=mind_sear_cutoff,op=set,value=2
actions.precombat+=/variable,name=pool_amount,op=set,value=60
actions.precombat+=/shadow_crash,if=raid_event.adds.in>=25&spell_targets.shadow_crash<=8&!fight_style.dungeonslice
actions.precombat+=/mind_blast,if=talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in>=25&spell_targets.shadow_crash<=8|fight_style.dungeonslice)
actions.precombat+=/vampiric_touch,if=!talent.damnation.enabled&(!talent.shadow_crash.enabled|raid_event.adds.in<25|spell_targets.shadow_crash>8|fight_style.dungeonslice)

# Executed every time the actor is available.
actions=variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
actions+=/variable,name=holding_crash,op=set,value=raid_event.adds.in<20
actions+=/run_action_list,name=aoe,if=spell_targets.mind_sear>2|spell_targets.vampiric_touch>3
actions+=/run_action_list,name=main

actions.aoe=call_action_list,name=aoe_variables
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&!variable.manual_vts_applied&!action.shadow_crash.in_flight
actions.aoe+=/shadow_crash,if=!variable.holding_crash
actions.aoe+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
actions.aoe+=/dark_void,if=raid_event.adds.in>10
actions.aoe+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)&(fight_remains<30|time_to_die>15)
# actions.aoe+=/run_action_list,name=aoe_pl_ire,if=talent.psychic_link.rank=2&talent.insidious_ire.rank=2 Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
actions.aoe+=/mind_blast,if=cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time&talent.mind_devourer.rank=2&spell_targets.mind_sear>=3&!buff.mind_devourer.up&spell_targets.mind_sear<=7
actions.aoe+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7&!buff.mind_devourer.up
actions.aoe+=/void_bolt,if=insanity<=85
# Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks, or mind devourer is up on 2+ targets. If Mind Devourer is up do not cancel mind sear.
actions.aoe+=/mind_sear,target_if=max:spell_targets.mind_sear,if=buff.mind_devourer.up&spell_targets.mind_sear>1|spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3))&!variable.pool_for_cds,early_chain_if=ticks>=2&!buff.mind_devourer_ms_active.up,interrupt_immediate=1,interrupt_if=ticks>=2&!buff.mind_devourer_ms_active.up
actions.aoe+=/call_action_list,name=pl_torrent,if=talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=3&(!variable.holding_crash|raid_event.adds.count%(active_dot.vampiric_touch+raid_event.adds.count)<1.5)&((insanity>=50|dot.devouring_plague.ticking|buff.dark_reveries.up)|buff.voidform.up|buff.dark_ascension.up)
actions.aoe+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75&(!buff.mind_flay_insanity.up&talent.mind_flay_insanity|!talent.psychic_link))&variable.dp_cutoff
actions.aoe+=/vampiric_touch,target_if=refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied),if=variable.max_vts>0&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains|variable.holding_crash)&!action.shadow_crash.in_flight
actions.aoe+=/shadow_word_pain,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
# TODO: Check Yshaarj Gains for pressing this during Inescapable Torment.
actions.aoe+=/shadow_word_death,target_if=min:target.time_to_die,if=target.time_to_die<=5&insanity<=80&talent.death_and_madness
actions.aoe+=/damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
actions.aoe+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
actions.aoe+=/mindgames,if=spell_targets.mind_sear<5&dot.devouring_plague.ticking|talent.psychic_link
actions.aoe+=/void_torrent,if=insanity<=35&!talent.psychic_link,target_if=variable.dots_up
actions.aoe+=/mind_flay,if=buff.mind_flay_insanity.up&buff.surge_of_darkness.remains>=5,interrupt_if=ticks>=2,interrupt_immediate=1
actions.aoe+=/call_action_list,name=filler


actions.aoe_variables=variable,name=max_vts,op=set,default=12,value=spell_targets.vampiric_touch>?12
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions.aoe_variables+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
# Todo Revamp to fix undesired behaviour with unstacked fights
actions.aoe_variables+=/variable,name=vts_applied,op=set,value=(active_dot.vampiric_touch+8*action.shadow_crash.in_flight)>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=holding_crash,op=set,value=(variable.max_vts-active_dot.vampiric_touch)<4|raid_event.adds.in<10&raid_event.adds.count>(variable.max_vts-active_dot.vampiric_touch),if=variable.holding_crash
actions.aoe_variables+=/variable,name=manual_vts_applied,op=set,value=(active_dot.vampiric_touch+8*!variable.holding_crash)>=variable.max_vts|!variable.is_vt_possible
actions.aoe_variables+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up

# Todo Check VE/DA enter conditions based on dots
actions.cds=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up&(fight_remains<=cooldown.power_infusion.remains+15)|fight_remains<=30
actions.cds+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions.cds+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions.cds+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions.cds+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
# Sync Power Infusion with Voidform or Dark Ascension
actions.cds+=/power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
# Use <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a> while <a href='https://www.wowhead.com/spell=194249/voidform'>Voidform</a> or <a href='https://www.wowhead.com/spell=391109/dark-ascension'>Dark Ascension</a> is active. Chain directly after your own <a href='https://www.wowhead.com/spell=10060/power-infusion'>Power Infusion</a>.
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
# Make sure Mindbender is active before popping Void Eruption and dump charges of Mind Blast before casting
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
# Make sure Mindbender is active before popping Dark Ascension unless you have insignificant talent points or too many targets
actions.cds+=/dark_ascension,if=pet.fiend.active|!talent.mindbender&!cooldown.fiend.up|spell_targets.mind_sear>2&talent.inescapable_torment.rank<2
actions.cds+=/call_action_list,name=trinkets
# Use Desperate Prayer to heal up should Shadow Word: Death or other damage bring you below 75%
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.filler=mind_flay,if=buff.mind_flay_insanity.up&dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
actions.filler+=/vampiric_touch,target_if=min:remains,if=buff.unfurling_darkness.up
actions.filler+=/mind_spike,if=buff.surge_of_darkness.up
actions.filler+=/lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75|spell_targets.lights_judgment>1
# Save up to 20s if adds are coming soon.
actions.filler+=/halo,if=raid_event.adds.in>20
actions.filler+=/shadow_word_death,target_if=min:target.time_to_die,if=target.health.pct<20&(spell_targets.mind_sear<4|talent.inescapable_torment.rank=2&pet.fiend.active)
# Save up to 10s if adds are coming soon.
actions.filler+=/divine_star,if=raid_event.adds.in>10
actions.filler+=/mind_spike,if=(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
actions.filler+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
actions.filler+=/shadow_crash,if=raid_event.adds.in>30
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.filler+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.filler+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.filler+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.filler+=/shadow_word_pain,target_if=min:remains

actions.main=call_action_list,name=main_variables
actions.main+=/call_action_list,name=cds,if=fight_remains<30|time_to_die>15&(!variable.holding_crash|spell_targets.mind_sear>2)
actions.main+=/mindbender,if=(variable.dots_up|action.shadow_crash.in_flight)&(fight_remains<30|time_to_die>15)
# High priority Mind Blast action when using Inescapable Torment
actions.main+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
actions.main+=/damnation,target_if=dot.vampiric_touch.refreshable|dot.shadow_word_pain.refreshable
actions.main+=/void_bolt,if=variable.dots_up&insanity<=85
# Use Mind Devourer Procs on Mind Sear when facing 2 or more targets
actions.main+=/mind_sear,target_if=spell_targets.mind_sear>1&buff.mind_devourer.up
actions.main+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
actions.main+=/vampiric_touch,target_if=min:remains,if=refreshable&target.time_to_die>=12&(cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight|variable.holding_crash)
actions.main+=/shadow_word_pain,target_if=min:remains,if=refreshable&target.time_to_die>=18&!talent.misery.enabled
# High Priority Mind Flay: Insanity to fish for C'Thun procs when Mind Blast is not capped and Void Torrent is not available and Mindbender is not active
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun&(!cooldown.void_torrent.up|!talent.void_torrent)
actions.main+=/shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(talent.inescapable_torment.rank<2|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up
actions.main+=/mind_blast,if=variable.dots_up&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
# TODO: Dont use if add events are coming soon when talented into PL
actions.main+=/mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
actions.main+=/shadow_crash,if=!variable.holding_crash
actions.main+=/dark_void,if=raid_event.adds.in>20
actions.main+=/devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
# TODO: Dont use if add events are coming soon when talented into PL
actions.main+=/void_torrent,if=insanity<=35&!variable.holding_crash,target_if=variable.all_dots_up
actions.main+=/call_action_list,name=filler

actions.main_variables=variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions.main_variables+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions.main_variables+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)|talent.void_torrent&talent.psychic_link&cooldown.void_torrent.remains<=4&(!raid_event.adds.exists&spell_targets.vampiric_touch>1|raid_event.adds.in<=5|raid_event.adds.remains>=6&!variable.holding_crash)&!buff.voidform.up

actions.pl_torrent=void_bolt
actions.pl_torrent+=/vampiric_touch,if=remains<=6&cooldown.void_torrent.remains<gcd*2
actions.pl_torrent+=/devouring_plague,if=remains<=4&cooldown.void_torrent.remains<gcd*2&!buff.voidform.up&(spell_targets.mind_sear<=4|!talent.surge_of_darkness&cooldown.mind_blast.full_recharge_time>=3)&!buff.mind_devourer.up
actions.pl_torrent+=/mind_sear,if=!variable.dp_cutoff|buff.mind_devourer.up
actions.pl_torrent+=/mind_blast,if=!talent.mindgames|cooldown.mindgames.remains>=3&!prev_gcd.1.mind_blast
actions.pl_torrent+=/void_torrent,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking|buff.voidform.up
actions.pl_torrent+=/mindgames,if=dot.vampiric_touch.ticking&dot.shadow_word_pain.ticking&dot.devouring_plague.ticking|buff.voidform.up

actions.trinkets=use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
# Sync with cooldowns for Ancient Madness or use when the fight will end soon or at full stacks
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=fight_remains<20|!talent.ancient_madness|(cooldown.dark_ascension.remains>10&talent.dark_ascension)|(cooldown.void_eruption.remains>10&talent.void_eruption)|(!talent.void_eruption&!talent.dark_ascension)

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=6827
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 45427 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45427.1 45427.1 43.8 / 0.096% 7601.3 / 16.7% 58.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
738.5 736.5 Mana 0.65% 52.5 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 45427
Elemental Blast 8038 17.7% 20.9 14.23sec 115094 99031 Direct 20.9 95045 190635 115143 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.93 20.93 0.00 0.00 0.00 1.1622 0.0000 2409415.05 2409415.05 0.00% 99030.62 99030.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.98% 16.53 6 25 95044.99 45560 200228 95087.74 73029 122292 1570746 1570746 0.00%
crit 21.02% 4.40 0 12 190634.85 91119 390187 188686.92 0 310543 838669 838669 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:10.44
  • if_expr:talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
    single
    [O]:1.25
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
    single
    [S]:9.25
  • if_expr:talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
Flame Shock 4732 10.4% 83.8 3.57sec 16920 128739 Direct 83.8 6113 12294 7184 17.3% 0.0%
Periodic 192.3 3611 7260 4246 17.4% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 83.85 83.85 192.25 192.25 82.85 0.1314 1.5505 1418701.88 1418701.88 0.00% 4589.81 128738.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 69.31 40 100 6112.80 3695 13879 6112.25 5226 7459 423710 423710 0.00%
crit 17.33% 14.53 3 32 12293.69 7390 27758 12294.97 9868 16505 178674 178674 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.59% 158.77 113 203 3610.51 1894 8027 3610.34 3170 4368 573247 573247 0.00%
crit 17.41% 33.48 11 59 7260.24 3899 15871 7260.43 6129 9271 243071 243071 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [X]:9.19
Flametongue Weapon 0 (925) 0.0% (2.0%) 1.0 0.00sec 277190 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 925 2.0% 676.7 0.72sec 410 0 Direct 676.7 348 700 410 17.4% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 676.71 676.71 0.00 0.00 0.00 0.0000 0.0000 277189.53 277189.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 559.04 386 730 348.50 289 593 348.51 323 394 194824 194824 0.00%
crit 17.39% 117.67 58 180 699.99 579 1172 700.07 628 806 82365 82365 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1081 2.4% 28.2 7.77sec 11520 0 Direct 28.2 9805 19716 11520 17.3% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.15 28.15 0.00 0.00 0.00 0.0000 0.0000 324288.49 324288.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 23.28 2 65 9805.44 9732 10030 9805.84 9732 10030 228272 228272 0.00%
crit 17.30% 4.87 0 21 19716.45 19463 20059 19333.53 0 20059 96016 96016 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 5256 11.6% 39.9 7.50sec 39526 34100 Direct 39.9 33615 67330 39526 17.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.86 39.86 0.00 0.00 0.00 1.1591 0.0000 1575572.79 1575572.79 0.00% 34099.62 34099.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.47% 32.87 18 49 33614.73 7659 108188 33680.05 25543 43758 1104960 1104960 0.00%
crit 17.53% 6.99 0 17 67330.38 15317 212302 67408.42 0 155010 470613 470613 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [N]:35.46
  • if_expr:buff.hailstorm.up
    single
    [V]:4.41
Ice Strike 1885 4.1% 24.5 12.34sec 23024 19817 Direct 24.5 19591 39269 23024 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.54 24.54 0.00 0.00 0.00 1.1618 0.0000 564942.36 564942.36 0.00% 19816.98 19816.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 20.26 10 30 19591.34 15009 43938 19593.30 16494 23742 396858 396858 0.00%
crit 17.44% 4.28 0 13 39268.78 30018 84173 38898.99 0 77254 168085 168085 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:24.54
  • if_expr:talent.hailstorm.enabled
Lava Lash 9172 20.2% 67.7 4.37sec 40588 34875 Direct 67.7 (67.7) 34541 69428 40588 17.3% (17.3%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.73 67.73 0.00 0.00 0.00 1.1638 0.0000 2749192.80 2749192.80 0.00% 34875.40 34875.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 55.99 27 88 34540.94 17703 124062 34556.29 29667 43794 1934051 1934051 0.00%
crit 17.33% 11.74 1 27 69427.75 35407 233829 69448.83 51340 96264 815142 815142 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [I]:49.81
  • if_expr:buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
    single
    [R]:17.92
Lightning Bolt 3327 7.3% 16.3 18.63sec 61211 51378 Direct 16.3 50460 100953 61213 21.3% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.28 16.28 0.00 0.00 0.00 1.1914 0.0000 996529.85 996529.85 0.00% 51378.11 51378.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.71% 12.81 5 22 50460.50 28814 128722 50593.84 38526 68375 646575 646575 0.00%
crit 21.29% 3.47 0 10 100953.39 57629 256415 98642.41 0 229054 349955 349955 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [K]:7.00
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [P]:0.27
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [T]:9.01
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1732 3.8% 193.4 1.81sec 2685 1508 Direct 193.4 2653 5335 2685 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.36 193.36 0.00 0.00 0.00 1.7805 0.0000 519143.59 741652.61 30.00% 1507.94 1507.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.24% 128.09 82 189 2653.34 2257 4290 2653.36 2429 2976 339857 485522 30.00%
crit 17.38% 33.60 13 59 5335.24 4513 8588 5334.79 4740 6172 179287 256131 30.00%
miss 16.38% 31.67 13 57 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 867 1.9% 193.4 1.80sec 1344 755 Direct 193.4 1328 2671 1344 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.37 193.37 0.00 0.00 0.00 1.7808 0.0000 259962.61 371384.62 30.00% 754.94 754.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.24% 128.08 82 179 1328.32 1128 2145 1328.31 1222 1504 170134 243055 30.00%
crit 17.39% 33.63 13 60 2671.18 2257 4294 2671.15 2385 3071 89828 128329 30.00%
miss 16.37% 31.66 12 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 162 (2863) 0.4% (6.3%) 7.0 45.71sec 121886 102398 Direct 7.0 (14.0) 5895 11826 6913 17.2% (19.2%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.00 1.1904 0.0000 48596.65 48596.65 0.00% 102397.62 102397.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.83% 5.82 1 8 5895.07 4707 9102 5899.21 4707 8730 34325 34325 0.00%
crit 17.17% 1.21 0 6 11826.29 9413 18203 8694.18 0 18016 14272 14272 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:7.03
  • if_expr:buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
    Lightning Bolt (_pw) 2701 5.9% 7.0 45.89sec 115509 0 Direct 7.0 95154 191413 115511 21.1% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.00 0.0000 0.0000 808471.43 808471.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.85% 5.52 1 8 95154.30 67234 193082 95213.50 67234 148510 525163 525163 0.00%
crit 21.15% 1.48 0 6 191412.94 134467 375569 154705.32 0 368441 283308 283308 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (1958) 0.0% (4.3%) 51.7 5.74sec 11360 9718

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.69 0.00 0.00 0.00 0.00 1.1690 0.0000 0.00 0.00 0.00% 9717.61 9717.61

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [Q]:51.69
    Stormstrike (_mh) 1305 2.9% 51.7 5.74sec 7572 0 Direct 51.7 6440 12957 7572 17.4% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.69 51.69 0.00 0.00 0.00 0.0000 0.0000 391417.13 559181.58 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 42.72 23 65 6440.47 5465 10690 6440.00 5849 7374 275108 393021 30.00%
crit 17.37% 8.98 0 20 12956.56 10930 21381 12954.50 0 16519 116309 166160 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 653 1.4% 51.7 5.74sec 3788 0 Direct 51.7 3220 6477 3788 17.4% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.69 51.69 0.00 0.00 0.00 0.0000 0.0000 195798.86 279719.79 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 42.69 24 64 3220.43 2733 5345 3220.29 2931 3735 137466 196385 30.00%
crit 17.42% 9.01 1 23 6476.55 5465 10690 6475.39 5465 8700 58333 83335 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 780 1.7% 5.7 53.44sec 40648 35003 Direct 5.7 34531 69418 40648 17.5% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.75 5.75 0.00 0.00 0.00 1.1613 0.0000 233646.21 233646.21 0.00% 35003.18 35003.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.46% 4.74 1 8 34530.96 26683 72174 34520.37 26683 54159 163679 163679 0.00%
crit 17.54% 1.01 0 6 69417.51 53365 139688 45672.72 0 135198 69968 69968 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [U]:5.75
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (715) 0.0% (1.6%) 1.0 0.00sec 214463 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 715 1.6% 151.9 4.06sec 1412 0 Direct 151.9 1201 2415 1412 17.3% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 151.90 151.90 0.00 0.00 0.00 0.0000 0.0000 214462.70 306383.10 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 125.57 70 195 1201.42 1016 1988 1201.51 1090 1376 150859 215518 30.00%
crit 17.34% 26.33 8 55 2415.36 2032 3976 2415.33 2111 2854 63604 90865 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
pet - greater_earth_elemental 413 / 86
melee 413 0.2% 40.1 2.30sec 640 420 Direct 40.1 545 1090 640 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.12 40.12 0.00 0.00 0.00 1.5223 0.0000 25675.03 36679.54 30.00% 420.35 420.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 33.16 20 62 545.26 475 919 544.20 475 694 18080 25829 30.00%
crit 17.36% 6.97 0 20 1090.43 950 1838 1088.32 0 1470 7595 10850 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2299 / 668
melee 2299 1.5% 89.1 3.42sec 2245 1994 Direct 89.1 1913 3825 2245 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.11 89.11 0.00 0.00 0.00 1.1260 0.0000 200095.02 285857.31 30.00% 1994.19 1994.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 73.61 6 191 1912.83 1588 3071 1911.74 1588 2403 140800 201148 30.00%
crit 17.40% 15.50 0 45 3824.81 3176 6071 3819.44 0 5241 59295 84709 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2297 / 672
melee 2297 1.5% 89.7 3.41sec 2244 1994 Direct 89.7 1913 3822 2244 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.65 89.65 0.00 0.00 0.00 1.1254 0.0000 201135.04 287343.10 30.00% 1993.59 1993.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 74.13 7 175 1913.11 1588 3071 1910.44 1588 2494 141817 202601 30.00%
crit 17.31% 15.52 0 45 3821.58 3176 6141 3816.31 0 5027 59318 84742 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2294 / 669
melee 2294 1.5% 89.2 3.40sec 2246 1996 Direct 89.2 1914 3822 2246 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.23 89.23 0.00 0.00 0.00 1.1253 0.0000 200454.20 286370.44 30.00% 1996.32 1996.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 73.69 6 175 1914.09 1588 3071 1910.84 1588 2687 141041 201492 30.00%
crit 17.42% 15.55 0 49 3821.56 3176 6141 3813.79 0 5543 59414 84879 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 310.77sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.13 0.00 0.00 0.00 0.00 1.0199 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [W]:1.13
Feral Spirit 10.7 30.06sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.73 0.00 0.00 0.00 0.00 1.1797 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:10.73
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.39sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.49
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 67.3 125.0 4.4sec 1.6sec 3.6sec 81.54% 98.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.5s

