SimulationCraft 1002-01

for World of Warcraft 10.0.2.47213 Live (hotfix 2023-01-06/47213, git build 0068ab88e7)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 43403 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
43403.2 43403.2 50.1 / 0.116% 8628.3 / 19.9% 3355.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.6 12.9 Runic Power 7.46% 50.0 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 43403
Abomination Limb 0 (551) 0.0% (1.3%) 3.0 120.56sec 54721 44456

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2311 0.0000 0.00 0.00 0.00% 44456.41 44456.41

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [d]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [e]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 551 1.3% 38.2 6.91sec 4282 0 Direct 38.2 3359 6768 4281 27.1% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.24 38.24 0.00 0.00 0.00 0.0000 0.0000 163732.95 163732.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.94% 27.90 13 37 3359.42 2279 6415 3358.89 2664 4117 93710 93710 0.00%
crit 27.06% 10.35 1 21 6767.75 4559 12992 6768.75 4782 9611 70023 70023 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2564 5.9% 192.4 1.82sec 3993 2210 Direct 192.4 3583 7210 3993 27.5% 16.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 192.45 192.45 0.00 0.00 0.00 1.8066 0.0000 768477.41 1097852.86 30.00% 2210.35 2210.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.13% 108.01 67 157 3583.32 2435 7197 3583.94 3314 3946 387047 552938 30.00%
crit 27.49% 52.91 26 87 7209.66 4870 14394 7208.65 6246 8084 381431 544915 30.00%
miss 16.38% 31.53 12 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1250 2.9% 188.2 1.82sec 1991 1102 Direct 188.2 1792 3607 1991 27.5% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 188.18 188.18 0.00 0.00 0.00 1.8065 0.0000 374732.59 535345.92 30.00% 1102.37 1102.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.81% 105.02 63 153 1791.52 1217 3599 1791.85 1653 1945 188142 268781 30.00%
crit 27.49% 51.74 24 84 3606.56 2435 7197 3606.32 3224 4060 186591 266565 30.00%
miss 16.70% 31.42 14 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Breath of Sindragosa 0 (11251) 0.0% (25.9%) 2.9 120.83sec 1147159 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [h]:2.94
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 11251 25.9% 200.2 1.41sec 16843 0 Direct 200.2 13173 26467 16843 27.6% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 200.22 200.22 0.00 0.00 0.00 0.0000 0.0000 3372331.46 3372331.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.39% 144.95 78 234 13172.64 7338 28157 13187.54 12095 14466 1909315 1909315 0.00%
crit 27.61% 55.28 17 94 26467.45 14675 55310 26501.58 23575 31098 1463017 1463017 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 711 1.6% 2.9 119.64sec 72399 0 Direct 2.8 59757 120007 76766 28.2% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.78 0.00 0.00 0.00 0.0000 0.0000 213287.69 213287.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 71.78% 1.99 0 3 59757.15 22015 68019 57759.61 0 68019 119180 119180 0.00%
crit 28.22% 0.78 0 3 120006.81 44029 136038 71391.90 0 136038 94108 94108 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 20 0.0% 1.1 116.33sec 5619 4251 Direct 11.6 406 819 519 27.2% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.07 11.64 0.00 0.00 0.00 1.3220 0.0000 6035.87 6035.87 0.00% 4250.61 4250.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.76% 8.47 0 31 406.38 289 678 303.53 0 619 3441 3441 0.00%
crit 27.24% 3.17 0 17 818.87 578 1311 594.38 0 1233 2595 2595 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [V]:1.07
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 982 2.3% 6.9 47.18sec 42677 0 Direct 6.9 33424 67184 42708 27.5% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.91 6.90 0.00 0.00 0.00 0.0000 0.0000 294764.14 421102.37 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.50% 5.00 0 9 33424.36 33171 34163 33397.49 0 34163 167260 238949 29.98%
crit 27.50% 1.90 0 8 67183.58 66341 68326 58700.47 0 68326 127504 182154 26.21%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 1873 4.3% 67.0 4.46sec 8387 0 Periodic 98.7 4457 8948 5693 27.5% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.02 0.00 98.75 98.75 66.01 0.0000 2.9999 562134.54 562134.54 0.00% 1897.65 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 72.48% 71.57 43 98 4456.80 29 9744 4456.62 4066 4817 318990 318990 0.00%
crit 27.52% 27.17 10 50 8948.15 482 19841 8947.17 7595 10539 243144 243144 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 802 (1202) 1.9% (2.8%) 23.8 7.19sec 15244 11442 Direct 23.8 (47.5) 7964 15984 10165 27.4% (27.4%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.76 23.76 0.00 0.00 0.00 1.3323 0.0000 241549.33 241549.33 0.00% 11442.26 11442.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.56% 17.24 0 45 7963.96 5121 13579 7933.66 0 9729 137322 137322 0.00%
crit 27.44% 6.52 0 21 15984.45 10111 27318 15814.23 0 22709 104227 104227 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:25.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [G]:13.73
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [m]:3.23
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [q]:6.80
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 400 0.9% 23.8 7.19sec 5079 0 Direct 23.8 3983 7988 5079 27.4% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.76 23.76 0.00 0.00 0.00 0.0000 0.0000 120701.28 120701.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.62% 17.26 0 44 3982.82 2478 6829 3966.95 0 4739 68735 68735 0.00%
crit 27.38% 6.51 0 21 7987.84 5121 13404 7895.77 0 12104 51967 51967 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 6585 (7965) 15.2% (18.3%) 67.0 4.46sec 35595 29181 Direct 67.0 (133.9) 23032 46284 29428 27.5% (27.5%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.02 67.02 0.00 0.00 0.00 1.2198 0.0000 1972304.58 1972304.58 0.00% 29181.30 29181.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.49% 48.58 27 72 23031.68 3909 49251 23035.40 20208 25767 1118979 1118979 0.00%
crit 27.51% 18.44 5 36 46284.04 7818 98502 46287.27 38062 57013 853325 853325 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [R]:50.53
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [W]:0.56
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [Y]:0.72
  • if_expr:buff.rime.react
    single_target
    [l]:15.22
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1380 3.2% 66.9 4.47sec 6180 0 Direct 66.9 4836 9722 6180 27.5% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.87 66.87 0.00 0.00 0.00 0.0000 0.0000 413266.47 413266.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.50% 48.48 23 71 4836.40 2620 10348 4837.35 4347 5402 234456 234456 0.00%
crit 27.50% 18.39 5 35 9722.09 5241 20232 9723.71 7784 12078 178811 178811 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1529 (8356) 3.5% (19.3%) 63.9 4.64sec 39186 19051 Direct 63.9 (215.0) 5611 11290 7172 27.5% (56.9%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.91 63.91 0.00 0.00 0.00 2.0569 0.0000 458349.09 654801.11 30.00% 19051.01 19051.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.53% 46.35 21 71 5611.45 3658 11593 5614.40 5076 6359 260117 371605 30.00%
crit 27.47% 17.56 4 35 11290.43 7316 23186 11296.01 9167 14569 198232 283196 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [T]:25.21
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [U]:47.13
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [X]:9.66
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [k]:11.58
  • if_expr:!variable.pooling_runes&buff.killing_machine.react
    single_target
    [n]:13.91
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 764 1.8% 63.9 4.64sec 3584 0 Direct 63.9 2805 5648 3584 27.4% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.91 63.91 0.00 0.00 0.00 0.0000 0.0000 229065.36 327244.57 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.60% 46.40 21 70 2805.26 1829 5796 2806.56 2498 3131 130166 185957 30.00%
crit 27.40% 17.51 3 34 5647.69 3658 11481 5651.26 4441 8871 98899 141288 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 4041 9.3% 43.6 6.79sec 27796 0 Direct 43.6 0 27796 27796 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.58 43.58 0.00 0.00 0.00 0.0000 0.0000 1211379.47 1211379.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.58 23 65 27796.08 15185 61865 27786.34 24625 31140 1211379 1211379 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2021 4.7% 43.6 6.79sec 13898 0 Direct 43.6 0 13898 13898 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.58 43.58 0.00 0.00 0.00 0.0000 0.0000 605689.74 605689.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.58 23 65 13898.04 7593 30932 13893.17 12313 15570 605690 605690 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (5282) 0.0% (12.2%) 15.0 20.61sec 105550 84389

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.00 0.00 0.00 0.00 0.00 1.2508 0.0000 0.00 0.00 0.00% 84389.30 84389.30

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [Q]:9.58
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [j]:5.42
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5282 12.2% 244.8 1.22sec 6468 0 Direct 244.8 5054 10179 6468 27.6% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 244.76 244.76 0.00 0.00 0.00 0.0000 0.0000 1583227.69 1583227.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.40% 177.22 114 236 5054.32 1070 13913 5052.55 4305 5805 895728 895728 0.00%
crit 27.60% 67.54 36 105 10178.59 2141 26993 10176.26 8192 12044 687500 687500 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 200 0.5% 20.3 14.34sec 2956 0 Direct 20.3 2314 4650 2955 27.5% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.29 20.29 0.00 0.00 0.00 0.0000 0.0000 59968.57 85671.58 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.53% 14.72 3 29 2313.62 2296 2365 2313.56 2296 2365 34046 48639 30.00%
crit 27.47% 5.57 0 16 4650.27 4593 4730 4637.76 0 4730 25922 37033 29.92%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 201 0.5% 20.3 14.35sec 2958 0 Direct 20.3 2314 4651 2958 27.6% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.35 20.35 0.00 0.00 0.00 0.0000 0.0000 60175.41 85967.07 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.44% 14.74 2 28 2313.65 2296 2365 2313.57 2296 2365 34098 48712 30.00%
crit 27.56% 5.61 0 15 4650.56 4593 4730 4634.30 0 4730 26078 37255 29.90%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 1825 / 996
Claw 600 0.8% 52.5 5.36sec 1869 1869 Direct 52.5 1466 2934 1869 27.4% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.47 52.47 0.00 0.00 0.00 1.0000 0.0000 98070.34 140104.06 30.00% 1869.11 1869.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.55% 38.07 18 53 1466.33 910 2884 1468.16 1301 1676 55821 79746 30.00%
crit 27.45% 14.40 2 32 2933.84 1820 5640 2938.23 2374 4326 42250 60358 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.47
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.70sec 68 68 Direct 2.9 54 108 68 27.0% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 0.00 1.0000 0.0000 200.03 285.76 30.00% 68.41 68.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.02% 2.14 0 3 53.88 32 76 52.78 0 71 115 164 29.37%
crit 26.98% 0.79 0 3 107.68 64 147 65.28 0 147 85 121 18.19%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.92
main_hand 1223 1.5% 95.3 2.90sec 2097 1356 Direct 95.3 1643 3286 2097 27.7% 0.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.34 95.34 0.00 0.00 0.00 1.5462 0.0000 199967.74 285675.48 30.00% 1356.47 1356.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.33% 68.96 40 92 1642.70 1011 3133 1645.10 1477 1833 113277 161829 30.00%
crit 27.67% 26.38 8 46 3285.71 2023 6195 3290.70 2826 3925 86691 123847 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 2.0 138.66sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.05 0.00 0.00 0.00 0.00 1.2872 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [Z]:1.46
  • if_expr:runic_power<60
    single_target
    [p]:0.59
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 85.68sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [b]:0.37
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [c]:3.57
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.9 62.05sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.86 0.00 0.00 0.00 0.00 1.2217 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [S]:4.49
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [o]:0.37
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 7.9 39.76sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [f]:0.33
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [g]:7.59
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.4 306.79sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [a]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.70sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [i]:2.98
Unholy Strength 20.3 14.31sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.32 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5sec 120.6sec 11.8sec 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 125.2s
  • trigger_min/max:120.0s / 125.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 12.1 31.5 25.2sec 6.8sec 19.5sec 78.68% 0.00% 0.0 (0.0) 7.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.7s / 75.7s
  • trigger_min/max:0.9s / 54.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.0s