Stack Uptimes

  • ashen_catalyst_1:31.42%
  • ashen_catalyst_2:16.77%
  • ashen_catalyst_3:12.13%
  • ashen_catalyst_4:9.91%
  • ashen_catalyst_5:6.19%
  • ashen_catalyst_6:3.09%
  • ashen_catalyst_7:1.59%
  • ashen_catalyst_8:0.44%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.0 0.0 48.4sec 48.4sec 14.7sec 29.24% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.2s / 288.4s
  • trigger_min/max:14.2s / 288.4s
  • trigger_pct:84.81%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crackling_surge_1:23.31%
  • crackling_surge_2:5.93%
  • crackling_surge_3:0.00%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.5sec 12.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.9s
  • trigger_pct:100.00%
  • duration_min/max:16.1s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.35%
  • crumbling_power_3:0.58%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.67%
  • crumbling_power_7:0.66%
  • crumbling_power_8:0.66%
  • crumbling_power_9:0.65%
  • crumbling_power_10:0.63%
  • crumbling_power_11:0.63%
  • crumbling_power_12:0.63%
  • crumbling_power_13:0.63%
  • crumbling_power_14:0.64%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.72%
  • crumbling_power_17:0.79%
  • crumbling_power_18:0.83%
  • crumbling_power_19:0.99%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Elemental Blast: Critical Strike 6.1 0.8 45.0sec 38.9sec 10.7sec 21.94% 0.00% 0.8 (0.8) 5.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 294.4s
  • trigger_min/max:1.6s / 294.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.4s

Stack Uptimes

  • elemental_blast_critical_strike_1:21.94%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 6.1 0.9 45.3sec 38.8sec 10.8sec 22.00% 0.00% 0.9 (0.9) 5.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 300.1s
  • trigger_min/max:1.6s / 294.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.7s

Stack Uptimes

  • elemental_blast_haste_1:22.00%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 6.2 0.8 44.8sec 38.7sec 10.8sec 22.03% 0.00% 0.8 (0.8) 5.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 317.3s
  • trigger_min/max:1.6s / 308.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.0s

Stack Uptimes

  • elemental_blast_mastery_1:22.03%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 121.9sec 98.8sec 57.8sec 24.71% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:24.71%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.1sec 100.2sec 58.2sec 25.08% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 319.4s

Stack Uptimes

  • elemental_chaos_earth_1:25.08%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 126.4sec 100.4sec 58.1sec 25.09% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:25.09%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.6sec 99.5sec 58.1sec 25.12% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 302.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.12%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.3sec 302.3sec 27.5sec 13.38% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 325.3s
  • trigger_min/max:300.0s / 325.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.38%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 10.7 0.0 29.2sec 30.1sec 14.7sec 52.56% 0.00% 42.0 (42.0) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 49.2s
  • trigger_min/max:15.8s / 47.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • feral_spirit_1:52.56%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 49.6 231.0 6.1sec 1.1sec 4.8sec 78.97% 87.93% 231.0 (498.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 47.7s
  • trigger_min/max:0.0s / 16.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.3s

Stack Uptimes

  • flurry_1:21.73%
  • flurry_2:34.41%
  • flurry_3:22.83%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.8 58.0sec 47.0sec 12.9sec 19.29% 0.00% 0.8 (0.8) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 213.9s
  • trigger_min/max:0.2s / 208.2s
  • trigger_pct:98.89%
  • duration_min/max:0.0s / 49.7s

Stack Uptimes

  • forgestorm_ignited_1:19.29%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 35.7 1.5 8.4sec 8.1sec 2.2sec 26.08% 89.06% 1.5 (10.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 31.1s
  • trigger_min/max:1.6s / 31.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.7s

Stack Uptimes

  • hailstorm_5:4.86%
  • hailstorm_6:3.44%
  • hailstorm_7:2.65%
  • hailstorm_8:4.33%
  • hailstorm_9:2.56%
  • hailstorm_10:8.24%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.6 5.5 27.8sec 17.7sec 9.9sec 34.88% 88.50% 5.5 (5.5) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 247.9s
  • trigger_min/max:0.0s / 246.4s
  • trigger_pct:4.98%
  • duration_min/max:0.0s / 60.8s

Stack Uptimes

  • hot_hand_1:34.88%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.5 0.0 12.4sec 12.3sec 3.9sec 32.17% 60.21% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 27.4s
  • trigger_min/max:7.7s / 27.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • ice_strike_1:32.17%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 5.9 0.0 48.5sec 48.5sec 14.7sec 29.10% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.9s / 325.9s
  • trigger_min/max:12.9s / 325.9s
  • trigger_pct:84.84%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • icy_edge_1:23.25%
  • icy_edge_2:5.85%
  • icy_edge_3:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 38.1 227.4 8.0sec 2.3sec 6.9sec 87.40% 100.00% 16.9 (36.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 31.6s
  • trigger_min/max:0.0s / 18.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.8s

Stack Uptimes

  • maelstrom_weapon_1:11.21%
  • maelstrom_weapon_2:12.89%
  • maelstrom_weapon_3:13.20%
  • maelstrom_weapon_4:13.21%
  • maelstrom_weapon_5:10.12%
  • maelstrom_weapon_6:8.01%
  • maelstrom_weapon_7:6.18%
  • maelstrom_weapon_8:4.06%
  • maelstrom_weapon_9:2.26%
  • maelstrom_weapon_10:6.26%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 5.9 0.0 48.3sec 48.3sec 14.7sec 29.14% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 300.6s
  • trigger_min/max:14.0s / 300.6s
  • trigger_pct:84.95%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • molten_weapon_1:23.28%
  • molten_weapon_2:5.86%
  • molten_weapon_3:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 7.0 0.0 45.7sec 45.7sec 2.0sec 4.59% 43.53% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 52.4s
  • trigger_min/max:45.0s / 52.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.7s

Stack Uptimes

  • primordial_wave_1:4.59%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.1 60.8sec 45.8sec 16.4sec 23.58% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 198.7s
  • trigger_min/max:0.0s / 198.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.4s

Stack Uptimes

  • sophic_devotion_1:23.58%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.1sec 45.7sec 32.2sec 38.06% 0.00% 25.6 (25.6) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 255.8s
  • trigger_min/max:0.0s / 205.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 183.2s

Stack Uptimes

  • spiraling_winds_1:2.33%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.29%
  • spiraling_winds_4:2.27%
  • spiraling_winds_5:2.26%
  • spiraling_winds_6:2.24%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.21%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.72%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 7.0 0.0 45.9sec 45.9sec 11.8sec 27.59% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:39.8s / 54.3s
  • trigger_min/max:39.8s / 54.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • splintered_elements_1:27.59%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 30.7 8.8 9.6sec 7.4sec 2.8sec 29.19% 58.33% 8.8 (8.8) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 101.3s
  • trigger_min/max:0.0s / 100.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 33.3s

Stack Uptimes

  • stormbringer_1:29.19%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.8 9.0 49.0 10.9s 1.1s 118.9s
windfury_totem_extra_attack_oh 26.8 9.0 50.0 10.9s 1.1s 121.7s
Maelstrom Weapon: Feral Spirit 63.0 48.0 80.0 4.8s 0.0s 32.3s
Maelstrom Weapon: Swirling Maelstrom 60.0 43.0 77.0 5.0s 0.8s 24.1s
Maelstrom Weapon: Primordial Wave 70.3 60.0 80.0 45.7s 45.0s 52.4s
Maelstrom Weapon: Windfury Attack 30.5 10.0 64.0 10.8s 0.0s 121.8s
Maelstrom Weapon: main_hand 32.3 13.0 55.0 9.4s 1.1s 116.2s
Maelstrom Weapon: offhand 32.3 11.0 60.0 9.4s 1.1s 104.5s
Maelstrom Weapon: Sundering 1.1 0.0 6.0 107.0s 40.0s 347.4s
Maelstrom Weapon: Lava Lash 13.6 3.0 35.0 20.6s 0.8s 223.7s
Maelstrom Weapon: Ice Strike 4.9 0.0 14.0 50.4s 7.7s 309.2s
Maelstrom Weapon: Stormstrike 10.3 1.0 24.0 26.6s 0.8s 246.0s
Maelstrom Weapon: Stormstrike Off-Hand 10.4 1.0 23.0 26.5s 0.8s 268.3s
Flametongue: Windfury Attack 151.9 82.0 244.0 4.1s 0.0s 47.1s
Stormbringer: Windfury Attack 17.0 1.0 36.0 17.8s 0.0s 235.5s
Flametongue: main_hand 161.7 108.0 220.0 2.2s 1.1s 19.8s
Hot Hand: main_hand 8.1 0.0 20.0 33.0s 1.1s 295.4s
Windfury: main_hand 50.4 24.0 82.0 6.2s 1.1s 83.7s
Flametongue: offhand 161.7 112.0 212.0 2.2s 1.1s 15.2s
Hot Hand: offhand 8.0 0.0 21.0 33.3s 1.1s 311.1s
Flametongue: Sundering 5.7 2.0 8.0 53.5s 40.0s 193.7s
Stormbringer: Sundering 0.7 0.0 6.0 113.9s 40.0s 327.5s
Windfury: Sundering 1.8 0.0 7.0 96.2s 40.0s 328.2s
Flametongue: Lava Lash 67.7 35.0 104.0 4.4s 0.8s 15.5s
Stormbringer: Lava Lash 7.6 0.0 21.0 34.3s 0.8s 297.6s
Flametongue: Ice Strike 24.5 19.0 30.0 12.3s 7.7s 27.4s
Stormbringer: Ice Strike 2.7 0.0 10.0 69.3s 7.8s 349.4s
Windfury: Ice Strike 7.6 0.0 17.0 36.0s 7.7s 279.1s
Flametongue: Stormstrike 51.7 33.0 77.0 5.7s 0.8s 38.2s
Stormbringer: Stormstrike 5.8 0.0 21.0 41.3s 0.8s 312.2s
Windfury: Stormstrike 16.1 3.0 32.0 17.6s 0.8s 173.0s
Flametongue: Stormstrike Off-Hand 51.7 33.0 77.0 5.7s 0.8s 38.2s
Stormbringer: Stormstrike Off-Hand 5.8 0.0 18.0 41.5s 0.8s 301.4s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 23.28% 13.41% 29.96% 0.5s 0.0s 4.8s
Hot Hand 34.88% 9.83% 60.84% 9.9s 0.0s 60.8s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.8510.0011.5157.5962.18913.708
Sundering14.0470.001153.74564.2905.692192.575
Primordial Wave0.8820.0017.3884.2660.06813.595
Lava Lash0.8860.00112.39957.89027.91896.823
Flame Shock22.3880.001244.635180.9280.000303.333
Ice Strike0.7880.00115.32415.9652.49544.226
Frost Shock2.9980.00127.750110.70161.205165.391
Elemental Blast5.5130.00138.88448.0546.720105.220
Stormstrike1.9700.00126.58294.59643.205160.671
Earth Elemental10.7090.00844.7921.3010.00044.792

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana624.60220954.56100.00%353.75258428.2653.91%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 736.52 738.53 258428.2 49395.6 47000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 20.9328784.631375.001375.0083.70
Flame ShockMana 9.196889.38750.0082.16205.93
Frost ShockMana 39.8619930.61500.00500.0079.05
Ice StrikeMana 24.5440486.261650.001650.0013.95
Lava LashMana 67.7327093.40400.00400.00101.47
Lightning BoltMana 16.288140.11500.00500.00122.42
Primordial WaveMana 7.0310547.591500.001500.0081.26
StormstrikeMana 51.6951692.441000.001000.0011.36
SunderingMana 5.7517244.503000.003000.0413.55

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 45427.06
Minimum 39320.71
Maximum 53912.32
Spread ( max - min ) 14591.61
Range [ ( max - min ) / 2 * 100% ] 16.06%
Standard Deviation 1936.0118
5th Percentile 42380.69
95th Percentile 48718.08
( 95th Percentile - 5th Percentile ) 6337.39
Mean Distribution
Standard Deviation 22.3566
95.00% Confidence Interval ( 45383.25 - 45470.88 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6978
0.1 Scale Factor Error with Delta=300 31997
0.05 Scale Factor Error with Delta=300 127986
0.01 Scale Factor Error with Delta=300 3199630
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 45427.06
Minimum 39320.71
Maximum 53912.32
Spread ( max - min ) 14591.61
Range [ ( max - min ) / 2 * 100% ] 16.06%
Standard Deviation 1936.0118
5th Percentile 42380.69
95th Percentile 48718.08
( 95th Percentile - 5th Percentile ) 6337.39
Mean Distribution
Standard Deviation 22.3566
95.00% Confidence Interval ( 45383.25 - 45470.88 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6978
0.1 Scale Factor Error with Delta=300 31997
0.05 Scale Factor Error with Delta=300 127986
0.01 Scale Factor Error with Delta=300 3199630
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 45427.06
Minimum 39320.71
Maximum 53912.32
Spread ( max - min ) 14591.61
Range [ ( max - min ) / 2 * 100% ] 16.06%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 12987331.93
Minimum 9266056.46
Maximum 17101302.36
Spread ( max - min ) 7835245.91
Range [ ( max - min ) / 2 * 100% ] 30.16%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.49 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 10.73 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
G 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
H 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
I 49.81 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
0.00 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
0.00 ice_strike,if=buff.doom_winds.up
0.00 sundering,if=buff.doom_winds.up
J 7.03 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking
K 7.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
L 10.44 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
M 24.54 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
N 35.46 frost_shock,if=buff.hailstorm.up
0.00 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
0.00 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
O 1.25 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
P 0.27 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
Q 51.69 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
R 17.92 lava_lash
S 9.25 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
T 9.01 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 5.75 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
V 4.41 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
W 1.13 earth_elemental
X 9.19 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ACDEFBJKMNQQISINIQIMILNIQIUIFILIMNQTWNRQXSMNQRTNXQRIMIJFIKNQQQMLNQIUTNQQMQRSNXQVRIFILIMNQJKNRIQIMILNQFRUSNMQXRSNQITIMINQQONRXQJFKMNQQILNIQIMIQONQRQQUMTINIFIQIQLMDENRQJIKINIMIQQLNQFRVIMILIINIQITIMNQLUNQQQQIFJKMNQRILINIQIMTNQQRFISIMINQQRLNUQMQRTJKNQXRMFQSNRXQSNMTQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana flurry(3), elemental_chaos_fire
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement 50000.0/50000: 100% mana flurry(3), elemental_chaos_fire
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_fire
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_fire
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), elemental_chaos_fire
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), crumbling_power(20), elemental_chaos_fire
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry(3), crumbling_power(20), elemental_chaos_fire
0:00.895 default B potion Fluffy_Pillow 40682.0/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, icy_edge, crackling_surge, maelstrom_weapon, crumbling_power(19), elemental_chaos_fire
0:00.895 single J primordial_wave Fluffy_Pillow 40682.0/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, icy_edge, crackling_surge, maelstrom_weapon, crumbling_power(19), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:01.792 single K lightning_bolt Fluffy_Pillow 40617.2/50000: 81% mana bloodlust, berserking, flurry, primordial_wave, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(10), crumbling_power(19), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:02.684 single M ice_strike Fluffy_Pillow 41544.4/50000: 83% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hailstorm(10), crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:03.498 single N frost_shock Fluffy_Pillow 41196.8/50000: 82% mana bloodlust, berserking, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(17), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:04.311 single Q stormstrike Fluffy_Pillow 41997.6/50000: 84% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), crumbling_power(16), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:05.124 single Q stormstrike Fluffy_Pillow 42298.4/50000: 85% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), crumbling_power(15), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:05.938 single I lava_lash Fluffy_Pillow 42600.8/50000: 85% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hot_hand, maelstrom_weapon(6), crumbling_power(14), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:06.749 single S elemental_blast Fluffy_Pillow 43498.4/50000: 87% mana bloodlust, berserking, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), crumbling_power(13), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:07.562 single I lava_lash Fluffy_Pillow 43424.2/50000: 87% mana bloodlust, berserking, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, hailstorm(7), crumbling_power(12), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:08.353 single N frost_shock Fluffy_Pillow 44289.8/50000: 89% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(7), crumbling_power(11), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:09.144 single I lava_lash Fluffy_Pillow 45055.4/50000: 90% mana bloodlust, berserking, flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), crumbling_power(10), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:09.933 single Q stormstrike Fluffy_Pillow 45917.8/50000: 92% mana bloodlust, berserking, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(4), crumbling_power(9), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:10.722 single I lava_lash Fluffy_Pillow 46180.2/50000: 92% mana bloodlust, berserking, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), crumbling_power(8), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:11.513 single M ice_strike Fluffy_Pillow 47045.8/50000: 94% mana bloodlust, berserking, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), crumbling_power(7), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:12.302 single I lava_lash Fluffy_Pillow 46658.2/50000: 93% mana bloodlust, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), ice_strike, crumbling_power(6), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:13.171 single L elemental_blast Fluffy_Pillow 47648.6/50000: 95% mana bloodlust, flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, crumbling_power(5), spiraling_winds, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:14.038 single N frost_shock Fluffy_Pillow 47660.8/50000: 95% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hailstorm(10), ice_strike, crumbling_power(4), spiraling_winds, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:14.993 single I lava_lash Fluffy_Pillow 48688.8/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon, crumbling_power(3), spiraling_winds(2), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:15.949 single Q stormstrike Fluffy_Pillow 49818.4/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(2), crumbling_power(2), spiraling_winds(2), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:16.903 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), crumbling_power, spiraling_winds(3), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:17.888 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(3), spiraling_winds(3), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:18.872 single I lava_lash Fluffy_Pillow 48574.4/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(5), spiraling_winds(4), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:19.855 default F feral_spirit Fluffy_Pillow 49747.2/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(7), spiraling_winds(4), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:20.838 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), spiraling_winds(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:21.822 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(8), spiraling_winds(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:22.806 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, hailstorm(8), spiraling_winds(6), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:23.790 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(8), spiraling_winds(6), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:24.773 single N frost_shock Fluffy_Pillow 49922.8/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(8), ice_strike, spiraling_winds(6), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:25.757 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(7), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:26.740 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(7), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:27.723 single W earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hailstorm(5), spiraling_winds(8), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:28.707 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hailstorm(5), spiraling_winds(8), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:29.691 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(2), spiraling_winds(9), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:30.673 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(2), spiraling_winds(9), sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:31.655 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:32.639 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:33.622 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:34.607 single N frost_shock Fluffy_Pillow 49926.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), hailstorm(5), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:35.589 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), stormbringer, maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:36.572 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:37.556 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:38.539 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst, hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:39.521 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:40.504 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
0:41.908 Waiting     1.109 sec 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
0:43.017 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
0:44.294 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), hot_hand, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
0:45.570 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
0:46.846 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_fire
0:48.122 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_fire
0:49.400 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), primordial_wave, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_fire
0:50.676 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_fire
0:51.953 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_fire
0:53.227 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(10), elemental_chaos_fire
0:54.390 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_fire
0:55.551 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
0:56.712 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
0:57.874 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_fire
0:59.037 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(10), elemental_chaos_fire
1:00.200 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), stormbringer, hailstorm(9), ice_strike, spiraling_winds(10), elemental_chaos_earth
1:01.361 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), stormbringer, maelstrom_weapon, spiraling_winds(10), elemental_chaos_earth
1:02.523 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_earth
1:03.685 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(4), elemental_chaos_earth
1:04.847 single T lightning_bolt Fluffy_Pillow 48859.2/50000: 98% mana flurry, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(6), elemental_chaos_earth
1:06.123 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(2), stormbringer, hailstorm(6), elemental_chaos_earth
1:07.400 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), stormbringer, maelstrom_weapon, elemental_chaos_earth
1:08.678 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_earth
1:09.955 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_earth
1:11.270 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:12.546 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(6), maelstrom_weapon(6), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:13.823 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(6), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:15.099 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(2), hailstorm(6), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:16.374 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(3), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:17.650 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(3), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:18.928 Waiting     1.075 sec 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(3), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:20.003 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:21.467 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(5), maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
1:22.745 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
1:24.022 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), hot_hand, maelstrom_weapon(5), sophic_devotion, elemental_chaos_earth
1:25.298 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), elemental_chaos_earth
1:26.575 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), elemental_chaos_earth
1:27.851 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(8), elemental_chaos_earth
1:29.129 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(8), elemental_chaos_earth
1:30.406 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(6), hailstorm(8), ice_strike, elemental_chaos_earth
1:31.683 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), elemental_chaos_earth
1:32.959 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(10), elemental_chaos_earth
1:34.396 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(10), elemental_chaos_earth
1:35.673 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hailstorm(10), elemental_chaos_earth
1:36.834 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(2), elemental_chaos_earth
1:37.997 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), elemental_chaos_earth
1:39.158 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), elemental_chaos_earth
1:40.321 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(6), elemental_chaos_earth
1:41.482 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), elemental_chaos_earth
1:42.642 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_earth
1:43.803 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_earth
1:44.965 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, ashen_catalyst, stormbringer, hailstorm(8), ice_strike, elemental_chaos_earth
1:46.125 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon, elemental_chaos_earth
1:47.286 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_earth
1:48.566 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), elemental_chaos_earth
1:49.842 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(4), elemental_chaos_earth
1:51.117 single S elemental_blast Fluffy_Pillow 49040.0/50000: 98% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(5), elemental_chaos_earth
1:52.394 single N frost_shock Fluffy_Pillow 49708.2/50000: 99% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hailstorm(5), elemental_chaos_earth
1:53.671 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_earth
1:54.998 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), ice_strike, elemental_chaos_earth
1:56.274 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), ice_strike, elemental_chaos_earth
1:57.550 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(5), ice_strike, elemental_chaos_earth
1:58.827 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(5), ice_strike, elemental_chaos_earth
2:00.105 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(5), ice_strike, elemental_chaos_air
2:01.305 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), elemental_chaos_air
2:02.506 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), hot_hand, maelstrom_weapon(5), elemental_chaos_air
2:03.705 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(6), elemental_chaos_air
2:04.904 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(6), elemental_chaos_air
2:06.104 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(6), elemental_chaos_air
2:07.305 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), hailstorm(6), ice_strike, elemental_chaos_air
2:08.506 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(6), ice_strike, elemental_chaos_air
2:09.707 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(8), elemental_chaos_air
2:10.946 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(9), elemental_chaos_air
2:12.183 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(10), elemental_chaos_air
2:13.420 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), hailstorm(10), elemental_chaos_air
2:14.661 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon, elemental_chaos_air
2:15.898 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon, elemental_chaos_air
2:17.136 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon, spiraling_winds, elemental_chaos_air
2:18.372 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon, spiraling_winds(2), elemental_chaos_air
2:19.608 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, ashen_catalyst(3), maelstrom_weapon(10), spiraling_winds(2), elemental_chaos_air
2:20.845 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(10), spiraling_winds(3), elemental_chaos_air
2:22.083 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(5), hailstorm(10), spiraling_winds(4), elemental_chaos_air
2:23.209 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(6), maelstrom_weapon(3), hailstorm(10), ice_strike, spiraling_winds(4), elemental_chaos_air
2:24.331 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(6), stormbringer, maelstrom_weapon(6), spiraling_winds(5), elemental_chaos_air
2:25.456 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(7), stormbringer, maelstrom_weapon(6), spiraling_winds(5), elemental_chaos_air
2:26.581 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(8), maelstrom_weapon(8), spiraling_winds(6), elemental_chaos_air
2:27.705 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(8), spiraling_winds(6), elemental_chaos_air
2:28.829 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon, hailstorm(8), spiraling_winds(7), elemental_chaos_air
2:29.955 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(2), spiraling_winds(8), elemental_chaos_air
2:31.080 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), spiraling_winds(8), elemental_chaos_air
2:32.204 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(6), spiraling_winds(9), elemental_chaos_air
2:33.329 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge(2), hot_hand, maelstrom_weapon(6), spiraling_winds(9), elemental_chaos_air
2:34.571 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_air
2:35.807 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(10), elemental_chaos_air
2:37.044 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_air
2:38.280 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, hailstorm(10), ice_strike, spiraling_winds(10), elemental_chaos_air
2:39.517 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon, spiraling_winds(10), elemental_chaos_air
2:40.751 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_air
2:41.989 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, stormbringer, maelstrom_weapon(2), elemental_chaos_air
2:43.226 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, stormbringer, maelstrom_weapon(2), elemental_chaos_air
2:44.461 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(4), elemental_chaos_air
2:45.697 single M ice_strike Fluffy_Pillow 48977.6/50000: 98% mana elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(4), elemental_chaos_air
2:46.935 single T lightning_bolt Fluffy_Pillow 49308.4/50000: 99% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(5), ice_strike, elemental_chaos_air
2:48.171 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), hot_hand, maelstrom_weapon, hailstorm(5), ice_strike, elemental_chaos_air
2:49.406 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(5), ice_strike, elemental_chaos_air
2:50.643 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), elemental_chaos_air
2:51.879 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), elemental_chaos_air
2:53.118 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), elemental_chaos_air
2:54.354 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), elemental_chaos_air
2:55.590 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), elemental_chaos_air
2:56.826 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), elemental_chaos_air
2:58.063 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(8), elemental_chaos_air
2:59.300 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon, hailstorm(8), elemental_chaos_air
3:00.538 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(2), hailstorm(8), ice_strike, elemental_chaos_frost
3:00.538 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(2), hailstorm(8), ice_strike, crumbling_power(20), elemental_chaos_frost
3:00.538 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_weapon(2), hailstorm(8), ice_strike, crumbling_power(20), elemental_chaos_frost
3:01.700 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(5), crumbling_power(19), elemental_chaos_frost
3:02.861 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_mastery, feral_spirit, crackling_surge(2), maelstrom_weapon(5), crumbling_power(18), elemental_chaos_frost
3:04.024 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(7), crumbling_power(17), elemental_chaos_frost
3:05.185 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_mastery, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(10), crumbling_power(17), elemental_chaos_frost
3:06.347 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), crumbling_power(16), sophic_devotion, elemental_chaos_frost
3:07.507 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), crumbling_power(15), sophic_devotion, elemental_chaos_frost
3:08.564 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), crumbling_power(14), sophic_devotion, elemental_chaos_frost
3:09.621 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, splintered_elements, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), crumbling_power(13), sophic_devotion, elemental_chaos_frost
3:10.675 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), crumbling_power(12), sophic_devotion, elemental_chaos_frost
3:11.732 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), ice_strike, crumbling_power(11), sophic_devotion, elemental_chaos_frost
3:12.790 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, stormbringer, maelstrom_weapon(5), ice_strike, crumbling_power(10), sophic_devotion, elemental_chaos_frost
3:13.951 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), ice_strike, crumbling_power(9), sophic_devotion, elemental_chaos_frost
3:15.112 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(3), stormbringer, maelstrom_weapon(9), ice_strike, crumbling_power(8), sophic_devotion, elemental_chaos_frost
3:16.273 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, ashen_catalyst(4), stormbringer, hailstorm(9), ice_strike, crumbling_power(7), sophic_devotion, elemental_chaos_frost
3:17.435 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, ashen_catalyst(4), stormbringer, maelstrom_weapon, crumbling_power(6), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:18.596 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(5), maelstrom_weapon(3), crumbling_power(5), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:19.871 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(6), maelstrom_weapon(4), crumbling_power(4), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:21.148 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:22.433 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:23.711 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:24.988 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(8), ice_strike, spiraling_winds, sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:26.265 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(9), ice_strike, spiraling_winds(2), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:27.542 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, hailstorm(9), ice_strike, spiraling_winds(2), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:28.781 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(9), ice_strike, spiraling_winds(3), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:30.022 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(9), ice_strike, spiraling_winds(4), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:31.262 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3), spiraling_winds(4), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:32.501 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_frost
3:33.739 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(7), spiraling_winds(6), elemental_chaos_frost
3:34.978 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(7), spiraling_winds(6), elemental_chaos_frost
3:36.217 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(7), spiraling_winds(7), elemental_chaos_frost
3:37.458 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon, hailstorm(7), spiraling_winds(7), elemental_chaos_frost
3:38.736 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(7), ice_strike, spiraling_winds(8), elemental_chaos_frost
3:40.012 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), stormbringer, maelstrom_weapon(7), spiraling_winds(9), elemental_chaos_frost
3:41.289 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(8), spiraling_winds(9), elemental_chaos_frost
3:42.567 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), hailstorm(8), spiraling_winds(10), elemental_chaos_frost
3:43.807 single N frost_shock Fluffy_Pillow 48984.0/50000: 98% mana flurry, elemental_blast_haste, ashen_catalyst(4), stormbringer, maelstrom_weapon, hailstorm(8), spiraling_winds(10), elemental_chaos_frost
3:45.046 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_frost
3:46.285 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(6), stormbringer, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_frost
3:47.524 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(6), stormbringer, maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_frost
3:48.764 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(7), stormbringer, maelstrom_weapon(8), elemental_chaos_frost
3:50.003 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(8), maelstrom_weapon(8), elemental_chaos_frost
3:51.241 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, maelstrom_weapon(8), elemental_chaos_frost
3:52.478 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(10), elemental_chaos_frost
3:53.754 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(10), elemental_chaos_frost
3:55.030 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(10), elemental_chaos_frost
3:56.192 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(5), hailstorm(10), ice_strike, elemental_chaos_frost
3:57.354 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(7), elemental_chaos_frost
3:58.515 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(7), elemental_chaos_frost
3:59.676 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), elemental_chaos_frost
4:00.840 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(8), elemental_chaos_earth
4:02.001 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, hailstorm(8), elemental_chaos_earth
4:03.164 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, hailstorm(8), elemental_chaos_earth
4:04.324 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), elemental_chaos_earth
4:05.485 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), elemental_chaos_earth
4:06.646 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(6), elemental_chaos_earth
4:07.922 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(6), elemental_chaos_earth
4:09.198 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(9), ice_strike, elemental_chaos_earth
4:10.474 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(3), hailstorm(9), ice_strike, elemental_chaos_earth
4:11.750 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon, elemental_chaos_earth
4:13.099 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(2), elemental_chaos_earth
4:14.376 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), maelstrom_weapon(3), spiraling_winds, elemental_chaos_earth
4:15.654 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon(3), spiraling_winds, elemental_chaos_earth
4:16.930 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), spiraling_winds(2), elemental_chaos_earth
4:18.207 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(5), spiraling_winds(3), elemental_chaos_earth
4:19.484 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(5), spiraling_winds(3), elemental_chaos_earth
4:20.724 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(5), spiraling_winds(4), elemental_chaos_earth
4:21.963 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), hailstorm(5), ice_strike, spiraling_winds(5), elemental_chaos_earth
4:23.202 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(3), hailstorm(5), ice_strike, spiraling_winds(5), elemental_chaos_earth
4:24.441 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(6), elemental_chaos_earth
4:25.681 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth
4:26.922 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(7), spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
4:28.162 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon(9), spiraling_winds(8), forgestorm_ignited, elemental_chaos_earth
4:29.402 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hailstorm(9), spiraling_winds(8), forgestorm_ignited, elemental_chaos_earth
4:30.679 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, molten_weapon, ashen_catalyst(2), maelstrom_weapon(2), spiraling_winds(9), forgestorm_ignited, elemental_chaos_earth
4:31.955 single Q stormstrike Fluffy_Pillow 49041.6/50000: 98% mana elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:33.244 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:34.520 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:35.796 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(5), maelstrom_weapon(5), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
4:37.072 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_earth
4:38.347 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hailstorm(5), ice_strike, spiraling_winds(10), elemental_chaos_earth
4:39.624 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, ashen_catalyst(2), maelstrom_weapon(10), hailstorm(5), ice_strike, elemental_chaos_earth
4:40.901 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst(3), hailstorm(10), ice_strike, elemental_chaos_earth
4:42.062 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(4), maelstrom_weapon, elemental_chaos_earth
4:43.222 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(4), maelstrom_weapon, elemental_chaos_earth
4:44.384 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst(5), maelstrom_weapon, elemental_chaos_earth
4:45.545 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, maelstrom_weapon, elemental_chaos_earth
4:46.706 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(2), maelstrom_weapon(3), ice_strike, elemental_chaos_earth
4:47.868 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), ice_strike, elemental_chaos_earth
4:49.030 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(5), ice_strike, elemental_chaos_earth
4:50.192 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon, hailstorm(5), ice_strike, elemental_chaos_earth
4:51.319 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(2), elemental_chaos_earth
4:52.445 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(3), elemental_chaos_earth
4:53.686 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(4), elemental_chaos_earth
4:54.947 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), elemental_chaos_earth
4:56.187 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(5), elemental_chaos_earth
4:57.427 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_earth
4:58.668 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(5), ice_strike, elemental_chaos_earth
4:59.907 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon, hailstorm(5), ice_strike, forgestorm_ignited, elemental_chaos_earth

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.82% 15.82% 1047
Haste 17.84% 17.84% 3032
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 65.93% 58.69% 3842
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +386 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1047
# gear_haste_rating=3032
# gear_mastery_rating=3842
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Gamba : 46964 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
46963.8 46963.8 86.5 / 0.184% 14990.0 / 31.9% 52.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
843.2 840.6 Mana 1.45% 52.3 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Gamba 46964
Ascendance (_dre) 0 (1020) 0.0% (2.2%) 8.3 30.71sec 36760 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.31 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1020 2.2% 8.3 30.71sec 36760 0 Direct 8.3 30766 61774 36760 19.3% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.31 8.31 0.00 0.00 0.00 0.0000 0.0000 305471.18 305471.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 6.70 0 20 30766.03 25295 52193 30698.66 0 45026 206249 206249 0.00%
crit 19.33% 1.61 0 10 61774.35 50590 104386 48630.55 0 97258 99222 99222 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 78 0.2% 3.7 90.41sec 6210 5677 Direct 3.7 6210 0 6210 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0939 0.0000 23178.70 33113.27 30.00% 5676.88 5676.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 6209.88 3670 12883 6225.73 4839 8658 23179 33113 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6944 14.8% 25.1 11.75sec 82884 70579 Direct 25.1 68608 137477 82916 20.8% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.13 25.12 0.00 0.00 0.00 1.1744 0.0000 2083266.93 2083266.93 0.00% 70578.55 70578.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.22% 19.90 10 30 68608.14 43655 138080 68592.29 56084 85585 1365595 1365595 0.00%
crit 20.78% 5.22 0 15 137477.30 87310 272997 136895.66 0 225861 717672 717672 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [R]:25.14
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
Flame Shock 1507 3.2% 30.0 9.84sec 15069 34201 Direct 30.0 2734 5488 3211 17.3% 0.0%
Periodic 187.0 1620 3254 1903 17.3% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 186.96 186.96 28.69 0.4406 1.5548 452032.42 452032.42 0.00% 1487.41 34200.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 24.79 10 42 2733.51 2271 4687 2733.45 2445 3156 67776 67776 0.00%
crit 17.35% 5.20 0 17 5488.20 4543 9237 5464.72 0 7853 28558 28558 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.71% 154.63 109 199 1620.06 1 2788 1619.75 1463 1794 250506 250506 0.00%
crit 17.29% 32.33 12 61 3253.66 2 5523 3253.18 2897 3740 105193 105193 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [N]:1.31
  • if_expr:!ticking
    single
    [Z]:10.12
Flametongue Weapon 0 (1501) 0.0% (3.2%) 1.0 0.00sec 449750 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1501 3.2% 1128.0 0.67sec 399 0 Direct 1128.0 340 681 399 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1127.97 1127.97 0.00 0.00 0.00 0.0000 0.0000 449750.13 449750.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 932.82 639 1288 339.59 277 570 339.64 305 376 316773 316773 0.00%
crit 17.30% 195.15 117 309 681.42 554 1140 681.62 620 770 132977 132977 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1110 2.4% 28.9 7.55sec 11528 0 Direct 28.9 9808 19719 11528 17.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.91 28.91 0.00 0.00 0.00 0.0000 0.0000 333243.59 333243.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 23.89 2 74 9807.62 9732 10030 9807.16 9732 10030 234283 234283 0.00%
crit 17.36% 5.02 0 21 19718.57 19463 20059 19350.25 0 20059 98961 98961 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1019 2.2% 16.6 16.85sec 18423 15728 Direct 16.6 15657 31467 18423 17.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.59 16.59 0.00 0.00 0.00 1.1714 0.0000 305587.35 305587.35 0.00% 15727.60 15727.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 13.69 2 28 15657.30 7338 29996 15720.20 12059 22253 214275 214275 0.00%
crit 17.49% 2.90 0 11 31467.11 14677 58370 29909.45 0 58370 91313 91313 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [X]:16.59
Ice Strike 1390 3.0% 20.2 14.91sec 20609 17790 Direct 20.2 17523 35165 20609 17.5% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.22 20.22 0.00 0.00 0.00 1.1585 0.0000 416630.82 416630.82 0.00% 17789.53 17789.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 16.68 8 26 17522.86 14382 29675 17525.92 15393 20046 292286 292286 0.00%
crit 17.49% 3.54 0 12 35165.33 28763 58110 34316.32 0 54990 124344 124344 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:2.59
  • if_expr:buff.doom_winds.up
    single
    [T]:17.63
Lava Lash 1323 2.8% 18.6 15.72sec 21388 18231 Direct 18.6 18174 36448 21388 17.6% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.56 18.56 0.00 0.00 0.00 1.1732 0.0000 397043.52 397043.52 0.00% 18231.40 18231.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.41% 15.30 6 24 18173.82 15146 30954 18169.16 15499 20900 278043 278043 0.00%
crit 17.59% 3.26 0 11 36448.19 30292 62504 35298.90 0 55904 119001 119001 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [O]:4.24
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [U]:14.33
Lightning Bolt 2792 6.0% 16.7 16.79sec 50045 42609 Direct 16.7 41242 82776 50046 21.2% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.74 16.74 0.00 0.00 0.00 1.1745 0.0000 837616.75 837616.75 0.00% 42609.46 42609.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.81% 13.19 3 25 41241.90 27610 88620 41242.11 32312 53704 543981 543981 0.00%
crit 21.19% 3.55 0 13 82775.51 55220 169166 80419.18 0 146011 293635 293635 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [S]:4.25
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [V]:12.49
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1461 3.1% 163.3 2.14sec 2683 1579 Direct 163.3 2653 5333 2683 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 163.26 163.26 0.00 0.00 0.00 1.6992 0.0000 437972.19 625690.51 30.00% 1578.80 1578.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.23% 108.13 53 162 2653.31 2257 4339 2653.08 2416 2945 286904 409874 30.00%
crit 17.35% 28.33 7 63 5333.26 4513 8677 5332.57 4722 6252 151068 215817 30.00%
miss 16.42% 26.80 7 51 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 747 1.6% 166.7 2.08sec 1343 791 Direct 166.7 1329 2669 1343 17.3% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 166.74 166.74 0.00 0.00 0.00 1.6992 0.0000 223981.72 319982.04 30.00% 790.54 790.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.23% 110.43 57 166 1329.47 1128 2169 1329.41 1212 1487 146817 209744 30.00%
crit 17.34% 28.92 8 53 2668.59 2257 4339 2668.17 2322 3081 77165 110238 30.00%
miss 16.43% 27.39 10 50 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7585) 0.0% (16.2%) 91.9 3.25sec 24738 21283

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 91.93 0.00 0.00 0.00 0.00 1.1623 0.0000 0.00 0.00 0.00% 21282.98 21282.98

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:12.88
  • if_expr:buff.doom_winds.up
    single
    [Q]:79.05
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Stormstrike (_mh) 4087 (5056) 8.7% (10.8%) 122.5 3.25sec 12372 0 Direct 122.5 (183.4) 8508 17110 10003 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.52 122.52 0.00 0.00 0.00 0.0000 0.0000 1225572.61 1750862.66 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 101.22 53 163 8507.97 2623 23559 8525.81 7135 10088 861204 1230322 30.00%
crit 17.38% 21.30 5 46 17109.88 5246 43983 17145.49 11549 23581 364369 520541 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 968 2.1% 60.9 5.50sec 4768 0 Direct 60.9 4768 0 4768 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.88 60.88 0.00 0.00 0.00 0.0000 0.0000 290273.05 290273.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 60.88 22 111 4768.14 1152 18863 4783.59 3636 6290 290273 290273 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2045 (2529) 4.4% (5.4%) 122.5 3.25sec 6189 0 Direct 122.5 (183.4) 4253 8560 5004 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.52 122.52 0.00 0.00 0.00 0.0000 0.0000 613105.29 875887.03 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.57% 101.16 50 160 4253.49 1312 11780 4262.70 3646 5015 430289 614714 30.00%
crit 17.43% 21.36 5 46 8559.76 2623 21862 8578.25 5570 11695 182817 261173 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 484 1.0% 60.9 5.50sec 2385 0 Direct 60.9 2385 0 2385 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.88 60.88 0.00 0.00 0.00 0.0000 0.0000 145199.21 145199.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 60.88 22 111 2385.13 576 10057 2392.30 1827 3237 145199 145199 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1008 2.1% 6.4 49.43sec 47402 40882 Direct 6.4 40398 80934 47403 17.3% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.37 6.37 0.00 0.00 0.00 1.1596 0.0000 301951.02 301951.02 0.00% 40881.53 40881.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.72% 5.27 1 9 40398.07 25567 84869 40449.00 29515 59203 212877 212877 0.00%
crit 17.28% 1.10 0 5 80934.45 51135 160711 56266.42 0 160711 89074 89074 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [M]:1.63
  • if_expr:buff.doom_winds.up
    single
    [W]:4.74
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (6908) 0.0% (14.7%) 1.0 0.00sec 2067471 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6908 14.7% 416.7 2.41sec 4962 0 Direct 416.7 4231 8483 4962 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 416.66 416.66 0.00 0.00 0.00 0.0000 0.0000 2067470.92 2953605.19 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.80% 345.00 198 506 4230.60 1423 11773 4228.51 3606 5207 1459536 2085105 30.00%
crit 17.20% 71.66 36 123 8483.11 2845 23547 8478.05 6795 11251 607935 868500 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 519 1.1% 33.6 8.43sec 4621 3288 Direct 33.6 3807 7649 4621 21.2% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.60 33.60 0.00 0.00 0.00 1.4054 0.0000 155279.12 155279.12 0.00% 3288.14 3288.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.81% 26.48 0 77 3806.65 3224 6140 3801.56 0 5372 100813 100813 0.00%
crit 21.19% 7.12 0 25 7649.25 6448 12257 7584.24 0 11513 54466 54466 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 300 0.6% 38.8 7.31sec 2311 1592 Direct 38.8 1903 3824 2311 21.2% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.81 38.81 0.00 0.00 0.00 1.4520 0.0000 89693.74 89693.74 0.00% 1591.64 1591.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.76% 30.57 0 87 1902.84 1612 3070 1900.42 0 2665 58165 58165 0.00%
crit 21.24% 8.24 0 30 3824.39 3224 6134 3798.90 0 5477 31528 31528 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (6913) 0.0% (14.7%) 27.4 8.63sec 75583 65732