Stack Uptimes

  • bonegrinder_crit_1:24.76%
  • bonegrinder_crit_2:18.91%
  • bonegrinder_crit_3:14.49%
  • bonegrinder_crit_4:11.41%
  • bonegrinder_crit_5:9.11%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 4.0 0.0 64.7sec 64.7sec 9.8sec 13.14% 38.66% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.6s / 308.1s
  • trigger_min/max:10.6s / 308.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • bonegrinder_frost_1:13.14%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.9 14.6 120.5sec 15.1sec 19.4sec 19.17% 0.00% 1.9 (1.9) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 149.4s
  • trigger_min/max:0.0s / 135.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:0.88%
  • bound_by_fire_and_blaze_2:4.32%
  • bound_by_fire_and_blaze_3:4.22%
  • bound_by_fire_and_blaze_4:3.66%
  • bound_by_fire_and_blaze_5:2.75%
  • bound_by_fire_and_blaze_6:3.35%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.8sec 120.8sec 68.0sec 66.67% 0.00% 199.7 (199.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 197.3s
  • trigger_min/max:120.0s / 197.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 196.3s

Stack Uptimes

  • breath_of_sindragosa_1:66.67%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.7sec 120.7sec 0.7sec 0.68% 0.00% 6.9 (6.9) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.68
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 148.9s
  • trigger_min/max:120.0s / 148.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s

Stack Uptimes

  • dragon_games_equipment_1:0.68%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.3sec 98.7sec 58.1sec 25.15% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 328.0s

Stack Uptimes

  • elemental_chaos_air_1:25.15%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.6sec 98.6sec 58.0sec 24.94% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 359.0s

Stack Uptimes

  • elemental_chaos_earth_1:24.94%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.9sec 101.9sec 58.0sec 24.91% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:24.91%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 122.3sec 97.9sec 58.1sec 25.01% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 301.9s

Stack Uptimes

  • elemental_chaos_frost_1:25.01%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 306.8sec 306.8sec 26.8sec 12.75% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 333.7s
  • trigger_min/max:300.0s / 333.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.75%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 85.6sec 85.6sec 19.5sec 25.90% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 211.7s
  • trigger_min/max:20.0s / 211.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:25.90%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 7.6 0.0 39.8sec 39.8sec 12.2sec 30.90% 0.00% 0.0 (0.0) 7.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.2s / 55.1s
  • trigger_min/max:28.2s / 55.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • enduring_strength_1:30.90%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 7.8 17.3 40.1sec 11.6sec 9.6sec 25.12% 98.65% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.2s / 127.7s
  • trigger_min/max:0.9s / 120.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:9.88%
  • enduring_strength_builder_2:7.84%
  • enduring_strength_builder_3:4.60%
  • enduring_strength_builder_4:1.97%
  • enduring_strength_builder_5:0.63%
  • enduring_strength_builder_6:0.16%
  • enduring_strength_builder_7:0.03%
  • enduring_strength_builder_8:0.00%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gathering Storm 13.3 129.6 23.3sec 2.1sec 15.5sec 68.88% 87.13% 69.7 (108.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.8s / 85.8s
  • trigger_min/max:0.9s / 34.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.7s

Stack Uptimes

  • gathering_storm_1:2.25%
  • gathering_storm_2:4.91%
  • gathering_storm_3:5.25%
  • gathering_storm_4:3.19%
  • gathering_storm_5:5.40%
  • gathering_storm_6:3.91%
  • gathering_storm_7:3.49%
  • gathering_storm_8:3.77%
  • gathering_storm_9:3.05%
  • gathering_storm_10:33.66%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 1.8 221.6 136.5sec 1.3sec 160.8sec 97.11% 81.44% 218.0 (218.0) 0.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:112.7s / 305.1s
  • trigger_min/max:1.0s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.6s

Stack Uptimes

  • icy_talons_1:0.83%
  • icy_talons_2:0.63%
  • icy_talons_3:95.65%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 43.9 8.1 6.8sec 5.7sec 1.7sec 25.02% 28.22% 8.1 (8.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 54.3s
  • trigger_min/max:0.0s / 54.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.2s

Stack Uptimes

  • killing_machine_1:25.02%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 7.9 0.0 39.8sec 39.8sec 11.8sec 31.08% 31.24% 0.0 (0.0) 7.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.2s / 55.1s
  • trigger_min/max:28.2s / 55.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:31.08%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 7.9 58.4 39.8sec 4.4sec 11.6sec 30.59% 52.97% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:25.5s / 55.8s
  • trigger_min/max:0.9s / 46.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:2.04%
  • pillar_of_frost_bonus_2:2.38%
  • pillar_of_frost_bonus_3:2.90%
  • pillar_of_frost_bonus_4:2.43%
  • pillar_of_frost_bonus_5:2.51%
  • pillar_of_frost_bonus_6:2.91%
  • pillar_of_frost_bonus_7:2.38%
  • pillar_of_frost_bonus_8:2.32%
  • pillar_of_frost_bonus_9:2.18%
  • pillar_of_frost_bonus_10:1.83%
  • pillar_of_frost_bonus_11:1.68%
  • pillar_of_frost_bonus_12:1.47%
  • pillar_of_frost_bonus_13:1.16%
  • pillar_of_frost_bonus_14:0.83%
  • pillar_of_frost_bonus_15:0.49%
  • pillar_of_frost_bonus_16:0.30%
  • pillar_of_frost_bonus_17:0.24%
  • pillar_of_frost_bonus_18:0.19%
  • pillar_of_frost_bonus_19:0.17%
  • pillar_of_frost_bonus_20:0.12%
  • pillar_of_frost_bonus_21:0.05%
  • pillar_of_frost_bonus_22:0.01%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.4 1.6 23.2sec 20.6sec 17.1sec 76.40% 0.00% 223.9 (223.9) 12.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 85.6s
  • trigger_min/max:20.0s / 27.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.7s

Stack Uptimes

  • remorseless_winter_1:76.40%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 67.2 6.0 4.5sec 4.1sec 1.5sec 33.31% 99.77% 6.0 (6.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 42.0s
  • trigger_min/max:0.0s / 42.0s
  • trigger_pct:63.01%
  • duration_min/max:0.0s / 17.5s

Stack Uptimes

  • rime_1:33.31%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.7 14.8 21.9sec 10.3sec 11.9sec 54.28% 0.00% 14.8 (14.8) 13.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 141.5s
  • trigger_min/max:0.9s / 134.8s
  • trigger_pct:14.94%
  • duration_min/max:0.0s / 90.5s

Stack Uptimes

  • rune_mastery_1:54.28%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.6 23.3sec 14.3sec 10.2sec 43.65% 42.98% 7.6 (7.6) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 83.5s
  • trigger_min/max:0.0s / 61.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.7s

Stack Uptimes

  • rune_of_hysteria_1:43.65%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Strength 8.5 11.9 35.9sec 14.3sec 23.6sec 66.57% 0.00% 11.9 (11.9) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 179.7s
  • trigger_min/max:0.0s / 63.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 170.5s

Stack Uptimes

  • unholy_strength_1:66.57%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 6.9 216.5 42.9sec 1.3sec 40.9sec 94.56% 91.82% 203.1 (203.1) 6.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 251.6s
  • trigger_min/max:1.0s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 312.5s

Stack Uptimes

  • unleashed_frenzy_1:3.91%
  • unleashed_frenzy_2:3.31%
  • unleashed_frenzy_3:87.34%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=6 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.8 10.0 50.0 10.9s 1.3s 125.4s
windfury_totem_extra_attack_oh 22.5 8.0 42.0 12.9s 1.3s 180.6s
Killing Machine spent on Obliterate 43.6 23.0 65.0 6.8s 0.9s 54.1s
Killing Machine: Critical auto attacks 43.9 23.0 65.0 6.8s 1.3s 54.3s
Killing Machine wasted: Critical auto attacks 8.1 0.0 23.0 32.7s 1.3s 308.4s
Rune ready 227.2 161.0 300.0 1.4s 0.0s 12.1s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 3.06% 0.00% 14.37% 0.7s 0.0s 6.6s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=360087)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0661.241 / 0.9943.10822.363
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
11.74131.94259.589 / 58.11091.946144.652

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Remorseless Winter0.7760.0017.7738.5671.11722.348
Horn of Winter18.6350.001155.05865.6370.127173.106
Death and Decay85.7301.009243.26828.0090.000243.268
Abomination Limb0.7940.0015.2020.9390.0005.202
Pillar of Frost1.9550.00115.77511.7500.50030.273
Breath of Sindragosa1.0460.00177.2751.6360.00078.117
Raise Dead0.7630.0015.2451.3710.2635.883