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.37 0.00 0.00 0.00 0.00 1.1499 0.0000 0.00 0.00 0.00% 65731.63 65731.63

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:27.36
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [P]:0.00
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1863 (2201) 4.0% (4.7%) 36.5 8.63sec 18058 0 Direct 36.5 (48.9) 13053 26180 15292 17.1% (12.7%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.47 36.45 0.00 0.00 0.00 0.0000 0.0000 557423.48 557423.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.94% 30.23 0 98 13053.42 3748 31939 12996.10 0 21758 394654 394654 0.00%
crit 17.06% 6.22 0 29 26179.74 7495 65315 25617.70 0 56465 162770 162770 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 338 0.7% 12.4 18.31sec 8122 0 Direct 12.4 8122 0 8122 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.45 12.45 0.00 0.00 0.00 0.0000 0.0000 101086.92 101086.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.45 0 43 8122.13 2777 28678 8012.02 0 17414 101087 101087 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 932 (1101) 2.0% (2.3%) 36.5 8.63sec 9034 0 Direct 36.5 (48.9) 6525 13111 7651 17.1% (12.7%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.47 36.45 0.00 0.00 0.00 0.0000 0.0000 278874.42 278874.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.90% 30.22 0 100 6524.55 1874 16329 6493.44 0 10488 197164 197164 0.00%
crit 17.10% 6.23 0 26 13110.72 3748 32553 12859.19 0 27191 81710 81710 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 169 0.4% 12.4 18.31sec 4064 0 Direct 12.4 4064 0 4064 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.45 12.45 0.00 0.00 0.00 0.0000 0.0000 50573.65 50573.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.45 0 43 4063.52 1554 14681 4007.84 0 10001 50574 50574 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3610 7.7% 27.4 8.63sec 39486 0 Direct 27.4 32513 65274 39485 21.3% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.36 27.36 0.00 0.00 0.00 0.0000 0.0000 1080418.78 1080418.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.72% 21.54 0 73 32513.15 15339 56970 32442.35 0 45685 700297 700297 0.00%
crit 21.28% 5.82 0 19 65274.09 30678 110995 64056.46 0 101450 380122 380122 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 422 / 89
melee 422 0.2% 41.0 2.38sec 643 429 Direct 41.0 548 1096 643 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.99 40.99 0.00 0.00 0.00 1.5004 0.0000 26369.04 37671.02 30.00% 428.77 428.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 33.85 22 62 547.99 475 892 546.79 475 717 18551 26502 30.00%
crit 17.41% 7.14 0 20 1095.54 950 1783 1092.47 0 1472 7818 11169 29.97%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 3929 / 2753
melee 3929 5.9% 370.4 1.61sec 2226 1949 Direct 370.4 1898 3791 2226 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 370.42 370.42 0.00 0.00 0.00 1.1422 0.0000 824523.42 1177920.63 30.00% 1948.79 1948.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 306.19 181 454 1897.59 1588 3106 1898.08 1729 2163 581030 830065 30.00%
crit 17.34% 64.23 27 107 3791.19 3176 6212 3792.55 3415 4351 243493 347856 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Gamba
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.2 308.69sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.15 0.00 0.00 0.00 0.00 1.0029 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Y]:1.15
Feral Spirit 14.9 21.15sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.89 0.00 0.00 0.00 0.00 1.1537 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:14.89
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 307.34sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.48
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 6.4 0.0 41.4sec 41.4sec 7.7sec 16.45% 91.91% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 333.4s
  • trigger_min/max:6.0s / 333.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.0s

Stack Uptimes

  • ascendance_1:16.45%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.1s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.73%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.74%
  • crumbling_power_19:1.21%
  • crumbling_power_20:0.06%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4sec 90.4sec 7.9sec 9.88% 11.41% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.3s
  • trigger_min/max:90.0s / 92.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 14.9 0.0 24.3sec 20.7sec 17.9sec 70.03% 100.00% 0.0 (0.0) 11.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.1s / 108.6s
  • trigger_min/max:6.1s / 43.3s
  • trigger_pct:49.99%
  • duration_min/max:0.0s / 103.5s

Stack Uptimes

  • earthen_weapon_2:67.27%
  • earthen_weapon_4:2.76%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.4 1.0 37.5sec 32.7sec 10.8sec 26.57% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 256.6s
  • trigger_min/max:1.7s / 252.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.7s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.57%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.4 1.0 37.4sec 32.7sec 10.7sec 26.52% 0.00% 1.0 (1.0) 7.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 272.1s
  • trigger_min/max:1.7s / 272.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.5s

Stack Uptimes

  • elemental_blast_haste_1:26.52%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.4 1.0 37.7sec 32.9sec 10.7sec 26.49% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 240.7s
  • trigger_min/max:1.7s / 234.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.5s

Stack Uptimes

  • elemental_blast_mastery_1:26.49%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.0sec 99.1sec 58.4sec 24.96% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 354.1s

Stack Uptimes

  • elemental_chaos_air_1:24.96%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.0sec 99.9sec 57.5sec 24.81% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:24.81%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 123.5sec 98.2sec 57.8sec 25.07% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 306.7s

Stack Uptimes

  • elemental_chaos_fire_1:25.07%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 125.1sec 99.3sec 58.1sec 25.16% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 301.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.16%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.4sec 307.4sec 27.4sec 13.28% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.3s
  • trigger_min/max:300.0s / 329.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.28%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 11.8 3.1 26.5sec 21.1sec 17.9sec 70.04% 0.00% 60.1 (60.1) 11.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 108.6s
  • trigger_min/max:7.1s / 43.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 103.5s

Stack Uptimes

  • feral_spirit_1:70.04%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.7 387.7 6.9sec 0.7sec 5.8sec 85.19% 90.84% 387.7 (921.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 68.2s
  • trigger_min/max:0.0s / 17.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.5s

Stack Uptimes

  • flurry_1:19.90%
  • flurry_2:34.72%
  • flurry_3:30.57%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 121.5 17.7sec 2.2sec 14.6sec 84.90% 100.00% 58.2 (58.2) 16.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 47.6s
  • trigger_min/max:0.0s / 39.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.56%
  • forceful_winds_2:13.76%
  • forceful_winds_3:12.43%
  • forceful_winds_4:10.58%
  • forceful_winds_5:33.57%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.3sec 46.3sec 13.0sec 19.55% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 204.8s
  • trigger_min/max:0.2s / 204.8s
  • trigger_pct:98.85%
  • duration_min/max:0.0s / 67.6s

Stack Uptimes

  • forgestorm_ignited_1:19.55%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 19.1 1.1 15.9sec 14.9sec 7.7sec 48.99% 79.24% 1.1 (1.1) 5.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.3s / 100.1s
  • trigger_min/max:8.2s / 100.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.8s

Stack Uptimes

  • ice_strike_1:48.99%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 23.1 21.0 12.9sec 6.7sec 8.0sec 61.98% 0.00% 21.0 (21.0) 22.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 84.1s
  • trigger_min/max:0.8s / 35.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.5s

Stack Uptimes

  • legacy_of_the_frost_witch_1:61.98%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 49.4 425.3 6.1sec 1.2sec 5.3sec 86.88% 100.00% 69.1 (74.2) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 55.3s
  • trigger_min/max:0.0s / 8.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.8s

Stack Uptimes

  • maelstrom_weapon_1:8.75%
  • maelstrom_weapon_2:10.26%
  • maelstrom_weapon_3:11.95%
  • maelstrom_weapon_4:12.54%
  • maelstrom_weapon_5:8.40%
  • maelstrom_weapon_6:7.20%
  • maelstrom_weapon_7:5.63%
  • maelstrom_weapon_8:4.91%
  • maelstrom_weapon_9:4.00%
  • maelstrom_weapon_10:13.24%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.8sec 45.5sec 16.5sec 23.80% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 221.5s
  • trigger_min/max:0.0s / 210.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 97.2s

Stack Uptimes

  • sophic_devotion_1:23.80%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.1sec 45.4sec 32.3sec 38.48% 0.00% 26.0 (26.0) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 252.5s
  • trigger_min/max:0.0s / 187.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 221.0s

Stack Uptimes

  • spiraling_winds_1:2.36%
  • spiraling_winds_2:2.33%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.27%
  • spiraling_winds_7:2.25%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.96%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 6.4 0.0 41.4sec 41.4sec 7.7sec 16.45% 100.00% 43.0 (43.0) 6.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 333.4s
  • trigger_min/max:6.0s / 333.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.0s

Stack Uptimes

  • static_accumulation_1:16.45%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 62.8 19.4 4.7sec 3.6sec 1.1sec 23.66% 52.32% 19.4 (19.4) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 74.7s
  • trigger_min/max:0.0s / 74.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • stormbringer_1:23.66%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.8 36.0 66.0 17.8s 15.0s 66.0s
Windfury-ForcefulWinds: 2 51.5 33.0 72.0 18.0s 0.5s 65.9s
Windfury-ForcefulWinds: 3 49.9 30.0 69.0 18.5s 0.2s 78.1s
Windfury-ForcefulWinds: 4 46.7 21.0 69.0 19.8s 0.8s 95.6s
Windfury-ForcefulWinds: 5 216.9 111.0 363.0 4.6s 0.0s 89.5s
windfury_totem_extra_attack_mh 28.2 9.0 51.0 10.4s 1.2s 131.9s
windfury_totem_extra_attack_oh 29.4 10.0 59.0 10.0s 0.1s 115.0s
Windfury: Unruly Winds 138.9 84.0 201.0 2.4s 0.0s 39.3s
Maelstrom Weapon: Feral Spirit 79.8 51.0 109.0 3.8s 0.0s 28.3s
Maelstrom Weapon: Elemental Assault 119.3 76.0 173.0 2.5s 0.8s 9.6s
Maelstrom Weapon: Static Accumulation 98.4 0.0 288.0 4.8s 1.0s 328.4s
Stormflurry 39.7 11.0 77.0 9.8s 0.8s 106.4s
Maelstrom Weapon: Windfury Attack 83.2 40.0 144.0 4.6s 0.0s 73.3s
Maelstrom Weapon: main_hand 27.3 8.0 51.0 11.1s 1.2s 123.2s
Maelstrom Weapon: Windlash 6.7 0.0 28.0 32.5s 1.2s 352.0s
Maelstrom Weapon: offhand 27.9 9.0 54.0 10.8s 1.2s 130.5s
Maelstrom Weapon: Windlash Off-Hand 7.7 0.0 26.0 29.1s 0.3s 333.7s
Maelstrom Weapon: Doom Winds 0.8 0.0 4.0 133.3s 90.0s 273.9s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 105.4s 40.0s 342.4s
Maelstrom Weapon: Windstrike 7.3 0.0 30.0 30.8s 0.8s 328.7s
Maelstrom Weapon: Windstrike Off-Hand 7.3 0.0 28.0 30.7s 0.8s 316.0s
Maelstrom Weapon: Lava Lash 3.7 0.0 12.0 58.8s 8.6s 316.3s
Maelstrom Weapon: Ice Strike 4.0 0.0 12.0 57.3s 8.3s 316.2s
Maelstrom Weapon: Stormstrike 24.5 7.0 52.0 12.6s 0.8s 178.1s
Maelstrom Weapon: Stormstrike Off-Hand 24.6 7.0 50.0 12.6s 0.8s 149.8s
Flametongue: Windfury Attack 416.7 252.0 603.0 2.4s 0.0s 39.3s
Stormbringer: Windfury Attack 43.9 12.0 78.0 7.7s 0.0s 109.8s
Flametongue: main_hand 136.5 68.0 194.0 2.6s 1.2s 79.6s
Windfury: main_hand 52.0 19.0 85.0 6.3s 1.2s 91.0s
Flametongue: Windlash 33.6 0.0 95.0 8.4s 1.2s 328.7s
Windfury: Windlash 12.6 0.0 41.0 19.7s 1.2s 306.8s
Flametongue: offhand 139.3 74.0 204.0 2.6s 1.2s 78.7s
Flametongue: Windlash Off-Hand 38.8 0.0 105.0 7.3s 0.1s 328.1s
Flametongue: Sundering 6.4 3.0 9.0 49.4s 40.0s 159.2s
Stormbringer: Sundering 0.7 0.0 4.0 113.8s 40.0s 338.3s
Windfury: Sundering 3.0 0.0 8.0 88.9s 40.0s 351.9s
Flametongue: Windstrike 36.5 0.0 117.0 8.6s 0.8s 329.4s
Stormbringer: Windstrike 3.8 0.0 16.0 45.6s 0.8s 325.4s
Windfury: Windstrike 13.9 0.0 50.0 18.8s 0.8s 312.7s
Flametongue: Windstrike Off-Hand 36.5 0.0 117.0 8.6s 0.8s 329.4s
Stormbringer: Windstrike Off-Hand 3.9 0.0 23.0 45.2s 0.8s 330.6s
Flametongue: Lava Lash 18.6 11.0 25.0 15.7s 8.4s 79.2s
Stormbringer: Lava Lash 1.9 0.0 9.0 77.5s 8.8s 321.8s
Flametongue: Ice Strike 20.2 11.0 28.0 14.9s 8.2s 100.1s
Stormbringer: Ice Strike 2.1 0.0 9.0 78.1s 8.4s 339.3s
Windfury: Ice Strike 8.0 2.0 16.0 37.2s 8.2s 275.1s
Flametongue: Stormstrike 122.5 67.0 188.0 3.3s 0.8s 79.7s
Stormbringer: Stormstrike 12.9 1.0 31.0 22.2s 0.8s 240.4s
Windfury: Stormstrike 49.4 22.0 93.0 7.1s 0.8s 106.9s
Flametongue: Stormstrike Off-Hand 122.5 67.0 188.0 3.3s 0.8s 79.7s
Stormbringer: Stormstrike Off-Hand 12.9 2.0 34.0 22.0s 0.8s 309.6s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 26.37% 11.97% 45.77% 0.8s 0.0s 34.4s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7900.0011.47010.3572.88019.390
Doom Winds0.5330.0012.3141.1350.0004.484
Sundering9.8890.001119.24050.6622.529161.965
Windstrike1.0580.0013.95128.7070.00092.252
Lava Lash4.1070.00166.88970.26118.348164.597
Flame Shock21.2240.001249.895219.2740.000327.752
Ice Strike3.4730.00188.17264.23814.176158.540
Frost Shock12.5910.001180.681190.31645.875296.909
Elemental Blast3.8270.00134.8163.0320.00049.904
Stormstrike1.0520.0014.95692.27147.935149.124
Earth Elemental9.3250.00345.6771.3520.00045.677

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Gamba
mana_regenMana668.39252170.47100.00%377.28227225.0947.40%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 840.56 843.20 227229.4 49207.0 43654.4 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Gamba
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 25.1334560.331375.001375.0160.28
Flame ShockMana 11.438574.96750.00285.8552.72
Frost ShockMana 16.598293.23500.00499.9836.85
Ice StrikeMana 20.2233356.791650.001649.9812.49
Lava LashMana 18.567425.57400.00400.0053.47
Lightning BoltMana 16.748368.48500.00499.99100.09
StormstrikeMana 122.52122523.801000.001332.7918.56
SunderingMana 6.3719110.253000.003000.0215.80