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Breath of SindragosaRune10.6310.554.64%0.990.080.78%
Empower Rune WeaponRunic Power19.1188.022.27%4.617.557.90%
Empower Rune WeaponRune19.1119.058.38%1.000.070.35%
Frost FeverRunic Power32.32153.413.95%4.758.185.06%
Horn of WinterRunic Power4.86121.393.13%25.000.000.00%
Horn of WinterRune9.719.714.27%1.000.000.01%
Murderous EfficiencyRune21.8121.819.60%1.000.000.00%
Rage of the Frozen ChampionRunic Power66.87519.2013.37%7.7615.752.94%
Rune RegenerationRune90.5790.5739.87%1.000.000.00%
Rune of HysteriaRunic Power166.40339.228.73%2.0430.738.31%
Runic AttenuationRunic Power71.74345.388.89%4.8113.323.71%
Runic EmpowermentRune75.7975.4733.22%1.000.320.42%
Arcane TorrentRunic Power2.0540.921.05%20.000.000.00%
Death and DecayRunic Power1.0710.740.28%10.000.000.00%
Howling BlastRunic Power67.021.510.04%0.020.000.00%
ObliterateRunic Power107.492117.6454.53%19.7032.221.50%
Remorseless WinterRunic Power15.00146.263.77%9.753.742.49%
pet - ghoul
energy_regenEnergy1111.331933.31100.00%1.74171.368.14%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 199.663194.5516.0015.961055.65
Death and DecayRune 1.071.071.001.005619.34
Frost StrikeRunic Power 23.76594.0925.0025.00609.75
Howling BlastRune 67.020.150.000.0015751908.85
ObliterateRune 107.49214.992.003.3611649.48
Remorseless WinterRune 15.0015.001.001.00105550.39
pet - ghoul
ClawEnergy 52.472098.8140.0040.0046.73
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 12.95 12.63 111.5 95.1 0.2 144.0
Rune 6.0 0.76 0.77 0.0 1.9 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 43403.15
Minimum 35435.13
Maximum 52432.15
Spread ( max - min ) 16997.02
Range [ ( max - min ) / 2 * 100% ] 19.58%
Standard Deviation 2214.9950
5th Percentile 39730.59
95th Percentile 47066.33
( 95th Percentile - 5th Percentile ) 7335.74
Mean Distribution
Standard Deviation 25.5783
95.00% Confidence Interval ( 43353.02 - 43453.28 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 101
0.1% Error 10005
0.1 Scale Factor Error with Delta=300 41883
0.05 Scale Factor Error with Delta=300 167529
0.01 Scale Factor Error with Delta=300 4188217
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 43403.15
Minimum 35435.13
Maximum 52432.15
Spread ( max - min ) 16997.02
Range [ ( max - min ) / 2 * 100% ] 19.58%
Standard Deviation 2214.9950
5th Percentile 39730.59
95th Percentile 47066.33
( 95th Percentile - 5th Percentile ) 7335.74
Mean Distribution
Standard Deviation 25.5783
95.00% Confidence Interval ( 43353.02 - 43453.28 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 101
0.1% Error 10005
0.1 Scale Factor Error with Delta=300 41883
0.05 Scale Factor Error with Delta=300 167529
0.01 Scale Factor Error with Delta=300 4188217
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 43403.15
Minimum 35435.13
Maximum 52432.15
Spread ( max - min ) 16997.02
Range [ ( max - min ) / 2 * 100% ] 19.58%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 12711173.65
Minimum 8325073.30
Maximum 16793535.30
Spread ( max - min ) 8468462.00
Range [ ( max - min ) / 2 * 100% ] 33.31%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
5 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
6 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
7 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
8 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
9 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
A 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
B 0.00 variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
C 0.00 variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
D 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
E 0.00 variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
Default action list Executed every time the actor is available.
# count action,conditions
F 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
When using 'external_buffs.pool', will use this lines logic to determine when to use Power Infusion.
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
G 13.73 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
H 0.00 call_action_list,name=trinkets
Choose Action list to run
I 0.00 call_action_list,name=cooldowns
J 0.00 call_action_list,name=racials
K 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
L 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
M 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
N 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
O 0.00 call_action_list,name=aoe,if=active_enemies>=2
P 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
Q 9.58 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
R 50.53 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
S 4.49 horn_of_winter,if=rune<2&runic_power.deficit>25
T 25.21 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
U 47.13 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
V 1.07 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
W 0.56 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
X 9.66 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
Y 0.72 howling_blast,if=buff.rime.react
Z 1.46 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
a 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
b 0.37 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
c 3.57 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
d 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
e 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
f 0.33 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
g 7.59 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
h 2.94 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
i 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
j 5.42 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
0.00 frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
k 11.58 obliterate,if=!variable.pooling_runes&buff.killing_machine.react
l 15.22 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
m 3.23 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
n 13.91 obliterate,if=!variable.pooling_runes
o 0.37 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
p 0.59 arcane_torrent,if=runic_power.deficit>20
q 6.80 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
0.00 use_item,name=algethar_puzzle_box,if=cooldown.pillar_of_frost.remains<2
r 2.82 use_item,slot=trinket1,if=!variable.trinket_1_manual&(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
s 2.76 use_item,slot=trinket2,if=!variable.trinket_2_manual&(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
t 0.13 use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
u 0.01 use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABCDEFeijklnhrcgaRURURTURTRSURTRXRQTTsUURURTUcTRURURQUUgUURURURUUUSQTRURTRURZTRUUURQVgknlkqnlnlGGGnjlmnmmknlmkleilGjhrTRXRXgRUTRUURSTQsUcURURTURTUXTRQURTTgRUTRUTjnloGGGklkkGGGnjkglGGGnlkpGGGkkjlGGGnlkeilkGhrQgURUTURSUURTRXQscUTURUUURUUQUfUURUURTRS

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 4 trinket_1_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 5 trinket_2_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 6 trinket_1_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 7 trinket_2_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 8 trinket_priority Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 9 trinket_1_exclude Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat A trinket_2_exclude Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat B trinket_1_manual Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat C trinket_2_manual Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat D rw_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat E 2h_check Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
0:00.000 default F auto_attack Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
0:00.000 cooldowns e abomination_limb Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, killing_machine, elemental_chaos_earth
0:01.037 cooldowns i raise_dead Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, killing_machine, rime, elemental_chaos_earth
0:01.037 single_target j remorseless_winter Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, killing_machine, rime, elemental_chaos_earth
0:02.073 single_target k obliterate Fluffy_Pillow 10.0/144: 7% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, killing_machine, remorseless_winter, rime, elemental_chaos_earth
0:03.106 single_target l howling_blast Fluffy_Pillow 30.0/144: 21% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, elemental_chaos_earth
0:04.142 single_target n obliterate Fluffy_Pillow 43.0/144: 30% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, gathering_storm(3), remorseless_winter, bonegrinder_crit, elemental_chaos_earth
0:05.179 cooldowns h breath_of_sindragosa Fluffy_Pillow 63.0/144: 44% runic_power
2.0/6: 33% rune
bloodlust, abomination_limb, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, elemental_chaos_earth
0:05.179 trinkets r use_item_blazebinders_hoof Fluffy_Pillow 63.0/144: 44% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, elemental_chaos_earth
0:05.179 cooldowns c empower_rune_weapon Fluffy_Pillow 63.0/144: 44% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, elemental_chaos_earth
0:05.179 cooldowns g pillar_of_frost Fluffy_Pillow 68.0/144: 47% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, elemental_chaos_earth
0:05.179 cooldowns a potion Fluffy_Pillow 68.0/144: 47% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, elemental_chaos_earth
0:05.179 breath R howling_blast Fluffy_Pillow 68.0/144: 47% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.081 breath U obliterate Fluffy_Pillow 81.0/144: 56% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.981 breath R howling_blast Fluffy_Pillow 90.0/144: 62% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy, bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.883 breath U obliterate Fluffy_Pillow 82.0/144: 57% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, unleashed_frenzy(2), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.784 breath R howling_blast Fluffy_Pillow 86.0/144: 60% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.685 breath T obliterate Fluffy_Pillow 83.0/144: 58% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.585 breath U obliterate Fluffy_Pillow 92.0/144: 64% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.484 breath R howling_blast Fluffy_Pillow 101.0/144: 70% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.385 breath T obliterate Fluffy_Pillow 98.0/144: 68% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.285 breath R howling_blast Fluffy_Pillow 102.0/144: 71% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.185 breath S horn_of_winter Fluffy_Pillow 94.0/144: 65% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.086 breath U obliterate Fluffy_Pillow 119.0/144: 83% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.986 breath R howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.886 breath T obliterate Fluffy_Pillow 120.0/144: 83% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.785 breath R howling_blast Fluffy_Pillow 129.0/144: 90% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.685 Waiting     0.548 sec 121.0/144: 84% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.233 breath X obliterate Fluffy_Pillow 110.0/144: 76% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.134 breath R howling_blast Fluffy_Pillow 141.0/144: 98% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.034 breath Q remorseless_winter Fluffy_Pillow 128.0/144: 89% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.939 Waiting     0.210 sec 130.6/144: 91% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.149 breath T obliterate Fluffy_Pillow 130.6/144: 91% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.051 Waiting     0.087 sec 134.2/144: 93% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.138 breath T obliterate Fluffy_Pillow 134.2/144: 93% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.038 Waiting     1.168 sec 128.0/144: 89% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.206 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 102.2/144: 71% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.206 breath U obliterate Fluffy_Pillow 102.2/144: 71% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.241 Waiting     1.137 sec 117.2/144: 81% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.378 breath U obliterate Fluffy_Pillow 101.2/144: 70% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.414 breath R howling_blast Fluffy_Pillow 105.2/144: 73% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.450 breath U obliterate Fluffy_Pillow 102.2/144: 71% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.486 breath R howling_blast Fluffy_Pillow 111.2/144: 77% runic_power
0.0/6: 0% rune
bloodlust, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:31.522 Waiting     1.687 sec 103.2/144: 72% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:33.209 breath T obliterate Fluffy_Pillow 71.2/144: 49% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:34.247 breath U obliterate Fluffy_Pillow 75.2/144: 52% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:35.282 Waiting     0.981 sec 79.2/144: 55% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_earth
0:36.263 cooldowns c empower_rune_weapon Fluffy_Pillow 68.2/144: 47% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_earth
0:36.263 breath T obliterate Fluffy_Pillow 73.2/144: 51% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_earth
0:37.163 breath R howling_blast Fluffy_Pillow 93.2/144: 65% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
0:38.065 breath U obliterate Fluffy_Pillow 90.2/144: 63% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
0:38.963 breath R howling_blast Fluffy_Pillow 94.2/144: 65% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
0:39.865 breath U obliterate Fluffy_Pillow 91.2/144: 63% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
0:40.766 breath R howling_blast Fluffy_Pillow 95.2/144: 66% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
0:41.935 breath Q remorseless_winter Fluffy_Pillow 92.2/144: 64% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
0:43.106 breath U obliterate Fluffy_Pillow 86.2/144: 60% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
0:44.277 breath U obliterate Fluffy_Pillow 74.2/144: 52% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
0:45.448 cooldowns g pillar_of_frost Fluffy_Pillow 83.2/144: 58% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
0:45.448 Waiting     0.824 sec 83.2/144: 58% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
0:46.272 breath U obliterate Fluffy_Pillow 72.2/144: 50% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), pillar_of_frost, remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
0:47.442 Waiting     1.750 sec 81.2/144: 56% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_earth
0:49.192 breath U obliterate Fluffy_Pillow 49.2/144: 34% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_earth
0:50.362 breath R howling_blast Fluffy_Pillow 53.2/144: 37% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth
0:51.533 breath U obliterate Fluffy_Pillow 50.2/144: 35% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_earth
0:52.702 breath R howling_blast Fluffy_Pillow 59.2/144: 41% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_earth
0:53.873 breath U obliterate Fluffy_Pillow 51.2/144: 36% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:55.043 breath R howling_blast Fluffy_Pillow 60.0/144: 42% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:56.213 breath U obliterate Fluffy_Pillow 37.9/144: 26% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:57.385 breath U obliterate Fluffy_Pillow 52.9/144: 37% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:58.730 Waiting     0.296 sec 61.7/144: 43% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
0:59.026 breath U obliterate Fluffy_Pillow 61.7/144: 43% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:00.369 breath S horn_of_winter Fluffy_Pillow 60.7/144: 42% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:01.712 breath Q remorseless_winter Fluffy_Pillow 81.9/144: 57% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:03.280 breath T obliterate Fluffy_Pillow 68.5/144: 48% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:04.622 breath R howling_blast Fluffy_Pillow 77.3/144: 54% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:05.966 breath U obliterate Fluffy_Pillow 74.3/144: 52% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:07.312 breath R howling_blast Fluffy_Pillow 67.3/144: 47% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:08.657 breath T obliterate Fluffy_Pillow 59.3/144: 41% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:10.000 breath R howling_blast Fluffy_Pillow 68.3/144: 47% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:11.345 breath U obliterate Fluffy_Pillow 49.3/144: 34% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:12.689 breath R howling_blast Fluffy_Pillow 58.3/144: 40% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:14.034 breath Z arcane_torrent Fluffy_Pillow 50.3/144: 35% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
1:15.379 breath T obliterate Fluffy_Pillow 43.3/144: 30% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_earth
1:16.724 breath R howling_blast Fluffy_Pillow 47.3/144: 33% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_earth
1:18.070 breath U obliterate Fluffy_Pillow 44.3/144: 31% runic_power
5.0/6: 83% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_earth
1:19.415 breath U obliterate Fluffy_Pillow 32.3/144: 22% runic_power
4.0/6: 67% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_earth
1:20.759 breath U obliterate Fluffy_Pillow 36.3/144: 25% runic_power
2.0/6: 33% rune
breath_of_sindragosa, icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_earth
1:22.104 breath R howling_blast Fluffy_Pillow 50.3/144: 35% runic_power
0.0/6: 0% rune
breath_of_sindragosa, icy_talons(3), killing_machine, rime, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_earth
1:23.449 breath Q remorseless_winter Fluffy_Pillow 26.3/144: 18% runic_power
1.0/6: 17% rune
breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_earth
1:24.795 breath V death_and_decay Fluffy_Pillow 25.3/144: 18% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_earth
1:26.140 cooldowns g pillar_of_frost Fluffy_Pillow 19.3/144: 13% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:26.140 Waiting     0.106 sec 19.3/144: 13% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm, icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:26.246 single_target k obliterate Fluffy_Pillow 3.3/144: 2% runic_power
4.0/6: 67% rune
unholy_strength, gathering_storm, icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:27.591 single_target n obliterate Fluffy_Pillow 29.5/144: 20% runic_power
4.0/6: 67% rune
unholy_strength, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:28.935 single_target l howling_blast Fluffy_Pillow 60.5/144: 42% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:30.278 single_target k obliterate Fluffy_Pillow 70.4/144: 49% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:31.623 single_target q frost_strike Fluffy_Pillow 101.4/144: 70% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:32.967 single_target n obliterate Fluffy_Pillow 76.4/144: 53% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:34.310 single_target l howling_blast Fluffy_Pillow 101.2/144: 70% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:35.655 single_target n obliterate Fluffy_Pillow 111.2/144: 77% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:36.999 single_target l howling_blast Fluffy_Pillow 142.2/144: 99% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:38.344 default G frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, rune_of_hysteria, elemental_chaos_earth
1:39.689 default G frost_strike Fluffy_Pillow 131.4/144: 91% runic_power
2.0/6: 33% rune
icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy, rune_of_hysteria, elemental_chaos_earth
1:41.036 default G frost_strike Fluffy_Pillow 106.4/144: 74% runic_power
2.0/6: 33% rune
icy_talons(3), enduring_strength, unleashed_frenzy(2), elemental_chaos_earth
1:42.378 single_target n obliterate Fluffy_Pillow 81.4/144: 57% runic_power
3.0/6: 50% rune
icy_talons(3), enduring_strength, unleashed_frenzy(3), elemental_chaos_earth
1:43.721 single_target j remorseless_winter Fluffy_Pillow 101.4/144: 70% runic_power
2.0/6: 33% rune
icy_talons(3), rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:45.065 single_target l howling_blast Fluffy_Pillow 120.0/144: 83% runic_power
2.0/6: 33% rune
icy_talons(3), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:46.410 single_target m frost_strike Fluffy_Pillow 129.9/144: 90% runic_power
3.0/6: 50% rune
rune_mastery, gathering_storm, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:47.754 single_target n obliterate Fluffy_Pillow 111.1/144: 77% runic_power
4.0/6: 67% rune
rune_mastery, gathering_storm, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:49.099 single_target m frost_strike Fluffy_Pillow 142.1/144: 99% runic_power
2.0/6: 33% rune
rune_mastery, gathering_storm(3), icy_talons(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_earth
1:50.442 single_target m frost_strike Fluffy_Pillow 122.1/144: 85% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:51.786 single_target k obliterate Fluffy_Pillow 97.1/144: 67% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), elemental_chaos_earth
1:53.132 single_target n obliterate Fluffy_Pillow 117.1/144: 81% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
1:54.476 single_target l howling_blast Fluffy_Pillow 142.1/144: 99% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
1:55.820 single_target m frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
1:57.164 single_target k obliterate Fluffy_Pillow 129.0/144: 90% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_earth
1:58.509 single_target l howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_earth
1:59.853 cooldowns e abomination_limb Fluffy_Pillow 144.0/144: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_earth
2:01.345 cooldowns i raise_dead Fluffy_Pillow 144.0/144: 100% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_fire
2:01.345 single_target l howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_fire
2:02.690 default G frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, icy_talons(3), bonegrinder_crit(2), elemental_chaos_fire
2:04.034 single_target j remorseless_winter Fluffy_Pillow 119.0/144: 83% runic_power
6.0/6: 100% rune
unholy_strength, abomination_limb, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy, elemental_chaos_fire
2:05.377 cooldowns h breath_of_sindragosa Fluffy_Pillow 134.0/144: 93% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy, elemental_chaos_fire
2:05.377 trinkets r use_item_blazebinders_hoof Fluffy_Pillow 134.0/144: 93% runic_power
6.0/6: 100% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy, elemental_chaos_fire
2:05.377 breath T obliterate Fluffy_Pillow 134.0/144: 93% runic_power
6.0/6: 100% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy, bound_by_fire_and_blaze, elemental_chaos_fire
2:06.723 breath R howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(2), bound_by_fire_and_blaze(2), elemental_chaos_fire
2:08.067 Waiting     0.377 sec 120.0/144: 83% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), elemental_chaos_fire
2:08.444 breath X obliterate Fluffy_Pillow 109.0/144: 76% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
2:09.790 breath R howling_blast Fluffy_Pillow 117.8/144: 82% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, elemental_chaos_fire
2:11.131 breath X obliterate Fluffy_Pillow 111.7/144: 78% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, elemental_chaos_fire
2:12.475 cooldowns g pillar_of_frost Fluffy_Pillow 104.5/144: 73% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_fire
2:12.475 breath R howling_blast Fluffy_Pillow 104.5/144: 73% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_fire
2:13.820 breath U obliterate Fluffy_Pillow 98.4/144: 68% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_fire
2:15.166 breath T obliterate Fluffy_Pillow 113.4/144: 79% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_fire