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Gamba Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Gamba Damage Per Second
Count 7499
Mean 46963.78
Minimum 35556.61
Maximum 65817.41
Spread ( max - min ) 30260.80
Range [ ( max - min ) / 2 * 100% ] 32.22%
Standard Deviation 3820.2352
5th Percentile 41209.71
95th Percentile 53644.50
( 95th Percentile - 5th Percentile ) 12434.79
Mean Distribution
Standard Deviation 44.1152
95.00% Confidence Interval ( 46877.31 - 47050.24 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 255
0.1% Error 25419
0.1 Scale Factor Error with Delta=300 124585
0.05 Scale Factor Error with Delta=300 498338
0.01 Scale Factor Error with Delta=300 12458446
Priority Target DPS
PR_Shaman_Enhancement_Gamba Priority Target Damage Per Second
Count 7499
Mean 46963.78
Minimum 35556.61
Maximum 65817.41
Spread ( max - min ) 30260.80
Range [ ( max - min ) / 2 * 100% ] 32.22%
Standard Deviation 3820.2352
5th Percentile 41209.71
95th Percentile 53644.50
( 95th Percentile - 5th Percentile ) 12434.79
Mean Distribution
Standard Deviation 44.1152
95.00% Confidence Interval ( 46877.31 - 47050.24 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 255
0.1% Error 25419
0.1 Scale Factor Error with Delta=300 124585
0.05 Scale Factor Error with Delta=300 498338
0.01 Scale Factor Error with Delta=300 12458446
DPS(e)
PR_Shaman_Enhancement_Gamba Damage Per Second (Effective)
Count 7499
Mean 46963.78
Minimum 35556.61
Maximum 65817.41
Spread ( max - min ) 30260.80
Range [ ( max - min ) / 2 * 100% ] 32.22%
Damage
PR_Shaman_Enhancement_Gamba Damage
Count 7499
Mean 13222697.51
Minimum 8334276.59
Maximum 19240374.30
Spread ( max - min ) 10906097.71
Range [ ( max - min ) / 2 * 100% ] 41.24%
DTPS
PR_Shaman_Enhancement_Gamba Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Gamba Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Gamba Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Gamba Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Gamba Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Gamba Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_GambaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Gamba Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.48 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 14.89 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
G 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 27.36 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
K 12.88 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
L 2.59 ice_strike,if=buff.doom_winds.up
M 1.63 sundering,if=buff.doom_winds.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
N 1.31 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
0.00 frost_shock,if=buff.hailstorm.up
O 4.24 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
P 0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
Q 79.05 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 25.14 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
S 4.25 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
0.00 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
T 17.63 ice_strike
U 14.33 lava_lash
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
V 12.49 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 4.74 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
X 16.59 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Y 1.15 earth_elemental
Z 10.12 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGBKKKKKLKJMJFJNQRQQRQTUQVXQQQFQRQTUXQQQSQXYTUQQRQQXWFRQQTQUQQQRQQVQTUXZQRXZQFTUVQQRQGMKKKKKRQFOTVQQJJJJRJFJJTOQQRQXZVQTQQRQFUWQSQTQRQQQQQSQJFJJOQRQQQSQTXFOQRQDEGMXLKKRKQUVQXQJRFJTQSQRQOXZVQQTQQRQQFQQUQRQQTQSQWUQRQQTXZFQUVQQRTQQQQQQRQUQFGLKKKKJJRJFJJOJQQRQQQJJF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 2 augmentation PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_earth
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), maelstrom_weapon, elemental_chaos_earth
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), maelstrom_weapon, crumbling_power(20), elemental_chaos_earth
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry(2), maelstrom_weapon, crumbling_power(20), elemental_chaos_earth
0:00.866 default G doom_winds Fluffy_Pillow 40635.6/50000: 81% mana bloodlust, berserking, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), crumbling_power(19), spiraling_winds, elemental_chaos_earth
0:01.731 default B potion Fluffy_Pillow 42019.6/50000: 84% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), doom_winds, crumbling_power(19), spiraling_winds, elemental_chaos_earth
0:01.731 single K stormstrike Fluffy_Pillow 42019.6/50000: 84% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), doom_winds, crumbling_power(19), spiraling_winds, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.598 single K stormstrike Fluffy_Pillow 41406.8/50000: 83% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, crumbling_power(18), spiraling_winds, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.465 single K stormstrike Fluffy_Pillow 40794.0/50000: 82% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(17), spiraling_winds(2), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.332 single K stormstrike Fluffy_Pillow 41181.2/50000: 82% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(16), spiraling_winds(2), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.197 single K stormstrike Fluffy_Pillow 40565.2/50000: 81% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(15), spiraling_winds(3), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.064 single L ice_strike Fluffy_Pillow 40952.4/50000: 82% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(14), spiraling_winds(3), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.931 single K stormstrike Fluffy_Pillow 40689.6/50000: 81% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(13), spiraling_winds(4), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.797 single J windstrike Fluffy_Pillow 39075.2/50000: 78% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, crumbling_power(12), spiraling_winds(4), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.664 single M sundering Fluffy_Pillow 40462.4/50000: 81% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, crumbling_power(11), spiraling_winds(5), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.531 single J windstrike Fluffy_Pillow 38849.6/50000: 78% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, crumbling_power(10), spiraling_winds(5), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.397 default F feral_spirit Fluffy_Pillow 40235.2/50000: 80% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(6), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.263 single J windstrike Fluffy_Pillow 41620.8/50000: 83% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(6), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.131 single N flame_shock Fluffy_Pillow 43009.6/50000: 86% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(7), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.085 single Q stormstrike Fluffy_Pillow 43786.0/50000: 88% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(7), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.273 single R elemental_blast Fluffy_Pillow 44686.8/50000: 89% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(8), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.227 single Q stormstrike Fluffy_Pillow 44838.2/50000: 90% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(8), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.153 single Q stormstrike Fluffy_Pillow 45319.8/50000: 91% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(9), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.080 single R elemental_blast Fluffy_Pillow 45803.0/50000: 92% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, crumbling_power(2), spiraling_winds(9), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.006 single Q stormstrike Fluffy_Pillow 45909.6/50000: 92% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, crumbling_power, spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.933 single T ice_strike Fluffy_Pillow 46392.8/50000: 93% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.859 single U lava_lash Fluffy_Pillow 46224.4/50000: 92% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.785 single Q stormstrike Fluffy_Pillow 47306.0/50000: 95% mana bloodlust, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.712 single V lightning_bolt Fluffy_Pillow 47789.2/50000: 96% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.638 single X frost_shock Fluffy_Pillow 48770.8/50000: 98% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.563 single Q stormstrike Fluffy_Pillow 49750.8/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.490 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.442 single Q stormstrike Fluffy_Pillow 48523.2/50000: 97% mana bloodlust, flurry(3), elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon(8), spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.395 default F feral_spirit Fluffy_Pillow 49048.0/50000: 98% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.349 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.303 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.256 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.210 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:31.165 single U lava_lash Fluffy_Pillow 49878.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:32.118 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
0:33.073 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
0:34.024 single Q stormstrike Fluffy_Pillow 48521.6/50000: 97% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_earth
0:34.979 single Q stormstrike Fluffy_Pillow 49049.6/50000: 98% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_earth
0:35.933 single S lightning_bolt Fluffy_Pillow 49576.0/50000: 99% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_earth
0:36.887 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
0:37.841 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
0:38.794 single Y earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
0:39.748 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
0:40.702 single U lava_lash Fluffy_Pillow 49876.4/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:42.093 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(3), stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_earth
0:43.333 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(4), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_earth
0:44.573 single R elemental_blast Fluffy_Pillow 49984.0/50000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(10), ice_strike, elemental_chaos_earth
0:45.811 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:47.049 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:48.288 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:49.527 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:50.766 default F feral_spirit Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(5), sophic_devotion, elemental_chaos_earth
0:52.005 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), sophic_devotion, elemental_chaos_earth
0:53.243 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:54.480 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:55.718 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:56.956 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:58.195 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, sophic_devotion, elemental_chaos_earth
0:59.433 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_earth
1:00.672 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_air
1:01.872 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_air
1:03.070 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_air
1:04.270 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:05.470 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:06.670 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:07.869 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:09.069 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
1:10.270 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:11.470 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:12.669 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(4), elemental_chaos_air
1:13.869 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(6), elemental_chaos_air
1:15.070 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(7), elemental_chaos_air
1:16.269 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), elemental_chaos_air
1:17.470 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), elemental_chaos_air
1:18.669 Waiting     1.008 sec 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), elemental_chaos_air
1:19.677 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), elemental_chaos_air
1:21.051 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(3), elemental_chaos_air
1:22.252 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_air
1:23.452 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, elemental_chaos_air
1:24.654 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_air
1:25.854 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:27.054 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:28.254 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:29.454 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:30.653 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:32.068 single M sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), doom_winds, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:33.268 single K stormstrike Fluffy_Pillow 48920.0/50000: 98% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, elemental_chaos_air
1:34.469 single K stormstrike Fluffy_Pillow 49841.6/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, elemental_chaos_air
1:35.669 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, elemental_chaos_air
1:36.871 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, elemental_chaos_air
1:38.071 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, elemental_chaos_air
1:39.271 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(10), spiraling_winds, elemental_chaos_air
1:40.473 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_air
1:41.639 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_air
1:42.805 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_air
1:43.970 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_air
1:45.135 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(4), elemental_chaos_air
1:46.300 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(5), elemental_chaos_air
1:47.465 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(5), elemental_chaos_air
1:48.632 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, spiraling_winds(6), elemental_chaos_air
1:49.799 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_air
1:51.000 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_air
1:52.200 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air
1:53.400 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air
1:54.600 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_air
1:55.799 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_air
1:56.999 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
1:58.201 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
1:59.401 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
2:00.601 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
2:01.801 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
2:03.001 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
2:04.201 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_air
2:05.403 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
2:06.567 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
2:07.731 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
2:08.899 Waiting     1.505 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
2:10.404 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_air
2:11.570 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_air
2:12.735 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
2:13.899 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:15.065 single Q stormstrike Fluffy_Pillow 49865.6/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:16.266 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(5), maelstrom_weapon(8), ice_strike, elemental_chaos_air
2:17.466 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:18.667 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:19.867 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:21.066 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:22.267 single Q stormstrike Fluffy_Pillow 48921.6/50000: 98% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_air
2:23.467 single S lightning_bolt Fluffy_Pillow 48841.6/50000: 98% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_air
2:24.667 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:25.868 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
2:27.068 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:28.270 single R elemental_blast Fluffy_Pillow 48923.2/50000: 98% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:29.471 single Q stormstrike Fluffy_Pillow 49469.8/50000: 99% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:30.671 single Q stormstrike Fluffy_Pillow 49389.8/50000: 99% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:31.871 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:33.072 single Q stormstrike Fluffy_Pillow 49921.6/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
2:34.272 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds, elemental_chaos_air
2:35.473 single S lightning_bolt Fluffy_Pillow 49921.6/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(10), ice_strike, spiraling_winds, elemental_chaos_air
2:36.672 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_air
2:37.871 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, forceful_winds, stormbringer, maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_air
2:39.071 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), forceful_winds(3), maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, elemental_chaos_air
2:40.272 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, elemental_chaos_air
2:41.472 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, elemental_chaos_air
2:42.674 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, elemental_chaos_air
2:43.874 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, elemental_chaos_air
2:45.074 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, elemental_chaos_air
2:46.274 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, elemental_chaos_air
2:47.476 single Q stormstrike Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, elemental_chaos_air
2:48.676 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, elemental_chaos_air
2:49.876 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, elemental_chaos_air
2:51.078 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_air
2:52.278 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
2:53.478 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
2:54.679 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
2:55.879 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_air
2:57.080 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_air
2:58.282 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_air
2:59.484 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
3:00.684 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
3:00.684 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(20), elemental_chaos_fire
3:00.684 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(20), elemental_chaos_fire
3:01.992 single M sundering Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), doom_winds, legacy_of_the_frost_witch, crumbling_power(20), elemental_chaos_fire
3:03.119 single X frost_shock Fluffy_Pillow 48803.2/50000: 98% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, crumbling_power(19), elemental_chaos_fire
3:04.245 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), doom_winds, crumbling_power(18), elemental_chaos_fire
3:05.371 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, crumbling_power(17), elemental_chaos_fire
3:06.495 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, ice_strike, crumbling_power(16), elemental_chaos_fire
3:07.620 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(9), doom_winds, ice_strike, crumbling_power(15), elemental_chaos_fire
3:08.746 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_fire
3:09.840 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_fire
3:10.935 single U lava_lash Fluffy_Pillow 49752.0/50000: 100% mana berserking, flurry(3), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_fire
3:12.028 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds, elemental_chaos_fire
3:13.122 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(3), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(2), elemental_chaos_fire
3:14.324 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(2), elemental_chaos_fire
3:15.527 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(3), elemental_chaos_fire
3:16.732 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, forceful_winds(4), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(3), elemental_chaos_fire
3:17.934 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds(5), maelstrom_weapon(7), static_accumulation, crumbling_power(6), spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
3:19.171 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(2), static_accumulation, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire
3:20.410 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire
3:21.647 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
3:22.886 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
3:24.126 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(7), forgestorm_ignited, elemental_chaos_fire
3:25.366 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_fire
3:26.603 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_fire
3:27.841 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_fire
3:29.078 single O lava_lash Fluffy_Pillow 48979.2/50000: 98% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_fire
3:30.317 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
3:31.556 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
3:32.795 Waiting     0.188 sec 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_fire
3:32.983 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:34.221 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:35.458 single Q stormstrike Fluffy_Pillow 47979.2/50000: 96% mana flurry, elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:36.697 single T ice_strike Fluffy_Pillow 48961.6/50000: 98% mana forceful_winds(4), maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_fire
3:37.935 single Q stormstrike Fluffy_Pillow 49292.4/50000: 99% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(6), ice_strike, forgestorm_ignited, elemental_chaos_fire
3:39.174 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, stormbringer, maelstrom_weapon(7), ice_strike, forgestorm_ignited, elemental_chaos_fire
3:40.413 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(8), ice_strike, forgestorm_ignited, elemental_chaos_fire
3:41.654 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
3:42.892 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
3:44.131 default F feral_spirit Fluffy_Pillow 49982.4/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
3:45.370 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:46.609 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_fire
3:47.848 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, elemental_chaos_fire
3:49.086 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(8), elemental_chaos_fire
3:50.324 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_fire
3:51.563 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, legacy_of_the_frost_witch, elemental_chaos_fire
3:52.799 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
3:54.035 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_fire
3:55.273 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:56.511 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_fire
3:57.752 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:58.991 single W sundering Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:00.229 single U lava_lash Fluffy_Pillow 48963.2/50000: 98% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:01.430 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:02.630 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(8), ice_strike, sophic_devotion, elemental_chaos_air
4:03.830 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:04.996 single Q stormstrike Fluffy_Pillow 49865.6/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:06.162 single T ice_strike Fluffy_Pillow 49731.2/50000: 99% mana flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:07.327 single X frost_shock Fluffy_Pillow 49945.2/50000: 100% mana elemental_blast_haste, forceful_winds(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:08.493 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(4), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:09.658 Waiting     0.289 sec 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:09.947 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:11.296 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:12.464 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:13.628 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(8), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:14.829 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:16.027 single Q stormstrike Fluffy_Pillow 49916.8/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
4:17.227 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
4:18.426 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
4:19.627 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, forgestorm_ignited, elemental_chaos_air
4:20.827 single Q stormstrike Fluffy_Pillow 49920.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_air
4:22.028 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, sophic_devotion, elemental_chaos_air
4:23.229 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_air
4:24.429 single Q stormstrike Fluffy_Pillow 49920.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_air
4:25.632 single Q stormstrike Fluffy_Pillow 49844.8/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_air
4:26.832 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_air
4:28.034 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:29.202 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:30.369 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:31.535 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:32.702 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), sophic_devotion, elemental_chaos_air
4:33.866 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), doom_winds, sophic_devotion, elemental_chaos_air
4:35.030 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, sophic_devotion, elemental_chaos_air
4:36.195 single K stormstrike Fluffy_Pillow 49864.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_air
4:37.359 single K stormstrike Fluffy_Pillow 47726.4/50000: 95% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_air
4:38.561 single K stormstrike Fluffy_Pillow 46649.6/50000: 93% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_air
4:39.761 single J windstrike Fluffy_Pillow 47569.6/50000: 95% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, elemental_chaos_air
4:40.961 single J windstrike Fluffy_Pillow 49489.6/50000: 99% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:42.161 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:43.362 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:44.564 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:45.765 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:46.968 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:48.170 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:49.370 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:50.571 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:51.772 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:52.972 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:54.173 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:55.338 single Q stormstrike Fluffy_Pillow 49864.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:56.502 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:57.668 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:58.833 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, spiraling_winds, sophic_devotion, elemental_chaos_air
5:00.000 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_frost

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 25.38% 21.55% 3663
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Gamba"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Phys : 44744 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
44743.9 44743.9 49.4 / 0.110% 8426.3 / 18.8% 49.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
847.2 844.3 Mana 1.92% 52.1 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Phys 44744
Ascendance 0 (324) 0.0% (0.7%) 2.0 180.42sec 47955 44301

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0825 0.0000 0.00 0.00 0.00% 44300.58 44300.58

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [G]:2.00
  • if_expr:(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
    Ascendance (_damage) 324 0.7% 2.0 180.42sec 47955 0 Direct 2.0 40298 81037 47956 18.8% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 95910.76 95910.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.20% 1.62 0 2 40297.54 35123 52193 38753.44 0 52193 65448 65448 0.00%
crit 18.80% 0.38 0 2 81037.18 70246 104386 27352.43 0 104386 30463 30463 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 77 0.2% 3.7 90.47sec 6148 5624 Direct 3.7 6148 0 6148 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0933 0.0000 22888.50 32698.70 30.00% 5623.71 5623.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.72 3 4 6147.70 3670 9854 6166.58 4974 8244 22889 32699 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.72
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6436 14.4% 24.7 11.69sec 78089 65878 Direct 24.7 64599 129538 78118 20.8% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.74 24.73 0.00 0.00 0.00 1.1854 0.0000 1931687.66 1931687.66 0.00% 65878.44 65878.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.18% 19.58 10 29 64598.67 43655 132838 64560.79 52761 77504 1264772 1264772 0.00%
crit 20.82% 5.15 0 13 129537.76 87310 262943 128963.68 0 203140 666916 666916 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [S]:24.74
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
Flame Shock 1501 3.4% 32.9 8.83sec 13683 27706 Direct 32.9 2688 5394 3154 17.2% 0.0%
Periodic 183.2 1611 3235 1893 17.3% 0.0% 95.5%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.93 32.93 183.20 183.20 31.78 0.4939 1.5636 450582.22 450582.22 0.00% 1488.50 27705.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 27.25 13 43 2687.57 2271 4687 2686.95 2420 3049 73236 73236 0.00%
crit 17.25% 5.68 0 18 5394.37 4543 9237 5376.24 0 7887 30637 30637 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.67% 151.44 105 198 1610.96 2 2788 1610.54 1471 1801 243968 243968 0.00%
crit 17.33% 31.76 12 57 3235.24 19 5512 3234.84 2833 3784 102741 102741 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [O]:1.15
  • if_expr:!ticking
    single
    [b]:12.68
Flametongue Weapon 0 (1451) 0.0% (3.2%) 1.0 0.00sec 434592 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1451 3.2% 1084.6 0.69sec 401 0 Direct 1084.6 342 685 401 17.2% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1084.56 1084.56 0.00 0.00 0.00 0.0000 0.0000 434591.84 434591.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.76% 897.62 604 1211 341.52 277 570 341.60 314 378 306557 306557 0.00%
crit 17.24% 186.94 112 282 684.91 554 1140 685.15 624 767 128035 128035 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1104 2.5% 28.7 7.64sec 11534 0 Direct 28.7 9805 19713 11534 17.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.75 28.75 0.00 0.00 0.00 0.0000 0.0000 331573.85 331573.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.55% 23.73 2 64 9805.31 9732 10030 9805.18 9732 10030 232691 232691 0.00%
crit 17.45% 5.02 0 22 19712.92 19463 20059 19289.35 0 20059 98883 98883 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1189 2.7% 20.0 13.82sec 17845 15017 Direct 20.0 15171 30585 17845 17.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 0.00 1.1884 0.0000 357265.67 357265.67 0.00% 15016.84 15016.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 16.55 6 30 15170.63 7338 29843 15204.91 12031 19233 251022 251022 0.00%
crit 17.35% 3.47 0 11 30584.59 14677 58370 29769.08 0 50791 106244 106244 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [Z]:20.02
Ice Strike 1432 3.2% 21.2 14.15sec 20274 17358 Direct 21.2 17256 34591 20274 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.19 21.19 0.00 0.00 0.00 1.1681 0.0000 429706.87 429706.87 0.00% 17357.69 17357.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 17.50 8 26 17256.25 14382 29675 17251.23 15354 19484 302062 302062 0.00%
crit 17.41% 3.69 0 12 34591.08 28763 57195 33885.60 0 53394 127645 127645 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:2.36
  • if_expr:buff.doom_winds.up
    single
    [V]:18.84
Lava Lash 1339 3.0% 19.1 14.97sec 21050 17757 Direct 19.1 17911 35940 21050 17.4% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.09 19.09 0.00 0.00 0.00 1.1855 0.0000 401904.96 401904.96 0.00% 17757.48 17757.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 15.77 7 25 17910.70 15146 30954 17901.98 16036 20687 282417 282417 0.00%
crit 17.41% 3.32 0 11 35939.85 30292 62504 34794.44 0 52083 119488 119488 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [P]:2.58
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [W]:16.51
Lightning Bolt 2936 6.6% 18.1 15.44sec 48746 41271 Direct 18.1 40020 80342 48746 21.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.10 18.10 0.00 0.00 0.00 1.1812 0.0000 882413.20 882413.20 0.00% 41270.90 41270.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.36% 14.18 3 28 40020.26 27610 88620 40018.15 31624 51297 567679 567679 0.00%
crit 21.64% 3.92 0 12 80341.73 55220 172862 79046.94 0 144214 314734 314734 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [T]:4.05
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [X]:14.05
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1495 3.4% 172.1 1.93sec 2610 1467 Direct 172.1 2581 5190 2610 17.3% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 172.06 172.06 0.00 0.00 0.00 1.7797 0.0000 449091.71 641575.95 30.00% 1466.58 1466.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.24% 113.98 68 161 2581.07 2257 4290 2579.80 2351 2855 294184 420274 30.00%
crit 17.35% 29.85 10 57 5189.84 4513 8588 5186.83 4610 5926 154908 221302 30.00%
miss 16.41% 28.23 10 50 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 758 1.7% 173.8 2.01sec 1311 737 Direct 173.8 1295 2603 1311 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 173.79 173.79 0.00 0.00 0.00 1.7792 0.0000 227792.90 325426.72 30.00% 736.70 736.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.20% 115.06 73 165 1294.82 1128 2169 1294.23 1177 1443 148978 212832 30.00%
crit 17.43% 30.28 10 56 2602.54 2257 4339 2601.22 2350 2960 78815 112595 30.00%
miss 16.37% 28.45 10 50 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:2
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (6835) 0.0% (15.3%) 88.2 3.21sec 23282 19633

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 88.23 0.00 0.00 0.00 0.00 1.1859 0.0000 0.00 0.00 0.00% 19632.74 19632.74