2:16.512 breath R howling_blast Fluffy_Pillow 106.2/144: 74% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_fire
2:17.857 breath U obliterate Fluffy_Pillow 98.2/144: 68% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), elemental_chaos_fire
2:19.201 breath U obliterate Fluffy_Pillow 107.2/144: 74% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(5), elemental_chaos_fire
2:20.544 breath R howling_blast Fluffy_Pillow 95.2/144: 66% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_fire
2:21.889 breath S horn_of_winter Fluffy_Pillow 87.2/144: 61% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_fire
2:23.233 breath T obliterate Fluffy_Pillow 101.2/144: 70% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), elemental_chaos_fire
2:24.577 breath Q remorseless_winter Fluffy_Pillow 89.2/144: 62% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_fire
2:25.920 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 85.6/144: 59% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:25.920 breath U obliterate Fluffy_Pillow 85.6/144: 59% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, elemental_chaos_fire
2:27.263 Waiting     1.192 sec 94.4/144: 66% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:28.455 cooldowns c empower_rune_weapon Fluffy_Pillow 68.6/144: 48% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:28.455 breath U obliterate Fluffy_Pillow 74.8/144: 52% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:29.625 breath R howling_blast Fluffy_Pillow 89.8/144: 62% runic_power
0.0/6: 0% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:30.796 Waiting     0.598 sec 83.8/144: 58% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:31.394 breath U obliterate Fluffy_Pillow 74.0/144: 51% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:32.565 breath R howling_blast Fluffy_Pillow 82.8/144: 57% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
2:33.735 breath T obliterate Fluffy_Pillow 89.8/144: 62% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
2:34.905 breath U obliterate Fluffy_Pillow 93.8/144: 65% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
2:36.077 breath R howling_blast Fluffy_Pillow 97.8/144: 68% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_fire
2:37.246 breath T obliterate Fluffy_Pillow 94.8/144: 66% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:38.416 breath U obliterate Fluffy_Pillow 93.8/144: 65% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:39.588 breath X obliterate Fluffy_Pillow 108.8/144: 76% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:40.756 Waiting     1.856 sec 117.6/144: 82% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:42.612 breath T obliterate Fluffy_Pillow 85.6/144: 59% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:43.783 breath R howling_blast Fluffy_Pillow 106.8/144: 74% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:44.955 breath Q remorseless_winter Fluffy_Pillow 100.7/144: 70% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_fire
2:46.126 Waiting     0.274 sec 94.7/144: 66% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:46.400 breath U obliterate Fluffy_Pillow 78.7/144: 55% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:47.571 breath R howling_blast Fluffy_Pillow 87.5/144: 61% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:48.742 breath T obliterate Fluffy_Pillow 87.6/144: 61% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:50.087 Waiting     0.607 sec 96.4/144: 67% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:50.694 breath T obliterate Fluffy_Pillow 80.4/144: 56% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:52.038 cooldowns g pillar_of_frost Fluffy_Pillow 89.2/144: 62% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:52.038 breath R howling_blast Fluffy_Pillow 89.2/144: 62% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:53.381 Waiting     2.018 sec 73.3/144: 51% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_fire
2:55.399 breath U obliterate Fluffy_Pillow 46.3/144: 32% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), elemental_chaos_fire
2:56.743 breath T obliterate Fluffy_Pillow 50.3/144: 35% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:58.086 breath R howling_blast Fluffy_Pillow 59.1/144: 41% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:59.431 Waiting     0.126 sec 37.0/144: 26% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
2:59.557 breath U obliterate Fluffy_Pillow 37.0/144: 26% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_fire
3:00.903 Waiting     2.474 sec 52.0/144: 36% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:03.377 breath T obliterate Fluffy_Pillow 10.2/144: 7% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:04.721 single_target j remorseless_winter Fluffy_Pillow 35.0/144: 24% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:06.300 single_target n obliterate Fluffy_Pillow 50.0/144: 35% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:07.644 single_target l howling_blast Fluffy_Pillow 70.0/144: 49% runic_power
0.0/6: 0% rune
rune_mastery, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:08.989 single_target o horn_of_winter Fluffy_Pillow 83.0/144: 58% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:10.335 default G frost_strike Fluffy_Pillow 113.0/144: 79% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, elemental_chaos_frost
3:11.680 default G frost_strike Fluffy_Pillow 88.0/144: 61% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy, elemental_chaos_frost
3:13.025 default G frost_strike Fluffy_Pillow 68.0/144: 47% runic_power
4.0/6: 67% rune
unholy_strength, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(2), elemental_chaos_frost
3:14.368 single_target k obliterate Fluffy_Pillow 43.0/144: 30% runic_power
6.0/6: 100% rune
unholy_strength, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:15.712 single_target l howling_blast Fluffy_Pillow 63.0/144: 44% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:17.056 single_target k obliterate Fluffy_Pillow 71.0/144: 49% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:18.401 single_target k obliterate Fluffy_Pillow 101.0/144: 70% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), elemental_chaos_frost
3:19.747 default G frost_strike Fluffy_Pillow 121.0/144: 84% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(3), elemental_chaos_frost
3:21.093 default G frost_strike Fluffy_Pillow 96.0/144: 67% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy, elemental_chaos_frost
3:22.437 default G frost_strike Fluffy_Pillow 71.0/144: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(2), rune_of_hysteria, elemental_chaos_frost
3:23.782 single_target n obliterate Fluffy_Pillow 46.0/144: 32% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:25.126 single_target j remorseless_winter Fluffy_Pillow 70.8/144: 49% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:26.471 single_target k obliterate Fluffy_Pillow 83.2/144: 58% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:27.816 cooldowns g pillar_of_frost Fluffy_Pillow 114.2/144: 79% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:27.816 single_target l howling_blast Fluffy_Pillow 114.2/144: 79% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(2), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:29.160 default G frost_strike Fluffy_Pillow 124.2/144: 86% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), rune_of_hysteria, elemental_chaos_frost
3:30.504 default G frost_strike Fluffy_Pillow 105.4/144: 73% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy, elemental_chaos_frost
3:31.850 default G frost_strike Fluffy_Pillow 80.4/144: 56% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(2), elemental_chaos_frost
3:33.194 single_target n obliterate Fluffy_Pillow 55.4/144: 38% runic_power
3.0/6: 50% rune
unholy_strength, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_frost
3:34.538 single_target l howling_blast Fluffy_Pillow 75.4/144: 52% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_frost
3:35.883 single_target k obliterate Fluffy_Pillow 83.4/144: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), elemental_chaos_frost
3:37.227 single_target p arcane_torrent Fluffy_Pillow 103.4/144: 72% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_frost
3:38.571 default G frost_strike Fluffy_Pillow 123.4/144: 86% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(5), enduring_strength_builder, elemental_chaos_frost
3:39.913 default G frost_strike Fluffy_Pillow 103.4/144: 72% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy, elemental_chaos_frost
3:41.257 default G frost_strike Fluffy_Pillow 78.4/144: 54% runic_power
2.0/6: 33% rune
icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(2), elemental_chaos_frost
3:42.600 single_target k obliterate Fluffy_Pillow 58.4/144: 41% runic_power
3.0/6: 50% rune
icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_chaos_frost
3:43.944 single_target k obliterate Fluffy_Pillow 78.4/144: 54% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:45.287 single_target j remorseless_winter Fluffy_Pillow 103.2/144: 72% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:46.632 single_target l howling_blast Fluffy_Pillow 115.6/144: 80% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_frost
3:47.976 default G frost_strike Fluffy_Pillow 125.5/144: 87% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, rune_of_hysteria, elemental_chaos_frost
3:49.321 default G frost_strike Fluffy_Pillow 106.7/144: 74% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy, rune_of_hysteria, elemental_chaos_frost
3:50.665 default G frost_strike Fluffy_Pillow 87.9/144: 61% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(2), elemental_chaos_frost
3:52.010 single_target n obliterate Fluffy_Pillow 62.9/144: 44% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), elemental_chaos_frost
3:53.353 single_target l howling_blast Fluffy_Pillow 82.9/144: 58% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_frost
3:54.698 single_target k obliterate Fluffy_Pillow 90.9/144: 63% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), elemental_chaos_frost
3:56.043 Waiting     3.797 sec 110.9/144: 77% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), elemental_chaos_frost
3:59.840 cooldowns e abomination_limb Fluffy_Pillow 115.9/144: 80% runic_power
1.0/6: 17% rune
icy_talons(3), bonegrinder_crit, elemental_chaos_frost
4:01.302 cooldowns i raise_dead Fluffy_Pillow 115.9/144: 80% runic_power
1.0/6: 17% rune
abomination_limb, rime, bonegrinder_crit, elemental_chaos_air
4:01.345 single_target l howling_blast Fluffy_Pillow 120.9/144: 84% runic_power
1.0/6: 17% rune
abomination_limb, killing_machine, rime, bonegrinder_crit, elemental_chaos_air
4:02.645 single_target k obliterate Fluffy_Pillow 128.9/144: 90% runic_power
3.0/6: 50% rune
rune_mastery, abomination_limb, killing_machine, bonegrinder_crit, elemental_chaos_air
4:03.946 default G frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, abomination_limb, bonegrinder_crit(2), elemental_chaos_air
4:05.247 cooldowns h breath_of_sindragosa Fluffy_Pillow 119.0/144: 83% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons, bonegrinder_crit(2), unleashed_frenzy, elemental_chaos_air
4:05.377 trinkets r use_item_blazebinders_hoof Fluffy_Pillow 119.0/144: 83% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons, bonegrinder_crit(2), unleashed_frenzy, elemental_chaos_air
4:05.377 breath Q remorseless_winter Fluffy_Pillow 119.0/144: 83% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons, bonegrinder_crit(2), unleashed_frenzy, bound_by_fire_and_blaze, elemental_chaos_air
4:06.677 cooldowns g pillar_of_frost Fluffy_Pillow 123.0/144: 85% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(2), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(2), bound_by_fire_and_blaze(3), elemental_chaos_air
4:06.677 breath U obliterate Fluffy_Pillow 123.0/144: 85% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(2), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(2), bound_by_fire_and_blaze(3), elemental_chaos_air
4:07.978 breath R howling_blast Fluffy_Pillow 127.0/144: 88% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_air
4:09.279 breath U obliterate Fluffy_Pillow 119.0/144: 83% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_air
4:10.580 breath T obliterate Fluffy_Pillow 112.0/144: 78% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_air
4:11.881 breath U obliterate Fluffy_Pillow 116.0/144: 81% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_air
4:13.183 breath R howling_blast Fluffy_Pillow 120.0/144: 83% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_air
4:14.483 breath S horn_of_winter Fluffy_Pillow 101.0/144: 70% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), elemental_chaos_air
4:15.784 breath U obliterate Fluffy_Pillow 115.0/144: 80% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_air
4:17.084 Waiting     0.303 sec 123.8/144: 86% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_air
4:17.387 breath U obliterate Fluffy_Pillow 114.0/144: 79% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, elemental_chaos_air
4:18.686 breath R howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
0.0/6: 0% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, elemental_chaos_air
4:19.985 breath T obliterate Fluffy_Pillow 121.9/144: 85% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_air
4:21.285 breath R howling_blast Fluffy_Pillow 134.2/144: 93% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_air
4:22.586 breath X obliterate Fluffy_Pillow 112.0/144: 78% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_air
4:23.885 Waiting     1.308 sec 120.8/144: 84% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_air
4:25.193 breath Q remorseless_winter Fluffy_Pillow 104.8/144: 73% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, elemental_chaos_air
4:26.675 trinkets s use_item_dragon_games_equipment Fluffy_Pillow 85.2/144: 59% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:26.675 Waiting     0.768 sec 85.2/144: 59% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, elemental_chaos_air
4:27.443 cooldowns c empower_rune_weapon Fluffy_Pillow 69.2/144: 48% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:27.443 Waiting     0.166 sec 75.4/144: 52% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:27.609 breath U obliterate Fluffy_Pillow 75.4/144: 52% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:28.742 Waiting     3.259 sec 90.4/144: 63% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:32.001 breath T obliterate Fluffy_Pillow 54.8/144: 38% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:33.132 Waiting     2.005 sec 69.8/144: 48% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:35.137 breath U obliterate Fluffy_Pillow 37.8/144: 26% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:36.269 breath R howling_blast Fluffy_Pillow 52.8/144: 37% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:37.400 breath U obliterate Fluffy_Pillow 36.9/144: 26% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:38.532 breath U obliterate Fluffy_Pillow 51.9/144: 36% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:39.663 breath U obliterate Fluffy_Pillow 66.9/144: 46% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:40.795 breath R howling_blast Fluffy_Pillow 75.7/144: 53% runic_power
0.0/6: 0% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:41.927 Waiting     0.573 sec 69.6/144: 48% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:42.500 breath U obliterate Fluffy_Pillow 66.0/144: 46% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:43.632 breath U obliterate Fluffy_Pillow 81.0/144: 56% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:44.765 Waiting     0.379 sec 89.8/144: 62% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:45.144 breath Q remorseless_winter Fluffy_Pillow 96.0/144: 67% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:46.508 Waiting     0.488 sec 76.4/144: 53% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:46.996 breath U obliterate Fluffy_Pillow 82.6/144: 57% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, elemental_chaos_air
4:48.127 cooldowns f pillar_of_frost Fluffy_Pillow 97.6/144: 68% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_air
4:48.127 breath U obliterate Fluffy_Pillow 97.6/144: 68% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, gathering_storm(2), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_air
4:49.428 breath U obliterate Fluffy_Pillow 85.6/144: 59% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_chaos_air
4:50.728 breath R howling_blast Fluffy_Pillow 89.6/144: 62% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_air
4:52.027 breath U obliterate Fluffy_Pillow 86.6/144: 60% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), elemental_chaos_air
4:53.328 breath U obliterate Fluffy_Pillow 90.6/144: 63% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_air
4:54.629 breath R howling_blast Fluffy_Pillow 78.6/144: 55% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_air
4:55.929 breath T obliterate Fluffy_Pillow 70.6/144: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), elemental_chaos_air
4:57.230 breath R howling_blast Fluffy_Pillow 79.6/144: 55% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_air
4:58.532 Waiting     0.769 sec 55.6/144: 39% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_air
4:59.301 breath S horn_of_winter Fluffy_Pillow 55.6/144: 39% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), elemental_chaos_air

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5770 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3463 0 13076 12453 6915
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 261520 249060 0
Runic Power 144 144 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 24.64% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 9.52% 3.34% 685
Attack Power 6058 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +687 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +89 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +386 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_1_manual,value=trinket.1.is.algethar_puzzle_box
actions.precombat+=/variable,name=trinket_2_manual,value=trinket.2.is.algethar_puzzle_box
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# When using 'external_buffs.pool', will use this lines logic to determine when to use Power Infusion.
actions+=/invoke_external_buff,name=power_infusion,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains_expected>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains_expected<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains_expected<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

actions.trinkets=use_item,name=algethar_puzzle_box,if=cooldown.pillar_of_frost.remains<2
# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets+=/use_item,slot=trinket1,if=!variable.trinket_1_manual&(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(variable.trinket_2_exclude|!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=!variable.trinket_2_manual&(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(variable.trinket_1_exclude|!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains_expected>20|!talent.pillar_of_frost)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=6915
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 45750 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45750.3 45750.3 45.6 / 0.100% 7406.9 / 16.2% 2575.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.9 7.9 Runic Power 2.52% 52.9 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 45750
Apocalypse 212 0.5% 6.9 45.71sec 9155 7225 Direct 6.9 7859 15785 9156 16.4%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 0.00 1.2672 0.0000 63515.30 63515.30 0.00% 7225.04 7225.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.65% 5.80 1 8 7859.39 6078 10788 7851.95 6893 8959 45609 45609 0.00%
crit 16.35% 1.13 0 6 15784.83 12599 22246 11209.39 0 20660 17907 17907 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=20 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    garg_setup
    [S]:6.94
  • if_expr:buff.commander_of_the_dead_window.up|cooldown.dark_transformation.remains>20|!talent.commander_of_the_dead&debuff.festering_wound.stack>=4
auto_attack_mh 2778 6.1% 153.5 2.35sec 5426 2322 Direct 153.5 4663 9373 5426 16.2%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.53 153.53 0.00 0.00 0.00 2.3367 0.0000 833059.90 1190115.91 30.00% 2322.13 2322.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.81% 128.67 81 172 4663.38 3725 6659 4662.82 4408 4936 600018 857190 30.00%
crit 16.19% 24.86 9 48 9373.37 7451 13139 9371.61 8333 10431 233042 332926 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Dark Transformation 191 0.4% 7.0 45.86sec 8231 6496 Direct 7.0 7064 14200 8231 16.3%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 1.2672 0.0000 57422.46 57422.46 0.00% 6495.75 6495.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.65% 5.84 1 8 7064.30 5546 9951 7058.36 6100 8272 41229 41229 0.00%
crit 16.35% 1.14 0 6 14200.09 11963 19301 10004.82 0 18661 16194 16194 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [O]:4.75
  • if_expr:variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd*2|cooldown.apocalypse.remains>30|!talent.commander_of_the_dead)
    garg_setup
    [X]:2.22
  • if_expr:talent.commander_of_the_dead&debuff.festering_wound.stack>=4|!talent.commander_of_the_dead
Death Coil 4602 (5960) 10.1% (13.1%) 99.5 2.99sec 17935 15517 Direct 99.5 (234.9) 11905 23920 13856 16.2% (16.2%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 99.51 99.47 0.00 0.00 0.00 1.1559 0.0000 1378197.47 1378197.47 0.00% 15517.02 15517.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.77% 83.32 54 117 11905.30 7432 19770 11914.68 11152 12849 991975 991975 0.00%
crit 16.23% 16.15 4 33 23920.20 15104 39539 23938.80 19683 28773 386223 386223 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    default
    [F]:4.74
  • if_expr:(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd*1.1&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
    garg_setup
    [Z]:1.29
  • if_expr:rune<=1
    generic
    [b]:93.49
  • if_expr:!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10
    Coil of Devastation 1358 3.0% 0.0 0.00sec 0 0 Periodic 135.4 3003 0 3003 0.0% 90.3%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 135.41 135.41 84.91 0.0000 2.0000 406616.16 406616.16 0.00% 1501.44 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 135.41 102 170 3002.89 1115 12614 3009.06 2591 3634 406616 406616 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 723 1.6% 5.5 46.88sec 39140 0 Direct 5.5 33627 67585 39172 16.3%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 5.54 0.00 0.00 0.00 0.0000 0.0000 216974.67 309971.71 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.67% 4.63 0 6 33626.62 33373 34365 33617.78 0 34365 155833 222625 29.99%
crit 16.33% 0.90 0 5 67585.27 66746 68730 41954.56 0 68730 61141 87347 18.62%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1112 2.4% 26.3 11.06sec 12695 10530 Direct 26.3 10898 21919 12695 16.3%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.29 26.29 0.00 0.00 0.00 1.2055 0.0000 333752.48 476801.41 30.00% 10530.46 10530.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.70% 22.01 12 35 10898.17 8211 17610 10892.58 9828 11827 239821 342611 30.00%
crit 16.30% 4.29 0 14 21919.10 16421 34368 21650.74 0 29895 93931 134191 29.66%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    garg_setup
    [Y]:2.23
  • if_expr:!variable.pop_wounds&debuff.festering_wound.stack<4&talent.apocalypse|!variable.pop_wounds&debuff.festering_wound.stack<1&!talent.apocalypse
  • target_if_expr:debuff.festering_wound.stack
    generic
    [d]:24.07
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1797 3.9% 105.8 3.46sec 5091 0 Direct 105.8 4371 8785 5091 16.3%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 105.84 105.84 0.00 0.00 0.00 0.0000 0.0000 538834.84 538834.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.68% 88.56 59 119 4370.51 3020 7607 4371.09 4055 4677 387053 387053 0.00%
crit 16.32% 17.28 3 35 8784.56 6039 15214 8787.37 7452 10491 151781 151781 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 78 0.2% 11.6 27.04sec 2021 1720 Direct 11.6 1736 3493 2021 16.2%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 1.1754 0.0000 23493.91 23493.91 0.00% 1719.53 1719.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.76% 9.74 4 14 1735.86 1216 2937 1736.35 1463 2066 16901 16901 0.00%
crit 16.24% 1.89 0 7 3492.89 2431 5957 3029.42 0 5853 6593 6593 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    default
    [G]:11.62
  • target_if_expr:target.time_to_die>dot.virulent_plague.remains&(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
Scourge Strike 997 (2320) 2.2% (5.1%) 79.1 3.69sec 8792 7729 Direct 79.1 (158.2) 3246 6527 3780 16.3% (16.2%)

Stats Details: Scourge Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 79.12 79.12 0.00 0.00 0.00 1.1375 0.0000 299050.02 427225.21 30.00% 7729.15 7729.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.74% 66.26 40 90 3246.26 2381 5184 3245.77 3036 3444 215089 307277 30.00%
crit 16.26% 12.86 2 28 6527.34 4763 10269 6526.59 5171 8091 83961 119948 30.00%

Action Details: Scourge Strike

  • id:55090
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:
  • description:An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.

Action Priority List

    garg_setup
    [a]:1.29
  • if_expr:debuff.festering_wound.stack>4|debuff.festering_wound.stack>=1&!talent.apocalypse
  • target_if_expr:debuff.festering_wound.stack
    generic
    [c]:77.82
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    Scourge Strike (_shadow) 1323 2.9% 0.0 0.00sec 0 0 Direct 79.1 4307 8652 5012 16.2%

Stats Details: Scourge Strike Shadow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 79.12 0.00 0.00 0.00 0.0000 0.0000 396549.99 396549.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.78% 66.29 43 91 4307.38 2704 7191 4309.41 4017 4622 285531 285531 0.00%
crit 16.22% 12.83 1 30 8652.04 5407 14333 8657.66 6994 10747 111019 111019 0.00%

Action Details: Scourge Strike Shadow

  • id:70890
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:70890
  • name:Scourge Strike
  • school:shadow
  • tooltip:
  • description:{$@spelldesc55090=An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.}
Soul Reaper 482 (2792) 1.1% (6.1%) 15.6 6.91sec 53678 43978 Direct 15.6 (31.1) 7960 15968 9260 16.2% (16.2%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.58 15.58 0.00 0.00 0.00 1.2206 0.0000 144256.08 144256.08 0.00% 43978.47 43978.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.77% 13.05 5 19 7960.15 4867 12093 7971.56 6994 9197 103873 103873 0.00%
crit 16.23% 2.53 0 10 15967.63 10002 24102 14915.40 0 23407 40383 40383 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [R]:15.21
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
    garg_setup
    [U]:0.36
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
    Soul Reaper (_execute) 2311 5.1% 15.6 6.91sec 44442 0 Direct 15.6 38208 76820 44442 16.1%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.57 15.57 0.00 0.00 0.00 0.0000 0.0000 691950.61 691950.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.86% 13.06 6 19 38208.07 27997 55101 38257.99 34440 43442 498846 498846 0.00%
crit 16.14% 2.51 0 9 76820.11 60385 109819 71512.69 0 108651 193105 193105 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 197 0.4% 3.6 91.67sec 16187 14094 Direct 3.6 13929 28021 16187 16.0%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 0.00 1.1486 0.0000 58954.37 58954.37 0.00% 14093.80 14093.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.98% 3.06 0 4 13929.01 11318 16955 13897.52 0 16955 42602 42602 0.00%
crit 16.02% 0.58 0 4 28021.46 22636 33911 13212.63 0 33911 16352 16352 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [Q]:3.64
  • if_expr:variable.st_planning
  • target_if_expr:debuff.festering_wound.stack
Unholy Pact 1277 2.8% 122.8 2.65sec 3117 0 Direct 122.8 2679 5380 3117 16.2%

Stats Details: Unholy Pact

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.76 122.76 0.00 0.00 0.00 0.0000 0.0000 382677.59 382677.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.78% 102.85 69 133 2679.16 1819 4354 2679.84 2436 2897 275542 275542 0.00%
crit 16.22% 19.92 4 41 5379.59 3711 8709 5383.13 4555 6387 107135 107135 0.00%

Action Details: Unholy Pact

  • id:319236
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:319236
  • name:Unholy Pact
  • school:shadow
  • tooltip:Deals {$s1=0} Shadow damage.
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
Virulent Plague 839 1.8% 11.6 27.04sec 21639 0 Periodic 99.5 2172 4364 2528 16.3% 99.5%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 0.00 99.49 99.49 10.59 0.0000 3.0000 251533.76 251533.76 0.00% 842.73 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.74% 83.32 55 110 2171.74 1520 3828 2171.97 2059 2298 180945 180945 0.00%
crit 16.26% 16.17 3 34 4364.41 3039 7557 4365.38 3828 5133 70589 70589 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 5764 / 5764
Claw 296 0.7% 37.9 7.84sec 2353 2343 Direct 37.9 2026 4047 2353 16.2%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.88 37.88 0.00 0.00 0.00 1.0045 0.0000 89157.16 127370.61 30.00% 2342.91 2342.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.79% 31.74 18 47 2025.72 1654 6510 2024.11 1838 2240 64301 91861 30.00%
crit 16.21% 6.14 0 18 4046.86 3308 5590 4032.88 0 4731 24856 35509 29.92%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:37.88
  • if_expr:energy>70
Gnaw 0 0.0% 0.4 90.09sec 80 80 Direct 0.4 69 139 80 16.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.36 0.36 0.00 0.00 0.00 1.0080 0.0000 28.66 40.94 30.00% 79.82 79.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.98% 0.30 0 2 69.34 58 85 15.23 0 83 21 30 6.60%
crit 16.02% 0.06 0 2 138.72 117 166 7.47 0 166 8 11 1.62%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:0.36
main_hand 4116 9.0% 193.3 1.54sec 6373 4138 Direct 193.3 5481 10966 6373 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.30 193.30 0.00 0.00 0.00 1.5400 0.0000 1231798.83 1759757.49 30.00% 4137.90 4137.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.75% 161.88 116 206 5481.08 1838 12800 5490.94 4881 6277 887278 1267572 30.00%
crit 16.25% 31.42 12 55 10966.05 3676 25601 10983.64 7237 15761 344521 492186 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Monstrous Blow 30 0.1% 3.3 91.13sec 2716 2705 Direct 3.3 2334 4673 2716 16.4%

Stats Details: Monstrous Blow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.32 3.32 0.00 0.00 0.00 1.0045 0.0000 9015.57 12879.72 30.00% 2704.94 2704.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.63% 2.78 0 4 2333.67 1842 3165 2322.55 0 2970 6478 9254 29.79%
crit 16.37% 0.54 0 4 4673.04 3685 6125 2048.05 0 6024 2538 3626 13.14%

Action Details: Monstrous Blow

  • id:91797
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91797
  • name:Monstrous Blow
  • school:physical
  • tooltip:Stunned.
  • description:Strike an enemy with a smashing attack, dealing {$s2=0} Physical damage and stunning for {$d=2 seconds}.