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:5.67
  • if_expr:buff.doom_winds.up
    single
    [R]:69.90
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    single
    [U]:12.66
    Stormstrike (_mh) 3698 (4556) 8.3% (10.2%) 117.7 3.21sec 11631 0 Direct 117.7 (175.5) 8035 16142 9441 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.73 117.73 0.00 0.00 0.00 0.0000 0.0000 1111413.65 1587774.26 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 97.31 50 157 8034.68 2623 20343 8044.60 6816 9770 781895 1117021 30.00%
crit 17.34% 20.41 4 43 16142.25 5246 40096 16158.42 10422 22454 329519 470753 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 857 1.9% 57.8 5.46sec 4463 0 Direct 57.8 4463 0 4463 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.77 57.77 0.00 0.00 0.00 0.0000 0.0000 257824.49 257824.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 57.77 22 111 4463.21 1152 18569 4472.21 3384 5888 257824 257824 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 1850 (2279) 4.2% (5.1%) 117.7 3.21sec 5819 0 Direct 117.7 (175.5) 4016 8083 4723 17.4% (11.7%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.73 117.73 0.00 0.00 0.00 0.0000 0.0000 555982.54 794281.02 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 97.28 54 155 4016.11 1312 10172 4020.99 3370 4864 390678 558126 30.00%
crit 17.37% 20.45 5 43 8083.08 2623 20134 8090.09 5436 10934 165305 236155 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 429 1.0% 57.8 5.46sec 2234 0 Direct 57.8 2234 0 2234 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.77 57.77 0.00 0.00 0.00 0.0000 0.0000 129031.06 129031.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 57.77 22 111 2233.63 576 9181 2238.20 1703 2953 129031 129031 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 989 2.2% 6.5 46.72sec 45316 38762 Direct 6.5 38535 77399 45317 17.4% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.54 6.54 0.00 0.00 0.00 1.1692 0.0000 296567.14 296567.14 0.00% 38761.88 38761.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.55% 5.40 1 9 38535.11 25567 82443 38538.57 26736 54189 208184 208184 0.00%
crit 17.45% 1.14 0 6 77399.25 51135 163043 54627.44 0 158883 88383 88383 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [N]:0.80
  • if_expr:buff.doom_winds.up
    single
    [Y]:5.75
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (6859) 0.0% (15.3%) 1.0 0.00sec 2050605 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6859 15.3% 408.7 2.45sec 5017 0 Direct 408.7 4285 8560 5017 17.1% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 408.71 408.71 0.00 0.00 0.00 0.0000 0.0000 2050605.16 2929510.64 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.88% 338.74 209 488 4285.45 1423 11363 4289.30 3673 5185 1451645 2073832 30.00%
crit 17.12% 69.97 30 117 8559.96 2845 22725 8565.94 6729 10978 598960 855679 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 449 1.0% 24.1 10.18sec 5524 4069 Direct 24.1 4568 9187 5524 20.7% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.07 24.07 0.00 0.00 0.00 1.3576 0.0000 132991.11 132991.11 0.00% 4069.37 4069.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.29% 19.09 10 28 4567.89 3559 6128 4568.16 4126 5533 87194 87194 0.00%
crit 20.71% 4.99 0 14 9186.74 7118 12257 9136.74 0 11982 45797 45797 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 236 0.5% 25.2 9.69sec 2767 2027 Direct 25.2 2289 4603 2767 20.6% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.23 25.23 0.00 0.00 0.00 1.3653 0.0000 69814.14 69814.14 0.00% 2026.65 2026.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 20.02 9 30 2289.20 1780 3064 2289.23 2061 2739 45834 45834 0.00%
crit 20.65% 5.21 0 16 4602.79 3626 6128 4588.65 0 5962 23980 23980 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (6667) 0.0% (14.7%) 20.6 9.82sec 95559 97393

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.65 0.00 0.00 0.00 0.00 0.9812 0.0000 0.00 0.00 0.00% 97393.32 97393.32

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [K]:20.60
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [Q]:0.05
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1839 (2249) 4.1% (5.0%) 27.5 9.82sec 24160 0 Direct 27.5 (39.3) 16894 33930 19756 16.8% (11.8%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.55 27.55 0.00 0.00 0.00 0.0000 0.0000 544237.88 544237.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.20% 22.92 11 40 16893.81 4954 31200 17002.35 12891 24038 387207 387207 0.00%
crit 16.80% 4.63 0 15 33930.42 9908 62071 33861.87 0 59021 157031 157031 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 410 0.9% 11.8 17.65sec 10313 0 Direct 11.8 10314 0 10314 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.76 11.76 0.00 0.00 0.00 0.0000 0.0000 121302.87 121302.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.76 4 21 10313.65 2671 27906 10295.10 7464 16235 121303 121303 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 918 (1123) 2.0% (2.5%) 27.5 9.82sec 12062 0 Direct 27.5 (39.3) 8450 16933 9865 16.7% (11.7%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.55 27.55 0.00 0.00 0.00 0.0000 0.0000 271770.42 271770.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.32% 22.95 11 38 8450.15 2477 15520 8505.56 6060 11886 193952 193952 0.00%
crit 16.68% 4.60 0 13 16933.38 4961 31200 16869.41 0 29803 77818 77818 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 204 0.5% 11.8 17.65sec 5144 0 Direct 11.8 5144 0 5144 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.76 11.76 0.00 0.00 0.00 0.0000 0.0000 60507.46 60507.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.76 4 21 5144.48 1335 13699 5136.79 3640 8178 60507 60507 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3295 7.3% 20.6 9.85sec 47346 0 Direct 20.6 39167 78744 47346 20.7% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.60 20.60 0.00 0.00 0.00 0.0000 0.0000 975467.52 975467.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.33% 16.35 7 24 39166.70 18281 56318 39157.74 33868 48350 640187 640187 0.00%
crit 20.67% 4.26 0 12 78743.70 37293 112635 78000.22 0 105558 335281 335281 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 401 / 83
melee 401 0.2% 39.4 2.39sec 629 407 Direct 39.4 537 1073 629 17.2% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.37 39.37 0.00 0.00 0.00 1.5444 0.0000 24775.55 35394.54 30.00% 407.49 407.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 32.58 21 56 536.87 475 892 536.38 475 676 17490 24987 30.00%
crit 17.25% 6.79 0 18 1072.82 950 1582 1071.18 0 1401 7285 10408 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4148 / 2583
melee 4148 5.8% 343.0 1.73sec 2252 2009 Direct 343.0 1922 3838 2252 17.2% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 343.02 343.02 0.00 0.00 0.00 1.1209 0.0000 772381.40 1103430.13 30.00% 2008.91 2008.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.80% 284.01 212 364 1922.10 1588 3071 1922.46 1764 2159 545904 779883 30.00%
crit 17.20% 59.01 30 98 3838.11 3176 6141 3839.08 3448 4414 226477 323547 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Phys
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.70sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 306.55sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.14 0.00 0.00 0.00 0.00 1.0079 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [a]:1.14
Feral Spirit 13.5 23.98sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.53 0.00 0.00 0.00 0.00 1.1403 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:13.53
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.50
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 93.92% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 180.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.2s / 182.6s
  • trigger_min/max:180.2s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.6sec 5.5sec 18.8sec 12.73% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.4s
  • trigger_min/max:0.0s / 164.2s
  • trigger_pct:100.00%
  • duration_min/max:17.1s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.72%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.70%
  • crumbling_power_7:0.70%
  • crumbling_power_8:0.68%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.71%
  • crumbling_power_18:1.24%
  • crumbling_power_19:0.84%
  • crumbling_power_20:0.02%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.5sec 90.5sec 7.9sec 9.85% 12.51% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.5s
  • trigger_min/max:90.0s / 92.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_1:9.85%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Earthen Weapon 13.5 0.0 26.0sec 22.8sec 17.5sec 62.27% 100.00% 0.0 (0.0) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.5s / 69.9s
  • trigger_min/max:6.2s / 44.8s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 53.8s

Stack Uptimes

  • earthen_weapon_2:58.11%
  • earthen_weapon_4:4.16%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.2 1.0 37.7sec 32.8sec 10.8sec 25.96% 0.00% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 293.5s
  • trigger_min/max:1.7s / 293.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.5s

Stack Uptimes

  • elemental_blast_critical_strike_1:25.96%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.3 0.9 37.1sec 32.4sec 10.7sec 26.20% 0.00% 0.9 (0.9) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 260.5s
  • trigger_min/max:1.7s / 260.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.9s

Stack Uptimes

  • elemental_blast_haste_1:26.20%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.3 1.0 37.3sec 32.4sec 10.8sec 26.22% 0.00% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 293.5s
  • trigger_min/max:1.7s / 288.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.2s

Stack Uptimes

  • elemental_blast_mastery_1:26.22%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.3sec 98.1sec 58.3sec 25.26% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 334.1s

Stack Uptimes

  • elemental_chaos_air_1:25.26%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.1sec 99.3sec 58.0sec 25.29% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.5s

Stack Uptimes

  • elemental_chaos_earth_1:25.29%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 122.9sec 98.4sec 58.3sec 24.84% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 350.8s

Stack Uptimes

  • elemental_chaos_fire_1:24.84%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 122.3sec 97.9sec 57.6sec 24.62% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:24.62%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 308.1sec 0.0sec 27.4sec 13.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 331.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.41%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Feral Spirit 10.7 2.9 29.6sec 24.0sec 17.5sec 62.28% 0.00% 53.3 (53.3) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 69.9s
  • trigger_min/max:6.2s / 44.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.8s

Stack Uptimes

  • feral_spirit_1:62.28%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 44.0 367.7 6.9sec 0.7sec 5.7sec 84.11% 90.44% 367.7 (871.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 59.4s
  • trigger_min/max:0.0s / 19.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.4s

Stack Uptimes

  • flurry_1:20.32%
  • flurry_2:33.24%
  • flurry_3:30.55%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 119.0 17.8sec 2.2sec 14.6sec 84.01% 100.00% 57.6 (57.6) 16.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 48.1s
  • trigger_min/max:0.0s / 48.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:15.43%
  • forceful_winds_2:14.33%
  • forceful_winds_3:12.70%
  • forceful_winds_4:10.54%
  • forceful_winds_5:31.01%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.6sec 46.5sec 12.9sec 19.47% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 210.8s
  • trigger_min/max:0.2s / 210.8s
  • trigger_pct:98.90%
  • duration_min/max:0.0s / 52.3s

Stack Uptimes

  • forgestorm_ignited_1:19.47%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.4 0.8 14.7sec 14.1sec 7.1sec 48.07% 76.95% 0.8 (0.8) 4.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.9s / 65.0s
  • trigger_min/max:8.4s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.7s

Stack Uptimes

  • ice_strike_1:48.07%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 24.1 16.1 12.5sec 7.4sec 7.1sec 57.13% 0.00% 16.1 (16.1) 23.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 57.4s
  • trigger_min/max:0.8s / 37.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.1s

Stack Uptimes

  • legacy_of_the_frost_witch_1:57.13%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 46.8 381.2 6.5sec 1.4sec 5.5sec 85.57% 100.00% 43.2 (47.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 37.1s
  • trigger_min/max:0.0s / 9.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.9s

Stack Uptimes

  • maelstrom_weapon_1:9.68%
  • maelstrom_weapon_2:11.36%
  • maelstrom_weapon_3:13.11%
  • maelstrom_weapon_4:13.65%
  • maelstrom_weapon_5:8.81%
  • maelstrom_weapon_6:7.13%
  • maelstrom_weapon_7:5.27%
  • maelstrom_weapon_8:4.29%
  • maelstrom_weapon_9:3.43%
  • maelstrom_weapon_10:8.84%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.8sec 45.5sec 16.5sec 23.75% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 216.5s
  • trigger_min/max:0.0s / 216.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.2s

Stack Uptimes

  • sophic_devotion_1:23.75%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.9sec 45.7sec 32.1sec 38.14% 0.00% 25.5 (25.5) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 293.2s
  • trigger_min/max:0.1s / 210.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 186.4s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.28%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.69%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 59.7 18.8 5.0sec 3.8sec 1.2sec 23.14% 54.41% 18.8 (18.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 75.5s
  • trigger_min/max:0.0s / 75.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.5s

Stack Uptimes

  • stormbringer_1:23.14%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.3 33.0 66.0 17.9s 15.0s 51.3s
Windfury-ForcefulWinds: 2 50.5 30.0 69.0 18.1s 0.9s 67.5s
Windfury-ForcefulWinds: 3 48.7 27.0 66.0 18.8s 0.6s 79.3s
Windfury-ForcefulWinds: 4 45.1 18.0 72.0 20.4s 1.0s 109.7s
Windfury-ForcefulWinds: 5 213.1 114.0 366.0 4.7s 0.0s 89.8s
windfury_totem_extra_attack_mh 27.8 9.0 52.0 10.6s 1.2s 142.6s
windfury_totem_extra_attack_oh 28.2 11.0 51.0 10.4s 0.1s 112.7s
Windfury: Unruly Winds 136.2 88.0 196.0 2.5s 0.0s 48.1s
Maelstrom Weapon: Feral Spirit 71.2 49.0 95.0 4.2s 0.0s 29.8s
Maelstrom Weapon: Elemental Assault 108.9 76.0 149.0 2.7s 0.8s 11.0s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.4s
Stormflurry 36.4 8.0 69.0 10.7s 0.8s 140.6s
Maelstrom Weapon: Windfury Attack 81.8 37.0 132.0 4.7s 0.0s 75.3s
Maelstrom Weapon: main_hand 28.7 10.0 56.0 10.2s 1.3s 115.4s
Maelstrom Weapon: Windlash 4.9 0.0 14.0 43.4s 1.2s 194.1s
Maelstrom Weapon: offhand 29.1 12.0 52.0 10.1s 1.3s 122.6s
Maelstrom Weapon: Windlash Off-Hand 5.1 0.0 13.0 42.0s 1.2s 194.1s
Maelstrom Weapon: Doom Winds 0.7 0.0 4.0 134.3s 90.0s 273.4s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 102.8s 40.0s 331.9s
Maelstrom Weapon: Windstrike 5.5 0.0 15.0 40.0s 0.8s 193.0s
Maelstrom Weapon: Windstrike Off-Hand 5.5 0.0 18.0 39.8s 0.8s 193.9s
Maelstrom Weapon: Lava Lash 3.8 0.0 12.0 56.5s 9.0s 315.4s
Maelstrom Weapon: Ice Strike 4.2 0.0 13.0 55.2s 8.8s 340.9s
Maelstrom Weapon: Stormstrike 23.5 7.0 47.0 12.5s 0.9s 141.5s
Maelstrom Weapon: Stormstrike Off-Hand 23.7 6.0 47.0 12.4s 0.9s 149.9s
Flametongue: Windfury Attack 408.7 264.0 588.0 2.5s 0.0s 48.1s
Stormbringer: Windfury Attack 43.0 16.0 76.0 7.9s 0.0s 100.5s
Flametongue: main_hand 143.8 93.0 193.0 2.5s 1.3s 27.3s
Windfury: main_hand 48.9 21.0 82.0 6.3s 1.3s 80.6s
Flametongue: Windlash 24.1 19.0 33.0 10.2s 1.2s 170.3s
Windfury: Windlash 16.3 10.0 25.0 14.7s 1.2s 176.7s
Flametongue: offhand 145.3 85.0 198.0 2.5s 1.3s 30.3s
Flametongue: Windlash Off-Hand 25.2 21.0 32.0 9.7s 1.2s 168.6s
Flametongue: Sundering 6.5 4.0 9.0 46.7s 40.0s 120.7s
Stormbringer: Sundering 0.7 0.0 5.0 107.1s 40.0s 339.7s
Windfury: Sundering 2.5 0.0 7.0 87.5s 40.0s 348.6s
Flametongue: Windstrike 27.5 17.0 45.0 9.8s 0.8s 171.3s
Stormbringer: Windstrike 2.9 0.0 11.0 57.2s 0.8s 193.8s
Windfury: Windstrike 19.2 10.0 34.0 13.6s 0.8s 177.3s
Flametongue: Windstrike Off-Hand 27.5 17.0 45.0 9.8s 0.8s 171.3s
Stormbringer: Windstrike Off-Hand 2.9 0.0 12.0 58.3s 0.8s 193.6s
Flametongue: Lava Lash 19.1 12.0 25.0 15.0s 9.0s 51.6s
Stormbringer: Lava Lash 2.0 0.0 9.0 75.8s 9.0s 322.7s
Flametongue: Ice Strike 21.2 14.0 28.0 14.1s 8.4s 56.4s
Stormbringer: Ice Strike 2.2 0.0 11.0 75.3s 8.8s 330.2s
Windfury: Ice Strike 8.1 1.0 17.0 36.2s 8.4s 270.4s
Flametongue: Stormstrike 117.7 67.0 183.0 3.2s 0.9s 27.5s
Stormbringer: Stormstrike 12.4 1.0 31.0 21.9s 0.9s 254.5s
Windfury: Stormstrike 41.2 11.0 80.0 7.7s 0.9s 111.8s
Flametongue: Stormstrike Off-Hand 117.7 67.0 183.0 3.2s 0.9s 27.5s
Stormbringer: Stormstrike Off-Hand 12.5 1.0 32.0 21.6s 0.9s 206.3s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 24.19% 16.29% 31.15% 0.7s 0.0s 18.2s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.8000.0011.4569.2913.41415.993
Ascendance0.5560.0012.3570.4280.0002.357
Doom Winds0.5810.0012.5301.2790.2104.655
Sundering7.1090.00180.69737.1443.135108.322
Windstrike0.8940.0013.77518.0549.18625.064
Lava Lash3.2110.00139.38756.37819.426112.014
Flame Shock16.6050.001213.842210.82694.346300.190
Ice Strike2.5670.00144.45649.64413.07199.300
Frost Shock9.3700.001113.972172.30356.847252.319
Elemental Blast3.4400.00121.4322.1470.00021.432
Stormstrike1.0470.0015.13388.07043.978137.942
Earth Elemental6.8950.01434.3660.8990.00034.366

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Phys
mana_regenMana674.92253305.61100.00%375.31226085.5947.16%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 844.35 847.24 226087.0 49132.8 43000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Phys
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 24.7434013.331375.001375.0056.79
Flame ShockMana 13.8410377.22750.00315.1443.42
Frost ShockMana 20.0210009.87500.00499.9835.69
Ice StrikeMana 21.1934971.161650.001650.0112.29
Lava LashMana 19.097636.85400.00399.9952.63
Lightning BoltMana 18.109051.13500.00500.0097.49
StormstrikeMana 117.73117729.771000.001334.2817.45
SunderingMana 6.5419633.783000.003000.0615.10

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Phys Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Phys Damage Per Second
Count 7499
Mean 44743.90
Minimum 37875.30
Maximum 54742.56
Spread ( max - min ) 16867.25
Range [ ( max - min ) / 2 * 100% ] 18.85%
Standard Deviation 2183.9640
5th Percentile 41400.34
95th Percentile 48439.99
( 95th Percentile - 5th Percentile ) 7039.65
Mean Distribution
Standard Deviation 25.2199
95.00% Confidence Interval ( 44694.47 - 44793.33 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 92
0.1% Error 9153
0.1 Scale Factor Error with Delta=300 40717
0.05 Scale Factor Error with Delta=300 162868
0.01 Scale Factor Error with Delta=300 4071690
Priority Target DPS
PR_Shaman_Enhancement_Phys Priority Target Damage Per Second
Count 7499
Mean 44743.90
Minimum 37875.30
Maximum 54742.56
Spread ( max - min ) 16867.25
Range [ ( max - min ) / 2 * 100% ] 18.85%
Standard Deviation 2183.9640
5th Percentile 41400.34
95th Percentile 48439.99
( 95th Percentile - 5th Percentile ) 7039.65
Mean Distribution
Standard Deviation 25.2199
95.00% Confidence Interval ( 44694.47 - 44793.33 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 92
0.1% Error 9153
0.1 Scale Factor Error with Delta=300 40717
0.05 Scale Factor Error with Delta=300 162868
0.01 Scale Factor Error with Delta=300 4071690
DPS(e)
PR_Shaman_Enhancement_Phys Damage Per Second (Effective)
Count 7499
Mean 44743.90
Minimum 37875.30
Maximum 54742.56
Spread ( max - min ) 16867.25
Range [ ( max - min ) / 2 * 100% ] 18.85%
Damage
PR_Shaman_Enhancement_Phys Damage
Count 7499
Mean 12592925.57
Minimum 9303340.70
Maximum 16342950.78
Spread ( max - min ) 7039610.08
Range [ ( max - min ) / 2 * 100% ] 27.95%
DTPS
PR_Shaman_Enhancement_Phys Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Phys Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Phys Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Phys Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Phys Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Phys Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_PhysTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Phys Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.50 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 13.53 feral_spirit
G 2.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
H 3.72 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
K 20.60 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
L 5.67 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
M 2.36 ice_strike,if=buff.doom_winds.up
N 0.80 sundering,if=buff.doom_winds.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
O 1.15 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
0.00 frost_shock,if=buff.hailstorm.up
P 2.58 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
Q 0.05 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 69.90 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
S 24.74 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
T 4.05 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
U 12.66 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
V 18.84 ice_strike
W 16.51 lava_lash
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
X 14.05 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 5.75 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
Z 20.02 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
a 1.14 earth_elemental
b 12.68 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ABCDFGEHKMKKKKKKFKOKKSKVSRRWRRFTRVYZSRWZabRVRXRZWSRRZVbUSWZbUFVZbRSRWYZbRVXRRSWZbUUTRVZFWRHLSLLLLRSRVWYUFRRRRRRSRVWZbUSRRZbVSRRRWFXZRVbYSRWRXRZVbUZWSUZbVUSFRWZbDGEKHKKKKFKKKKVKRPRRRRFRRRSRVSRWXYZUSRVZbWUXZbFRRSRVRRRRSRWRXRFVRXRYWZSRbVRSRZHWLLTLFRRRRSRVWZXRRSZbBY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 2 augmentation PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 7 trinket1_is_weird PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 8 trinket2_is_weird PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default B potion Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_frost
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, crumbling_power(20), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:00.954 default G ascendance Fluffy_Pillow 40776.4/50000: 82% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:01.908 default E berserking Fluffy_Pillow 42302.8/50000: 85% mana bloodlust, ascendance, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, crumbling_power(18), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:01.908 default H doom_winds Fluffy_Pillow 42302.8/50000: 85% mana bloodlust, berserking, ascendance, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, crumbling_power(18), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:02.774 single K windstrike Fluffy_Pillow 43688.4/50000: 87% mana bloodlust, berserking, ascendance, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, doom_winds, crumbling_power(18), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:03.641 single M ice_strike Fluffy_Pillow 45075.6/50000: 90% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, doom_winds, crumbling_power(17), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:04.508 single K windstrike Fluffy_Pillow 44812.8/50000: 90% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, crumbling_power(16), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:05.374 single K windstrike Fluffy_Pillow 46198.4/50000: 92% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, crumbling_power(15), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:06.242 single K windstrike Fluffy_Pillow 47587.2/50000: 95% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.108 single K windstrike Fluffy_Pillow 48972.8/50000: 98% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:07.974 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:08.840 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:09.709 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:10.576 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:11.442 single O flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:12.309 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:13.175 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.041 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:14.995 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:15.949 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, legacy_of_the_frost_witch, crumbling_power(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:16.902 single S elemental_blast Fluffy_Pillow 49874.8/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:17.856 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:18.811 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:19.766 single W lava_lash Fluffy_Pillow 48528.0/50000: 97% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:20.719 single R stormstrike Fluffy_Pillow 49652.8/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:21.673 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_frost, elemental_potion_of_ultimate_power
0:22.628 default F feral_spirit Fluffy_Pillow 49528.0/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:23.581 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), ice_strike, spiraling_winds(2), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:24.533 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:25.485 single V ice_strike Fluffy_Pillow 49523.2/50000: 99% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:26.437 single Y sundering Fluffy_Pillow 49396.4/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:27.391 single Z frost_shock Fluffy_Pillow 47922.8/50000: 96% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:28.347 single S elemental_blast Fluffy_Pillow 48952.4/50000: 98% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:29.300 single R stormstrike Fluffy_Pillow 49102.2/50000: 98% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), spiraling_winds(5), elemental_chaos_frost, elemental_potion_of_ultimate_power
0:30.254 single W lava_lash Fluffy_Pillow 49628.6/50000: 99% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(6), elemental_chaos_frost
0:31.208 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(6), elemental_chaos_frost
0:32.161 single a earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(7), elemental_chaos_frost
0:33.115 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(7), elemental_chaos_frost
0:34.071 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(8), elemental_chaos_frost
0:35.027 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(9), elemental_chaos_frost
0:35.981 single R stormstrike Fluffy_Pillow 49876.4/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(9), elemental_chaos_frost
0:36.936 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_frost
0:37.891 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, forceful_winds, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:38.846 single Z frost_shock Fluffy_Pillow 49528.0/50000: 99% mana bloodlust, flurry(3), forceful_winds, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:39.800 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), forceful_winds, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:40.753 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:41.991 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:43.231 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:44.470 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:45.708 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:47.114 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(3), ice_strike, spiraling_winds(10), elemental_chaos_frost
0:48.352 Waiting     0.814 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_frost
0:49.166 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_frost
0:50.641 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_frost
0:51.877 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ice_strike, spiraling_winds(10), elemental_chaos_frost
0:53.239 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ice_strike, spiraling_winds(10), elemental_chaos_frost
0:54.441 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, spiraling_winds(10), elemental_chaos_frost
0:55.643 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, spiraling_winds(10), elemental_chaos_frost
0:56.845 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_frost
0:58.047 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_frost
0:59.249 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, spiraling_winds(10), elemental_chaos_frost
1:00.451 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_fire
1:01.653 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_fire
1:02.900 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_fire
1:04.138 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
1:05.377 single W lava_lash Fluffy_Pillow 49982.4/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
1:06.616 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
1:07.854 single Z frost_shock Fluffy_Pillow 48980.8/50000: 98% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
1:09.093 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
1:10.331 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
1:11.569 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
1:12.806 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, maelstrom_weapon(6), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
1:14.046 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
1:15.285 single R stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(3), forceful_winds(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
1:16.524 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:17.762 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:19.002 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), ice_strike, sophic_devotion, elemental_chaos_fire
1:20.241 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), sophic_devotion, elemental_chaos_fire
1:21.480 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), sophic_devotion, elemental_chaos_fire
1:22.718 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(5), sophic_devotion, elemental_chaos_fire
1:23.956 single T lightning_bolt Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(10), sophic_devotion, elemental_chaos_fire
1:25.193 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:26.432 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
1:27.670 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
1:28.908 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:30.146 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_fire
1:31.383 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_fire
1:32.623 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_fire
1:33.862 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, forgestorm_ignited, elemental_chaos_fire
1:35.101 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), doom_winds, forgestorm_ignited, elemental_chaos_fire
1:36.340 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:37.581 single L stormstrike Fluffy_Pillow 49985.6/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
1:38.821 single L stormstrike Fluffy_Pillow 47969.6/50000: 96% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, elemental_chaos_fire
1:40.058 single L stormstrike Fluffy_Pillow 48948.8/50000: 98% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, legacy_of_the_frost_witch, elemental_chaos_fire
1:41.295 single R stormstrike Fluffy_Pillow 48928.0/50000: 98% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), elemental_chaos_fire
1:42.535 single S elemental_blast Fluffy_Pillow 49912.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_fire
1:43.774 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
1:45.014 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
1:46.252 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:47.491 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:48.729 single U stormstrike Fluffy_Pillow 48980.8/50000: 98% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(3), ice_strike, elemental_chaos_fire
1:49.968 default F feral_spirit Fluffy_Pillow 49963.2/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_fire
1:51.208 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_fire
1:52.446 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_fire
1:53.684 single R stormstrike Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
1:54.921 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
1:56.159 single R stormstrike Fluffy_Pillow 48980.8/50000: 98% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
1:57.399 single R stormstrike Fluffy_Pillow 49964.8/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), elemental_chaos_fire
1:58.638 single S elemental_blast Fluffy_Pillow 49947.2/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_fire
1:59.876 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
2:01.115 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
2:02.353 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:03.592 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:04.830 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_frost
2:06.070 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, maelstrom_weapon(4), elemental_chaos_frost
2:07.310 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, stormbringer, maelstrom_weapon(7), elemental_chaos_frost
2:08.549 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, stormbringer, legacy_of_the_frost_witch, elemental_chaos_frost
2:09.751 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
2:10.954 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
2:12.158 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_frost
2:13.358 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(4), elemental_chaos_frost
2:14.561 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(6), ice_strike, elemental_chaos_frost
2:15.762 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:16.962 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(4), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:18.165 single R stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:19.367 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:20.568 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(6), ice_strike, elemental_chaos_frost
2:21.770 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds, elemental_chaos_frost
2:22.972 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, spiraling_winds, elemental_chaos_frost
2:24.175 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, spiraling_winds(2), elemental_chaos_frost
2:25.376 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), spiraling_winds(2), elemental_chaos_frost
2:26.615 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds(3), elemental_chaos_frost
2:27.855 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds(4), elemental_chaos_frost
2:29.093 single S elemental_blast Fluffy_Pillow 48980.8/50000: 98% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(4), elemental_chaos_frost
2:30.330 single R stormstrike Fluffy_Pillow 49585.0/50000: 99% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_frost
2:31.567 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_frost
2:32.804 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_frost
2:34.043 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_frost
2:35.282 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_frost
2:36.521 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_frost
2:37.760 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_frost
2:38.998 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_frost
2:40.238 Waiting     0.986 sec 50000.0/50000: 100% mana forceful_winds(3), maelstrom_weapon(2), ice_strike, spiraling_winds(10), elemental_chaos_frost
2:41.224 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(3), ice_strike, spiraling_winds(10), elemental_chaos_frost
2:42.688 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_frost
2:43.925 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
2:45.161 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, stormbringer, maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_frost
2:46.398 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, stormbringer, spiraling_winds(10), elemental_chaos_frost
2:47.602 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, maelstrom_weapon(2), elemental_chaos_frost
2:48.803 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, maelstrom_weapon(2), elemental_chaos_frost
2:50.007 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(3), elemental_chaos_frost
2:51.208 Waiting     0.996 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(3), ice_strike, elemental_chaos_frost
2:52.204 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(3), ice_strike, elemental_chaos_frost
2:53.591 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), maelstrom_weapon(7), ice_strike, elemental_chaos_frost
2:54.795 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, forceful_winds(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:55.996 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:57.235 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:58.474 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:59.712 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
3:00.951 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), sophic_devotion, elemental_chaos_fire
3:00.951 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), crumbling_power(20), sophic_devotion, elemental_chaos_fire
3:02.192 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, crumbling_power(19), sophic_devotion, elemental_chaos_fire
3:02.192 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, crumbling_power(19), sophic_devotion, elemental_chaos_fire
3:03.317 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, crumbling_power(18), sophic_devotion, elemental_chaos_fire
3:04.442 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, crumbling_power(18), sophic_devotion, elemental_chaos_fire
3:05.567 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(17), sophic_devotion, elemental_chaos_fire
3:06.693 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(16), sophic_devotion, elemental_chaos_fire
3:07.819 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(15), sophic_devotion, elemental_chaos_fire
3:08.946 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(14), sophic_devotion, elemental_chaos_fire
3:10.073 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_fire
3:11.197 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_fire
3:12.322 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_fire
3:13.449 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_fire
3:14.575 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_fire
3:15.814 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_fire
3:17.080 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_fire
3:18.319 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_fire
3:19.558 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_fire
3:20.796 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), elemental_chaos_fire
3:22.035 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
3:23.274 single R stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
3:24.511 default F feral_spirit Fluffy_Pillow 47961.6/50000: 96% mana flurry(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
3:25.749 single R stormstrike Fluffy_Pillow 49942.4/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
3:26.988 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), elemental_chaos_fire
3:28.226 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), elemental_chaos_fire
3:29.465 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_fire
3:30.702 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
3:31.939 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
3:33.177 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:34.416 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_fire
3:35.655 single W lava_lash Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_fire
3:36.894 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_fire
3:38.131 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_fire
3:39.369 single Z frost_shock Fluffy_Pillow 48980.8/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(4), elemental_chaos_fire
3:40.606 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(2), spiraling_winds(4), elemental_chaos_fire
3:41.841 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(5), spiraling_winds(5), elemental_chaos_fire
3:43.079 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, forceful_winds(5), stormbringer, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_fire
3:44.282 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_fire
3:45.484 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_fire
3:46.686 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_fire
3:47.889 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(3), spiraling_winds(9), forgestorm_ignited, elemental_chaos_fire
3:49.092 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, maelstrom_weapon(3), spiraling_winds(9), forgestorm_ignited, elemental_chaos_fire
3:50.295 single X lightning_bolt Fluffy_Pillow 49924.8/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:51.497 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:52.700 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:53.938 Waiting     0.101 sec 50000.0/50000: 100% mana flurry(2), forceful_winds(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:54.039 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:55.277 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_fire
3:56.516 single R stormstrike Fluffy_Pillow 48982.4/50000: 98% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_fire
3:57.754 single S elemental_blast Fluffy_Pillow 47963.2/50000: 96% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_fire
3:58.992 single R stormstrike Fluffy_Pillow 48569.0/50000: 97% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:00.197 single V ice_strike Fluffy_Pillow 49497.0/50000: 99% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:01.399 single R stormstrike Fluffy_Pillow 49770.2/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:02.602 single R stormstrike Fluffy_Pillow 48695.0/50000: 97% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:03.804 single R stormstrike Fluffy_Pillow 49618.2/50000: 99% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_fire
4:05.007 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_fire
4:06.209 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_fire
4:07.411 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:08.613 single W lava_lash Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:09.815 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:11.017 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(3), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:12.219 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:13.420 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(4), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:14.625 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
4:15.827 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds, forgestorm_ignited, elemental_chaos_fire
4:17.028 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
4:18.267 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
4:19.505 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, elemental_chaos_fire
4:20.745 single W lava_lash Fluffy_Pillow 48984.0/50000: 98% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
4:21.983 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
4:23.221 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire
4:24.459 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire
4:25.699 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
4:26.938 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(7), elemental_chaos_fire
4:28.177 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(7), elemental_chaos_fire
4:29.415 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(8), elemental_chaos_fire
4:30.704 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, forceful_winds(2), stormbringer, ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_fire
4:31.907 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_fire
4:33.110 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:34.521 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), doom_winds, spiraling_winds(10), elemental_chaos_fire
4:35.723 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), stormbringer, maelstrom_weapon(3), doom_winds, spiraling_winds(10), elemental_chaos_fire
4:36.926 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(6), doom_winds, spiraling_winds(10), elemental_chaos_fire
4:38.129 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(10), doom_winds, spiraling_winds(10), elemental_chaos_fire
4:39.331 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon, doom_winds, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:40.532 default F feral_spirit Fluffy_Pillow 49921.6/50000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(5), doom_winds, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:41.770 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:43.006 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:44.245 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_fire
4:45.482 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_fire
4:46.721 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_fire
4:47.959 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:49.160 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:50.362 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:51.564 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:52.766 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_fire
4:53.967 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:55.170 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:56.372 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:57.574 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
4:58.777 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon, elemental_chaos_fire
4:59.979 default B potion Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(2), elemental_chaos_fire
5:00.000 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(2), elemental_chaos_air, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 25.38% 21.55% 3663
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.06% 52.06% 3245
Armor 3603 3603 3603
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +211 Haste, +230 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Phys"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.doom_winds.enabled&buff.doom_winds.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&talent.feral_spirit.enabled&buff.feral_spirit.up)|(!talent.doom_winds.enabled&!talent.ascendance.enabled&!talent.feral_spirit.enabled)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3663
# gear_mastery_rating=3245
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 309353922
Max Event Queue: 392
Sim Seconds: 2250296
CPU Seconds: 314.8883
Physical Seconds: 158.4042
Speed Up: 7146