Action Priority List

    default
    [ ]:3.32
Sweeping Claws 1321 2.9% 69.0 4.24sec 5731 5705 Direct 69.0 4932 9849 5731 16.3%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.96 68.96 0.00 0.00 0.00 1.0045 0.0000 395197.08 395197.08 0.00% 5705.33 5705.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.74% 57.75 38 78 4931.68 3545 8229 4934.69 4578 5326 284799 284799 0.00%
crit 16.26% 11.21 1 23 9848.61 7090 16458 9855.22 7410 15390 110398 110398 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:68.96
pet - gargoyle 31436 / 5306
Gargoyle Strike 31436 11.5% 40.4 5.16sec 38860 36431 Direct 40.4 33423 66784 38860 16.3%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.45 40.45 0.00 0.00 0.00 1.0667 0.0000 1571779.01 1571779.01 0.00% 36431.00 36431.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.70% 33.86 23 41 33422.99 7133 74913 33420.58 27577 40536 1131551 1131551 0.00%
crit 16.30% 6.59 0 17 66783.97 13188 144528 66806.24 0 123083 440228 440228 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.

Action Priority List

    default
    [ ]:42.45
pet - risen_skulker 1132 / 1132
Skulker Shot 1132 2.5% 155.2 1.93sec 2186 1134 Direct 155.1 1881 3757 2187 16.3%

Stats Details: Skulker Shot

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.17 155.11 0.00 0.00 0.00 1.9268 0.0000 339177.93 484552.26 30.00% 1134.43 1134.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.71% 129.85 94 169 1881.09 1395 3238 1881.90 1788 2005 244253 348941 30.00%
crit 16.29% 25.26 8 47 3757.26 2789 6475 3759.96 3328 4519 94925 135611 30.00%

Action Details: Skulker Shot

  • id:212423
  • school:physical
  • range:35.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:212423
  • name:Skulker Shot
  • school:physical
  • tooltip:
  • description:A ranged shot that causes Physical damage.

Action Priority List

    default
    [ ]:156.17
pet - army_ghoul 24432 / 5404
Claw 4002 1.9% 215.3 1.00sec 1218 1218 Direct 215.3 1048 2093 1218 16.2%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 215.30 215.30 0.00 0.00 0.00 1.0000 0.0000 262128.81 374479.28 30.00% 1217.50 1217.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.78% 180.37 144 201 1047.97 482 1511 1047.74 883 1150 189025 270043 30.00%
crit 16.22% 34.93 15 58 2092.97 964 3023 2093.60 1635 2417 73103 104436 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:26.87
    default
    [ ]:26.87
    default
    [ ]:26.90
    default
    [ ]:26.92
    default
    [ ]:26.93
    default
    [ ]:26.94
    default
    [ ]:26.93
    default
    [ ]:26.94
main_hand 20430 9.8% 353.9 0.60sec 3781 3411 Direct 353.9 3254 6505 3781 16.2%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 353.91 353.91 0.00 0.00 0.00 1.1086 0.0000 1338134.32 1911669.20 30.00% 3410.60 3410.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.80% 296.57 248 330 3254.18 1443 4523 3254.00 2698 3553 965084 1378726 30.00%
crit 16.20% 57.35 30 91 6505.20 2886 9046 6507.67 5270 7267 373050 532943 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - magus_of_the_dead 7751 / 3962
Frostbolt 2300 2.6% 41.6 7.11sec 8433 5893 Direct 41.6 7265 14508 8436 16.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.64 41.63 0.00 0.00 0.00 1.4311 0.0000 351178.36 351178.36 0.00% 5892.85 5892.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.83% 34.90 21 46 7265.00 3694 11419 7268.45 6532 8045 253535 253535 0.00%
crit 16.17% 6.73 0 17 14508.07 7387 22527 14507.67 0 21196 97643 97643 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:22.35
    default
    [ ]:22.30
Shadow Bolt 5451 6.1% 98.8 2.94sec 8408 6554 Direct 98.7 7238 14448 8410 16.2%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 98.75 98.73 0.00 0.00 0.00 1.2829 0.0000 830254.22 830254.22 0.00% 6553.64 6553.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.75% 82.69 62 103 7238.49 3474 10886 7241.21 6583 7808 598524 598524 0.00%
crit 16.25% 16.04 4 30 14447.79 6947 21772 14457.56 11177 17580 231730 231730 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:52.38
    default
    [ ]:52.30
pet - apoc_ghoul 8694 / 3905
Claw 1619 1.6% 197.2 1.43sec 1104 1104 Direct 197.2 951 1899 1104 16.2%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 197.18 197.18 0.00 0.00 0.00 1.0000 0.0000 217746.18 311073.91 30.00% 1104.31 1104.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.80% 165.23 113 214 950.68 571 1511 951.64 866 1042 157080 224405 30.00%
crit 16.20% 31.95 11 58 1898.77 1193 3023 1901.31 1611 2202 60667 86669 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:49.29
    default
    [ ]:49.40
    default
    [ ]:49.35
    default
    [ ]:49.13
main_hand 7075 7.0% 280.0 1.00sec 3398 2461 Direct 280.0 2925 5842 3398 16.2%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 279.97 279.97 0.00 0.00 0.00 1.3809 0.0000 951383.68 1359154.19 30.00% 2460.93 2460.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.79% 234.59 161 300 2925.40 1785 4523 2929.03 2676 3205 686272 980413 30.00%
crit 16.21% 45.38 18 78 5842.43 3570 9046 5851.64 5028 6721 265112 378741 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Army of the Dead 2.0 0.00sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 0.6571 0.4688 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    default
    [E]:1.00
  • if_expr:talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=34
    garg_setup
    [T]:0.00
  • if_expr:talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 183.66sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [e]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 167.98sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.41 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [P]:2.41
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 306.66sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [N]:0.49
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
    garg_setup
    [W]:1.00
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Algeth'ar Puzzle (solved_the_puzzle) 2.0 183.90sec

Stats Details: Solved The Puzzle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Solved The Puzzle

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
Summon Gargoyle 2.0 183.64sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    garg_setup
    [V]:2.00
  • if_expr:buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>40
Unholy Strength 21.7 13.45sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 0.0 183.9sec 183.9sec 20.0sec 13.52% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3273.11
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3273.11

Trigger Details

  • interval_min/max:180.4s / 202.7s
  • trigger_min/max:180.4s / 202.7s
  • trigger_pct:100.00%
  • duration_min/max:20.0s / 20.0s

Stack Uptimes

  • algethar_puzzle_1:13.52%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 183.6sec 183.6sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 198.5s
  • trigger_min/max:180.0s / 198.5s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
commander_of_the_dead_window 7.0 0.0 45.9sec 45.9sec 4.0sec 9.27% 49.89% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead_window
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 65.7s
  • trigger_min/max:45.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s

Stack Uptimes

  • commander_of_the_dead_window_1:9.27%
Dark Transformation 7.0 0.0 45.9sec 45.9sec 22.5sec 52.35% 59.08% 0.0 (0.0) 6.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 65.7s
  • trigger_min/max:45.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s

Stack Uptimes

  • dark_transformation_1:52.35%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.0sec 120.0sec 0.6sec 0.56% 0.00% 5.5 (5.5) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.62
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 120.2s
  • trigger_min/max:120.0s / 120.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.6s

Stack Uptimes

  • dragon_games_equipment_1:0.56%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.5sec 96.9sec 58.5sec 25.50% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 325.6s

Stack Uptimes

  • elemental_chaos_air_1:25.50%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.3sec 98.9sec 57.7sec 24.68% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 316.6s

Stack Uptimes

  • elemental_chaos_earth_1:24.68%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.9sec 99.1sec 58.3sec 24.61% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:24.61%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.1sec 99.4sec 58.0sec 25.21% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.21%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.8sec 306.8sec 27.4sec 13.32% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 334.3s
  • trigger_min/max:300.0s / 334.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.32%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 168.0sec 168.0sec 19.3sec 15.43% 0.00% 7.0 (7.0) 2.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 204.1s
  • trigger_min/max:120.0s / 204.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.43%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Festermight 13.1 72.1 23.3sec 3.5sec 19.3sec 84.54% 0.00% 0.0 (0.0) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 46.8s
  • trigger_min/max:0.8s / 31.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:7.48%
  • festermight_2:8.85%
  • festermight_3:9.94%
  • festermight_4:14.46%
  • festermight_5:10.29%
  • festermight_6:8.40%
  • festermight_7:7.29%
  • festermight_8:5.97%
  • festermight_9:4.47%
  • festermight_10:3.25%
  • festermight_11:1.98%
  • festermight_12:1.10%
  • festermight_13:0.62%
  • festermight_14:0.35%
  • festermight_15:0.09%
  • festermight_16:0.01%
  • festermight_17:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 1.0 99.5 146.3sec 3.0sec 287.8sec 99.97% 90.19% 97.4 (97.4) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:41.9s / 331.1s
  • trigger_min/max:0.8s / 17.7s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 360.0s

Stack Uptimes

  • icy_talons_1:1.35%
  • icy_talons_2:0.38%
  • icy_talons_3:98.23%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 12.0 8.2 24.8sec 14.4sec 10.7sec 42.74% 0.00% 8.2 (8.2) 11.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 152.8s
  • trigger_min/max:0.8s / 147.0s
  • trigger_pct:15.04%
  • duration_min/max:0.0s / 68.2s

Stack Uptimes

  • rune_mastery_1:42.74%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 41.8 6.1 7.1sec 6.2sec 2.6sec 36.32% 0.00% 6.1 (6.1) 41.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 74.1s
  • trigger_min/max:0.8s / 74.1s
  • trigger_pct:47.57%
  • duration_min/max:0.0s / 19.3s

Stack Uptimes

  • runic_corruption_1:36.32%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 21.0 0.2 14.0sec 13.8sec 1.0sec 6.86% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.3s / 57.8s
  • trigger_min/max:1.3s / 57.8s
  • trigger_pct:14.20%
  • duration_min/max:0.0s / 8.3s

Stack Uptimes

  • sudden_doom_1:6.86%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.6 0.0 91.7sec 91.7sec 19.6sec 23.79% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 113.0s
  • trigger_min/max:90.0s / 113.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • unholy_assault_1:23.79%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Pact 7.0 0.0 45.9sec 45.9sec 14.7sec 34.22% 37.44% 95.8 (95.8) 6.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_pact
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:45.0s / 65.7s
  • trigger_min/max:45.0s / 65.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • unholy_pact_1:34.22%

Spelldata

  • id:319233
  • name:Unholy Pact
  • tooltip:
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.5 13.2 36.0sec 13.5sec 24.6sec 69.32% 0.00% 13.2 (13.2) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 186.4s
  • trigger_min/max:0.0s / 57.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.2s