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.48sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 156540 522 7.65 3213 6474 38.3 38.3 27.0% 0.0% 0.0% 0.0% 6.91sec 156540 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost antimagic_shell 48707 0 0 0.00 0 0 5.1 0.0 0.0% 0.0% 0.0% 0.0% 64.65sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 134.78sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 768694 2562 38.58 3574 7193 192.9 192.9 27.5% 16.3% 0.0% 0.0% 1.81sec 1098162 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 373859 1246 37.67 1786 3596 188.4 188.4 27.5% 16.7% 0.0% 0.0% 1.81sec 534098 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.90sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 3297387 10991 39.24 13141 26396 196.2 196.2 27.6% 0.0% 0.0% 0.0% 1.43sec 3297387 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 201754 673 0.53 59583 120398 2.8 2.7 27.2% 0.0% 0.0% 0.0% 119.94sec 201754 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 5980 20 2.29 410 824 1.1 11.4 27.1% 0.0% 0.0% 0.0% 112.34sec 5980 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 316693 1056 1.49 33425 67178 7.5 7.5 26.8% 0.0% 0.0% 0.0% 48.21sec 452431 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 85.42sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 645356 2151 19.75 5116 10277 67.9 98.7 27.5% 0.0% 0.0% 0.0% 4.40sec 645356 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 270099 900 4.78 8861 17782 23.9 23.9 27.3% 0.0% 0.0% 0.0% 7.31sec 270099 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 135164 451 4.78 4430 8894 23.9 23.9 27.4% 0.0% 0.0% 0.0% 7.31sec 135164 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 61.64sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 1982253 6608 13.57 22824 45951 67.9 67.9 27.6% 0.0% 0.0% 0.0% 4.40sec 1982253 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 414860 1383 13.54 4794 9633 67.7 67.7 27.5% 0.0% 0.0% 0.0% 4.41sec 414860 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 456079 1520 12.78 5583 11247 63.9 63.9 27.5% 0.0% 0.0% 0.0% 4.64sec 651558 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 228003 760 12.78 2792 5621 63.9 63.9 27.5% 0.0% 0.0% 0.0% 4.64sec 325727 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1221219 4071 8.82 0 27683 44.1 44.1 100.0% 0.0% 0.0% 0.0% 6.71sec 1221219 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 610610 2035 8.82 0 13841 44.1 44.1 100.0% 0.0% 0.0% 0.0% 6.71sec 610610 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 39.60sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 306.29sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.73sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.49sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1591408 5305 49.23 5055 10174 246.2 246.2 27.5% 0.0% 0.0% 0.0% 1.21sec 1591408 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 59930 200 4.06 2314 4651 20.3 20.3 27.4% 0.0% 0.0% 0.0% 14.32sec 85616 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 60007 200 4.06 2314 4650 20.3 20.3 27.5% 0.0% 0.0% 0.0% 14.35sec 85727 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.4 0.0 0.0% 0.0% 0.0% 0.0% 14.30sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 97213 594 19.22 1451 2907 52.5 52.5 27.6% 0.0% 0.0% 0.0% 5.36sec 138879 163.77sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 186 1 1.07 50 100 2.9 2.9 27.3% 0.0% 0.0% 0.0% 120.73sec 266 163.77sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul main_hand 0 198118 1210 34.92 1629 3261 95.3 95.3 27.5% 0.0% 0.0% 0.0% 2.91sec 283034 163.77sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.73sec 0 163.77sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy algethar_puzzle_box_channel 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.77sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy antimagic_shell 48707 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 45.11sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 63237 211 1.39 7829 15727 6.9 6.9 16.2% 0.0% 0.0% 0.0% 45.70sec 63237 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 835767 2786 30.72 4674 9400 153.6 153.6 16.2% 0.0% 0.0% 0.0% 2.35sec 1193983 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.84sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 57160 191 1.40 7025 14098 7.0 7.0 16.5% 0.0% 0.0% 0.0% 45.84sec 57160 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1383543 4612 19.86 11963 24064 99.3 99.3 16.3% 0.0% 0.0% 0.0% 2.99sec 1383543 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 408133 1360 27.05 3018 0 0.0 135.3 0.0% 0.0% 0.0% 0.0% 0.00sec 408133 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 324431 1081 1.66 33622 67616 8.3 8.3 16.3% 0.0% 0.0% 0.0% 29.13sec 463485 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 167.88sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 335236 1117 5.25 10976 22082 26.2 26.2 16.2% 0.0% 0.0% 0.0% 11.08sec 478921 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 538480 1795 21.15 4374 8784 105.8 105.8 16.3% 0.0% 0.0% 0.0% 3.46sec 538480 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 23623 79 2.32 1744 3494 11.6 11.6 16.5% 0.0% 0.0% 0.0% 27.04sec 23623 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.92sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike 55090 298407 995 15.79 3247 6533 78.9 78.9 16.2% 0.0% 0.0% 0.0% 3.70sec 426306 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike_shadow 70890 396872 1323 15.79 4317 8678 0.0 78.9 16.3% 0.0% 0.0% 0.0% 0.00sec 396872 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 144525 482 3.11 8005 16078 15.5 15.5 16.0% 0.0% 0.0% 0.0% 6.92sec 144525 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 694558 2315 3.11 38373 77157 15.5 15.5 16.3% 0.0% 0.0% 0.0% 6.92sec 694558 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.52sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 58954 197 0.73 13917 27963 3.6 3.6 16.1% 0.0% 0.0% 0.0% 91.63sec 58954 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_pact 319236 382611 1275 24.56 2676 5377 122.8 122.8 16.3% 0.0% 0.0% 0.0% 2.65sec 382611 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 21.7 0.0 0.0% 0.0% 0.0% 0.0% 13.39sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 252599 842 19.90 2179 4381 11.6 99.5 16.3% 0.0% 0.0% 0.0% 27.04sec 252599 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 89260 298 7.56 2031 4058 37.8 37.8 16.3% 0.0% 0.0% 0.0% 7.86sec 127517 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 23 0 0.06 69 138 0.3 0.3 15.9% 0.0% 0.0% 0.0% 90.12sec 34 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul main_hand 0 1237015 4123 38.64 5505 11012 193.2 193.2 16.3% 0.0% 0.0% 0.0% 1.54sec 1767209 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul monstrous_blow 91797 9146 30 0.68 2330 4653 3.4 3.4 16.2% 0.0% 0.0% 0.0% 91.18sec 13065 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul spawn_travel 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 394948 1316 13.80 4924 9841 69.0 69.0 16.3% 0.0% 0.0% 0.0% 4.24sec 394948 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1571725 31435 48.49 33468 66763 40.4 40.4 16.3% 0.0% 0.0% 0.0% 5.16sec 1571725 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.52sec 0 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_risen_skulker skulker_shot 212423 339568 1132 31.02 1884 3766 155.2 155.1 16.2% 0.0% 0.0% 0.0% 1.93sec 485109 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 261205 4448 219.95 1043 2085 215.3 215.3 16.3% 0.0% 0.0% 0.0% 1.00sec 373159 58.72sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1341422 22844 361.24 3264 6519 353.6 353.6 16.3% 0.0% 0.0% 0.0% 0.60sec 1916366 58.72sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.66sec 0 58.72sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.88sec 0 59.10sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.11sec 0 59.44sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.88sec 0 59.89sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 347184 3455 24.86 7179 14335 41.6 41.6 16.2% 0.0% 0.0% 0.0% 7.11sec 347184 100.49sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 842392 8383 59.40 7290 14555 99.5 99.5 16.2% 0.0% 0.0% 0.0% 2.92sec 842392 100.49sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.88sec 0 59.84sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.88sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.88sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.88sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 219149 1634 88.28 955 1908 197.4 197.4 16.3% 0.0% 0.0% 0.0% 1.43sec 313078 134.13sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 953721 7110 124.98 2936 5867 279.4 279.4 16.3% 0.0% 0.0% 0.0% 1.00sec 1362494 134.13sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.88sec 0 134.13sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 45.77sec 0 134.50sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.79sec 0 134.26sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.98sec 0 133.47sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.43sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow dark_ascension 391109 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.81sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 1490123 4967 10.06 24311 52037 50.3 50.3 19.2% 0.0% 0.0% 0.0% 5.96sec 3480850 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 1990727 6636 25.72 13047 26841 50.3 128.6 17.6% 0.0% 0.0% 0.0% 5.96sec 3480850 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 178.9 0.0 0.0% 0.0% 0.0% 0.0% 1.67sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo 120644 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 77.44sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_heal 390971 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 77.44sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_damage 390964 76598 255 0.70 19150 39585 3.5 3.5 13.8% 0.0% 0.0% 0.0% 77.44sec 76598 300.00sec
PR_Priest_Shadow PR_Priest_Shadow idol_of_cthun 377349 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_void_tendril mind_flay ticks -193473 829424 2765 28.50 4994 10118 19.0 142.5 16.1% 0.0% 0.0% 0.0% 14.41sec 829424 24.45sec
PR_Priest_Shadow PR_Priest_Shadow mental_fortitude 377065 142811 476 68.18 419 0 330.0 340.9 0.0% 0.0% 0.0% 0.0% 0.90sec 6875140 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 1699630 5665 12.41 21978 46564 62.1 62.1 22.0% 0.0% 0.0% 0.0% 4.81sec 1699630 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay ticks -15407 106999 357 3.75 4983 10108 3.1 18.7 14.1% 0.0% 0.0% 0.0% 61.12sec 106999 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay_insanity ticks -391403 2085187 6951 29.69 11971 24446 37.3 148.4 16.6% 0.0% 0.0% 0.0% 7.93sec 2085187 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 262366 875 1.70 26514 56199 8.5 8.5 14.5% 0.0% 0.0% 0.0% 28.51sec 262366 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.83sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames 375901 409665 1366 1.53 43330 94431 7.7 7.7 20.0% 0.0% 0.0% 0.0% 40.64sec 409665 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames_damage_reversal 323706 0 0 0.00 0 0 7.7 0.0 0.0% 0.0% 0.0% 0.0% 40.64sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 304.10sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow power_infusion 10060 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.64sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 35.59sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_damage 205386 321221 1071 1.78 30116 64372 8.9 8.9 17.2% 0.0% 0.0% 0.0% 35.51sec 321221 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_dots 391286 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 35.59sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 197149 657 25.91 1522 0 130.6 129.5 0.0% 0.0% 0.0% 0.0% 2.23sec 197149 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 352854 1176 2.37 24577 50574 11.8 11.8 20.0% 0.0% 0.0% 0.0% 26.36sec 352854 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 90650 302 2.35 5026 18647 11.8 11.8 19.7% 0.0% 0.0% 0.0% 26.36sec 240938 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain ticks -589 911591 3039 50.35 3057 6253 17.2 251.8 17.6% 0.0% 0.0% 0.0% 17.54sec 911591 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparitions 341491 0 0 0.00 0 0 112.0 0.0 0.0% 0.0% 0.0% 0.0% 2.66sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparition 148859 396052 1320 21.72 3647 0 110.4 108.6 0.0% 0.0% 0.0% 0.0% 2.66sec 396052 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 377851 1260 17.37 4352 0 7.3 86.8 0.0% 0.0% 0.0% 0.0% 37.19sec 377851 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.39sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 1089213 3631 33.05 5568 11385 17.2 165.2 17.6% 0.0% 0.0% 0.0% 17.54sec 1089213 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 165.2 0.0 0.0% 0.0% 0.0% 0.0% 1.80sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow void_torrent ticks -263165 919815 3066 5.74 26335 53731 4.9 28.7 20.9% 0.0% 0.0% 0.0% 65.77sec 919815 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment 373427 0 0 0.00 0 0 41.1 0.0 0.0% 0.0% 0.0% 0.0% 7.12sec 0 137.71sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment_damage 373442 848360 6160 17.90 16408 34219 41.1 41.1 23.8% 0.0% 0.0% 0.0% 7.12sec 848360 137.71sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender melee 0 720791 5234 56.92 4483 9100 130.6 130.6 22.4% 0.0% 0.0% 0.0% 2.23sec 720791 137.71sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 310.77sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2409415 8031 4.19 95045 190635 20.9 20.9 21.0% 0.0% 0.0% 0.0% 14.23sec 2409415 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 30.06sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 602384 2008 16.77 6113 12294 83.8 83.8 17.3% 0.0% 0.0% 0.0% 3.57sec 1418702 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 816318 2721 38.45 3611 7260 83.8 192.3 17.4% 0.0% 0.0% 0.0% 3.57sec 1418702 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 277190 924 135.34 348 700 676.7 676.7 17.4% 0.0% 0.0% 0.0% 0.72sec 277190 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 324288 1081 5.63 9805 19716 28.2 28.2 17.3% 0.0% 0.0% 0.0% 7.77sec 324288 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 1575573 5252 7.97 33615 67330 39.9 39.9 17.5% 0.0% 0.0% 0.0% 7.50sec 1575573 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 564942 1883 4.91 19591 39269 24.5 24.5 17.4% 0.0% 0.0% 0.0% 12.34sec 564942 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 2749193 9164 13.55 34541 69428 67.7 67.7 17.3% 0.0% 0.0% 0.0% 4.37sec 2749193 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 996530 3322 3.26 50460 100953 16.3 16.3 21.3% 0.0% 0.0% 0.0% 18.63sec 996530 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 1 519144 1730 38.67 2653 5335 193.4 193.4 17.4% 16.4% 0.0% 0.0% 1.81sec 741653 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 2 259963 867 38.67 1328 2671 193.4 193.4 17.4% 16.4% 0.0% 0.0% 1.80sec 371385 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.39sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement primordial_wave 375982 48597 162 1.41 5895 11826 7.0 7.0 17.2% 0.0% 0.0% 0.0% 45.71sec 48597 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_pw 188196 808471 2695 1.40 95154 191413 7.0 7.0 21.1% 0.0% 0.0% 0.0% 45.89sec 808471 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 51.7 0.0 0.0% 0.0% 0.0% 0.0% 5.74sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 391417 1305 10.34 6440 12957 51.7 51.7 17.4% 0.0% 0.0% 0.0% 5.74sec 559182 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 195799 653 10.34 3220 6477 51.7 51.7 17.4% 0.0% 0.0% 0.0% 5.74sec 279720 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 233646 779 1.15 34531 69418 5.7 5.7 17.5% 0.0% 0.0% 0.0% 53.44sec 233646 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 214463 715 30.38 1201 2415 151.9 151.9 17.3% 0.0% 0.0% 0.0% 4.06sec 306383 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 25675 414 38.81 545 1090 40.1 40.1 17.4% 0.0% 0.0% 0.0% 2.30sec 36680 62.03sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_frost_wolf melee 0 200095 4621 123.47 1913 3825 89.1 89.1 17.4% 0.0% 0.0% 0.0% 3.42sec 285857 43.30sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_lightning_wolf melee 0 201135 4980 133.19 1913 3822 89.7 89.7 17.3% 0.0% 0.0% 0.0% 3.41sec 287343 40.39sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_fiery_wolf melee 0 200454 7515 200.71 1914 3822 89.2 89.2 17.4% 0.0% 0.0% 0.0% 3.40sec 286370 26.68sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_dre 114051 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 30.71sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_damage_dre 344548 305471 1018 1.66 30766 61774 8.3 8.3 19.3% 0.0% 0.0% 0.0% 30.71sec 305471 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba doom_winds 384352 23179 77 0.75 6210 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.41sec 33113 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 308.69sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba elemental_blast 117014 2083267 6944 5.02 68608 137477 25.1 25.1 20.8% 0.0% 0.0% 0.0% 11.75sec 2083267 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba feral_spirit 51533 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 21.15sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock 188389 96334 321 6.00 2734 5488 30.0 30.0 17.3% 0.0% 0.0% 0.0% 9.84sec 452032 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock ticks -188389 355699 1186 37.39 1620 3254 30.0 187.0 17.3% 0.0% 0.0% 0.0% 9.84sec 452032 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_attack 10444 449750 1499 225.59 340 681 1128.0 1128.0 17.3% 0.0% 0.0% 0.0% 0.67sec 449750 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba forgestorm_ignited_damage 381700 333244 1111 5.78 9808 19719 28.9 28.9 17.4% 0.0% 0.0% 0.0% 7.55sec 333244 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba frost_shock 196840 305587 1019 3.32 15657 31467 16.6 16.6 17.5% 0.0% 0.0% 0.0% 16.85sec 305587 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ice_strike 342240 416631 1389 4.04 17523 35165 20.2 20.2 17.5% 0.0% 0.0% 0.0% 14.91sec 416631 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lava_lash 60103 397044 1323 3.71 18174 36448 18.6 18.6 17.6% 0.0% 0.0% 0.0% 15.72sec 397044 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt 188196 837617 2792 3.35 41242 82776 16.7 16.7 21.2% 0.0% 0.0% 0.0% 16.79sec 837617 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba main_hand 1 437972 1460 32.65 2653 5333 163.3 163.3 17.4% 16.4% 0.0% 0.0% 2.14sec 625691 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba offhand 2 223982 747 33.35 1329 2669 166.7 166.7 17.3% 16.4% 0.0% 0.0% 2.08sec 319982 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.34sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike 17364 0 0 0.00 0 0 91.9 0.0 0.0% 0.0% 0.0% 0.0% 3.25sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_mh 32175 1225573 4085 24.50 8508 17110 122.5 122.5 17.4% 0.0% 0.0% 0.0% 3.25sec 1750863 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_mh 390287 290273 968 12.18 4768 0 60.9 60.9 0.0% 0.0% 0.0% 0.0% 5.50sec 290273 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_offhand 32176 613105 2044 24.50 4253 8560 122.5 122.5 17.4% 0.0% 0.0% 0.0% 3.25sec 875887 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_offhand 390287 145199 484 12.18 2385 0 60.9 60.9 0.0% 0.0% 0.0% 0.0% 5.50sec 145199 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba sundering 197214 301951 1007 1.27 40398 80934 6.4 6.4 17.3% 0.0% 0.0% 0.0% 49.43sec 301951 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_attack 25504 2067471 6892 83.33 4231 8483 416.7 416.7 17.2% 0.0% 0.0% 0.0% 2.41sec 2953605 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash 114089 155279 518 6.72 3807 7649 33.6 33.6 21.2% 0.0% 0.0% 0.0% 8.43sec 155279 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash_offhand 114093 89694 299 7.76 1903 3824 38.8 38.8 21.2% 0.0% 0.0% 0.0% 7.31sec 89694 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike 115356 0 0 0.00 0 0 27.4 0.0 0.0% 0.0% 0.0% 0.0% 8.63sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_mh 115357 557423 1858 7.29 13053 26180 36.5 36.5 17.1% 0.0% 0.0% 0.0% 8.63sec 557423 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_mh 390287 101087 337 2.49 8122 0 12.4 12.4 0.0% 0.0% 0.0% 0.0% 18.31sec 101087 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_offhand 115360 278874 930 7.29 6525 13111 36.5 36.5 17.1% 0.0% 0.0% 0.0% 8.63sec 278874 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_offhand 390287 50574 169 2.49 4064 0 12.4 12.4 0.0% 0.0% 0.0% 0.0% 18.31sec 50574 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt_ti 188196 1080419 3601 5.47 32513 65274 27.4 27.4 21.3% 0.0% 0.0% 0.0% 8.63sec 1080419 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_greater_earth_elemental melee 0 26369 422 39.37 548 1096 41.0 41.0 17.4% 0.0% 0.0% 0.0% 2.38sec 37671 62.46sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_spirit_wolf melee 0 824523 7516 202.60 1898 3791 370.4 370.4 17.3% 0.0% 0.0% 0.0% 1.61sec 1177921 109.70sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.42sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance_damage 344548 95911 320 0.40 40298 81037 2.0 2.0 18.8% 0.0% 0.0% 0.0% 180.42sec 95911 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.70sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys doom_winds 384352 22889 76 0.74 6148 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.47sec 32699 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 306.55sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys elemental_blast 117014 1931688 6439 4.95 64599 129538 24.7 24.7 20.8% 0.0% 0.0% 0.0% 11.69sec 1931688 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys feral_spirit 51533 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 23.98sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock 188389 103873 346 6.59 2688 5394 32.9 32.9 17.2% 0.0% 0.0% 0.0% 8.83sec 450582 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock ticks -188389 346709 1156 36.64 1611 3235 32.9 183.2 17.3% 0.0% 0.0% 0.0% 8.83sec 450582 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_attack 10444 434592 1449 216.91 342 685 1084.6 1084.6 17.2% 0.0% 0.0% 0.0% 0.69sec 434592 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys forgestorm_ignited_damage 381700 331574 1105 5.75 9805 19713 28.7 28.7 17.4% 0.0% 0.0% 0.0% 7.64sec 331574 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys frost_shock 196840 357266 1191 4.00 15171 30585 20.0 20.0 17.4% 0.0% 0.0% 0.0% 13.82sec 357266 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ice_strike 342240 429707 1432 4.24 17256 34591 21.2 21.2 17.4% 0.0% 0.0% 0.0% 14.15sec 429707 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lava_lash 60103 401905 1340 3.82 17911 35940 19.1 19.1 17.4% 0.0% 0.0% 0.0% 14.97sec 401905 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt 188196 882413 2941 3.62 40020 80342 18.1 18.1 21.6% 0.0% 0.0% 0.0% 15.44sec 882413 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys main_hand 1 449092 1497 34.41 2581 5190 172.1 172.1 17.3% 16.4% 0.0% 0.0% 1.93sec 641576 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys offhand 2 227793 759 34.76 1295 2603 173.8 173.8 17.4% 16.4% 0.0% 0.0% 2.01sec 325427 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike 17364 0 0 0.00 0 0 88.2 0.0 0.0% 0.0% 0.0% 0.0% 3.21sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_mh 32175 1111414 3705 23.55 8035 16142 117.7 117.7 17.3% 0.0% 0.0% 0.0% 3.21sec 1587774 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_mh 390287 257824 859 11.55 4463 0 57.8 57.8 0.0% 0.0% 0.0% 0.0% 5.46sec 257824 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_offhand 32176 555983 1853 23.55 4016 8083 117.7 117.7 17.4% 0.0% 0.0% 0.0% 3.21sec 794281 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_offhand 390287 129031 430 11.55 2234 0 57.8 57.8 0.0% 0.0% 0.0% 0.0% 5.46sec 129031 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys sundering 197214 296567 989 1.31 38535 77399 6.5 6.5 17.4% 0.0% 0.0% 0.0% 46.72sec 296567 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_attack 25504 2050605 6835 81.74 4285 8560 408.7 408.7 17.1% 0.0% 0.0% 0.0% 2.45sec 2929511 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash 114089 132991 443 4.81 4568 9187 24.1 24.1 20.7% 0.0% 0.0% 0.0% 10.18sec 132991 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash_offhand 114093 69814 233 5.05 2289 4603 25.2 25.2 20.6% 0.0% 0.0% 0.0% 9.69sec 69814 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike 115356 0 0 0.00 0 0 20.6 0.0 0.0% 0.0% 0.0% 0.0% 9.82sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_mh 115357 544238 1814 5.51 16894 33930 27.5 27.5 16.8% 0.0% 0.0% 0.0% 9.82sec 544238 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_mh 390287 121303 404 2.35 10314 0 11.8 11.8 0.0% 0.0% 0.0% 0.0% 17.65sec 121303 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_offhand 115360 271770 906 5.51 8450 16933 27.5 27.5 16.7% 0.0% 0.0% 0.0% 9.82sec 271770 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_offhand 390287 60507 202 2.35 5144 0 11.8 11.8 0.0% 0.0% 0.0% 0.0% 17.65sec 60507 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt_ti 188196 975468 3252 4.12 39167 78744 20.6 20.6 20.7% 0.0% 0.0% 0.0% 9.85sec 975468 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_greater_earth_elemental melee 0 24776 401 38.26 537 1073 39.4 39.4 17.2% 0.0% 0.0% 0.0% 2.39sec 35395 61.74sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_spirit_wolf melee 0 772381 12948 345.02 1922 3838 343.0 343.0 17.2% 0.0% 0.0% 0.0% 1.73sec 1103430 59.65sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
275118.7 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.2sec 18.8sec 5.5sec 23.05% 23.34% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 177.0s
  • trigger_min/max:1.6s / 177.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.05%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.8 2.2 22.2sec 18.7sec 5.5sec 23.27% 23.47% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 204.0s
  • trigger_min/max:3.0s / 204.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • brittle_1:23.27%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_death_check) 9.5 2.4 33.7sec 26.3sec 7.2sec 22.85% 0.00% 2.4 (2.4) 9.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_death_check
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.4s / 70.4s
  • trigger_min/max:0.9s / 70.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s

Stack Uptimes

  • death_and_madness_death_check_1:22.85%

Spelldata

  • id:322098
  • name:Death and Madness
  • tooltip:If the target dies within {$d=7 seconds}, the Priest gains {$321291m2=20} Insanity.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 119.2 134.8sec 2.5sec 285.0sec 98.65% 0.00% 109.8 (109.8) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 325.8s
  • trigger_min/max:0.0s / 17.8s
  • trigger_pct:100.00%
  • duration_min/max:5.0s / 356.8s

Stack Uptimes

  • death_rot_1:0.31%
  • death_rot_2:0.84%
  • death_rot_3:0.44%
  • death_rot_4:0.51%
  • death_rot_5:0.42%
  • death_rot_6:0.57%
  • death_rot_7:0.46%
  • death_rot_8:0.52%
  • death_rot_9:0.45%
  • death_rot_10:94.15%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% from you for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 4.4 241.8 74.3sec 1.2sec 67.2sec 98.33% 98.19% 203.1 (203.1) 3.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 345.8s
  • trigger_min/max:0.0s / 15.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 347.8s

Stack Uptimes

  • everfrost_1:1.47%
  • everfrost_2:1.46%
  • everfrost_3:1.45%
  • everfrost_4:1.45%
  • everfrost_5:1.44%
  • everfrost_6:1.43%
  • everfrost_7:1.43%
  • everfrost_8:1.42%
  • everfrost_9:1.42%
  • everfrost_10:85.36%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 15.6 46.4 18.9sec 4.8sec 17.1sec 88.56% 99.13% 5.3 (5.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 161.9s
  • trigger_min/max:0.0s / 30.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 162.9s

Stack Uptimes

  • festering_wound_1:17.70%
  • festering_wound_2:21.82%
  • festering_wound_3:18.99%
  • festering_wound_4:13.04%
  • festering_wound_5:8.52%
  • festering_wound_6:8.49%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 66.7 7.5sec 4.4sec 295.4sec 98.45% 98.19% 66.7 (66.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 9.1s
  • trigger_min/max:0.8s / 15.5s
  • trigger_pct:100.00%
  • duration_min/max:231.8s / 358.9s

Stack Uptimes

  • lashing_flames_1:98.45%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 66.7 185.1sec 4.4sec 289.1sec 99.20% 0.00% 62.6 (62.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 342.8s
  • trigger_min/max:0.9s / 53.9s
  • trigger_pct:100.00%
  • duration_min/max:1.4s / 358.0s

Stack Uptimes

  • razorice_1:0.99%
  • razorice_2:0.80%
  • razorice_3:0.90%
  • razorice_4:0.85%
  • razorice_5:95.66%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 277346.96
Minimum 254330.05
Maximum 302622.80
Spread ( max - min ) 48292.74
Range [ ( max - min ) / 2 * 100% ] 8.71%
Standard Deviation 6827.5037
5th Percentile 266550.76
95th Percentile 289038.71
( 95th Percentile - 5th Percentile ) 22487.95
Mean Distribution
Standard Deviation 78.8425
95.00% Confidence Interval ( 277192.43 - 277501.49 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2328
0.1 Scale Factor Error with Delta=300 397931
0.05 Scale Factor Error with Delta=300 1591724
0.01 Scale Factor Error with Delta=300 39793080
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3776
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 66310158 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.