Stack Uptimes

  • unholy_strength_1:69.32%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 45.9sec 45.9sec 19.5sec 99.94% 99.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 138.0s
  • trigger_min/max:45.0s / 138.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.94%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 45.8sec 45.8sec 19.5sec 99.94% 99.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 102.1s
  • trigger_min/max:45.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.94%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 45.8sec 45.8sec 19.5sec 99.94% 99.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 98.7s
  • trigger_min/max:45.0s / 98.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.94%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.8 0.0 46.0sec 46.0sec 19.5sec 99.94% 99.93% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 185.6s
  • trigger_min/max:45.0s / 185.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • commander_of_the_dead_1:99.94%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 184.8sec 184.8sec 27.4sec 90.53% 96.45% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.7s / 230.8s
  • trigger_min/max:180.7s / 230.8s
  • trigger_pct:100.00%
  • duration_min/max:9.2s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.53%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 184.6sec 184.6sec 27.5sec 90.26% 96.87% 0.0 (0.0) 0.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.1s / 230.3s
  • trigger_min/max:181.1s / 230.3s
  • trigger_pct:100.00%
  • duration_min/max:9.7s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.26%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 184.3sec 184.3sec 27.7sec 90.06% 96.88% 0.0 (0.0) 0.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 229.8s
  • trigger_min/max:180.8s / 229.8s
  • trigger_pct:100.00%
  • duration_min/max:10.2s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.06%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.2sec 184.2sec 27.8sec 90.96% 97.73% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 229.4s
  • trigger_min/max:180.5s / 229.4s
  • trigger_pct:100.00%
  • duration_min/max:10.7s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:90.96%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.0sec 184.0sec 27.9sec 91.22% 97.82% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 229.4s
  • trigger_min/max:180.5s / 229.4s
  • trigger_pct:100.00%
  • duration_min/max:8.7s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.22%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 183.9sec 183.9sec 27.9sec 91.37% 97.70% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 229.4s
  • trigger_min/max:180.5s / 229.4s
  • trigger_pct:100.00%
  • duration_min/max:8.2s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.37%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.0sec 184.0sec 28.0sec 93.02% 98.89% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 229.4s
  • trigger_min/max:180.5s / 229.4s
  • trigger_pct:100.00%
  • duration_min/max:7.7s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:93.02%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 184.0sec 184.0sec 28.0sec 93.07% 98.73% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 229.4s
  • trigger_min/max:180.5s / 229.4s
  • trigger_pct:100.00%
  • duration_min/max:7.2s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:93.07%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Commander of the Dead 2.0 0.0 183.6sec 183.6sec 25.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 202.8s
  • trigger_min/max:180.5s / 202.8s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 184.0sec 184.0sec 23.8sec 95.15% 99.94% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 203.1s
  • trigger_min/max:180.8s / 203.1s
  • trigger_pct:100.00%
  • duration_min/max:17.6s / 24.0s

Stack Uptimes

  • dark_empowerment_1:95.15%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.5 0.0 66.0sec 66.0sec 20.9sec 97.66% 98.58% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:41.6s / 228.8s
  • trigger_min/max:41.6s / 228.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.66%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.5 0.0 65.9sec 65.9sec 20.9sec 97.69% 98.61% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:41.4s / 229.1s
  • trigger_min/max:41.4s / 229.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.69%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 25.5 8.0 48.0 11.5s 1.3s 124.0s
delayed_aa_cast 0.0 0.0 1.0 0.0s 0.0s 0.0s
Rune ready 158.3 118.0 202.0 2.0s 0.0s 12.2s
Runic Corruption from Runic Power Spent 47.8 28.0 73.0 6.2s 0.8s 74.1s
Festering Wound from Festering Strike 65.7 42.0 94.0 11.1s 1.0s 63.7s
Festering Wound from Infected Claws 32.1 14.0 57.0 9.2s 1.0s 104.9s
Festering Wound from Unholy Assault 14.6 12.0 16.0 91.7s 90.0s 113.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 3.22% 0.00% 12.89% 2.0s 0.0s 22.4s
ghoul - Energy Cap 0.53% 0.18% 1.60% 0.2s 0.0s 1.0s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=311935)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1111.943 / 1.0897.13024.328
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
36.61557.02080.794 / 79.772107.942153.984

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Army of the Dead6.2500.00238.3936.1200.00038.393
Summon Gargoyle3.6150.49522.8323.6150.49522.832
Dark Transformation0.9250.00120.6685.1350.65822.872
Apocalypse0.8730.00120.7554.2110.27122.420
Empower Rune Weapon49.6590.00184.05067.72060.53893.695
Unholy Assault1.6670.00122.9734.3690.53824.050
Soul Reaper1.0010.00113.11213.2043.90629.280

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
ApocalypseRune13.8813.688.64%0.990.201.41%
Empower Rune WeaponRunic Power11.5556.422.37%4.881.352.34%
Empower Rune WeaponRune11.5511.157.04%0.960.403.50%
Festering WoundRunic Power105.84309.3312.99%2.928.182.58%
Rune RegenerationRune133.52133.5284.32%1.000.000.00%
Runic AttenuationRunic Power74.79362.9015.24%4.8511.052.96%
Army of the DeadRunic Power2.0019.880.83%9.940.120.61%
Festering StrikeRunic Power26.29510.2821.42%19.4115.552.96%
OutbreakRunic Power11.62113.244.75%9.743.002.58%
Scourge StrikeRunic Power79.12776.6932.61%9.8214.501.83%
Soul ReaperRunic Power15.58147.726.20%9.488.065.17%
Summon GargoyleRunic Power2.0085.453.59%42.7314.5514.55%
pet - ghoul
Dark TransformationEnergy6.98366.678.72%52.56331.0047.44%
energy_regenEnergy1346.163840.2491.28%2.8558.181.49%
pet - army_ghoul
energy_regenEnergy901.507177.56100.00%7.96965.5811.86%
pet - apoc_ghoul
energy_regenEnergy705.395668.25100.00%8.041722.6723.31%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.001.000.00
Death CoilRunic Power 99.512357.6623.6923.69757.03
Festering StrikeRune 26.2952.582.002.006347.17
OutbreakRune 11.6211.621.001.002021.15
Scourge StrikeRune 79.1279.121.001.008791.74
Soul ReaperRune 15.5815.581.001.0053677.58
pet - ghoul
ClawEnergy 37.881515.3540.0040.0058.84
Sweeping ClawsEnergy 68.962758.3640.0040.00143.27
pet - army_ghoul
ClawEnergy 215.308612.0240.0040.0030.44
pet - apoc_ghoul
ClawEnergy 197.187887.2040.0040.0027.61
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 8.0 7.94 7.87 76.3 22.3 0.0 100.0
Rune 5.0 0.53 0.54 0.0 3.4 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 45750.31
Minimum 40524.88
Maximum 52050.88
Spread ( max - min ) 11526.00
Range [ ( max - min ) / 2 * 100% ] 12.60%
Standard Deviation 2012.7399
5th Percentile 42826.47
95th Percentile 49385.18
( 95th Percentile - 5th Percentile ) 6558.70
Mean Distribution
Standard Deviation 23.2427
95.00% Confidence Interval ( 45704.76 - 45795.87 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7436
0.1 Scale Factor Error with Delta=300 34583
0.05 Scale Factor Error with Delta=300 138331
0.01 Scale Factor Error with Delta=300 3458271
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 45750.31
Minimum 40524.88
Maximum 52050.88
Spread ( max - min ) 11526.00
Range [ ( max - min ) / 2 * 100% ] 12.60%
Standard Deviation 2012.7399
5th Percentile 42826.47
95th Percentile 49385.18
( 95th Percentile - 5th Percentile ) 6558.70
Mean Distribution
Standard Deviation 23.2427
95.00% Confidence Interval ( 45704.76 - 45795.87 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7436
0.1 Scale Factor Error with Delta=300 34583
0.05 Scale Factor Error with Delta=300 138331
0.01 Scale Factor Error with Delta=300 3458271
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 45750.31
Minimum 40524.88
Maximum 52050.88
Spread ( max - min ) 11526.00
Range [ ( max - min ) / 2 * 100% ] 12.60%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 6076839.59
Minimum 4569364.52
Maximum 7580247.96
Spread ( max - min ) 3010883.44
Range [ ( max - min ) / 2 * 100% ] 24.77%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 army_of_the_dead,precombat_time=2
6 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)
7 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)
8 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
9 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
A 0.00 variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
B 0.00 variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
C 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
D 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
0.00 variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle
Variables
0.00 variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
0.00 variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4)|fight_remains<10
0.00 variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&cooldown.apocalypse.remains|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration)|fight_remains<=21
When using 'external_buffs.pool', will use this lines logic to determine when to use Power Infusion.
E 1.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=34
Prioritize Army, Outbreak and Maintaining Plaguebringer
0.00 wait_for_cooldown,name=apocalypse,if=cooldown.apocalypse.remains<gcd&buff.commander_of_the_dead_window.up
F 4.74 death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd*1.1&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
0.00 epidemic,if=active_enemies>=4&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
G 11.62 outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
0.00 wound_spender,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
H 0.00 run_action_list,name=garg_setup,if=variable.garg_setup=0
Call Action Lists
I 0.00 call_action_list,name=cooldowns
J 0.00 call_action_list,name=trinkets
K 0.00 call_action_list,name=racials
L 0.00 run_action_list,name=aoe,if=active_enemies>=4
M 0.00 run_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
N 0.49 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Potion
0.00 vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
Cooldowns
0.00 summon_gargoyle,if=active_enemies>=3
0.00 unholy_blight,if=variable.adds_remain|fight_remains<21
0.00 abomination_limb,if=rune<2&variable.adds_remain
0.00 raise_dead,if=!pet.ghoul.active
O 4.75 dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd*2|cooldown.apocalypse.remains>30|!talent.commander_of_the_dead)
0.00 dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
0.00 apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&(buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead|cooldown.dark_transformation.remains>30)
0.00 apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
P 2.41 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
0.00 abomination_limb,if=rune<3&variable.st_planning
Q 3.64 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
0.00 unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.adds_remain&debuff.festering_wound.stack<2
R 15.21 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
0.00 sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd
actions.garg_setup
# count action,conditions
S 6.94 apocalypse,if=buff.commander_of_the_dead_window.up|cooldown.dark_transformation.remains>20|!talent.commander_of_the_dead&debuff.festering_wound.stack>=4
Garg Setup
T 0.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
U 0.36 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
V 2.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>40
W 1.00 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
X 2.22 dark_transformation,if=talent.commander_of_the_dead&debuff.festering_wound.stack>=4|!talent.commander_of_the_dead
Y 2.23 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4&talent.apocalypse|!variable.pop_wounds&debuff.festering_wound.stack<1&!talent.apocalypse
Z 1.29 death_coil,if=rune<=1
a 1.29 wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>4|debuff.festering_wound.stack>=1&!talent.apocalypse
actions.generic
# count action,conditions
b 93.49 death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10
Generic
0.00 any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
c 77.82 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
d 24.07 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
e 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
f 2.00 use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets
0.00 use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
g 2.78 use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

Sample Sequence

012456789ABCDGWYYXVFFSPQfbbbccbcbcecbcdbcGbcbbdcbccbgdbccbbcdbcbccbddbGbOaSccbdbcccbbcbdbcbGbcbccdbbcbdbcbOdSQcGcFcbccbcbcdbbbccbcdbcbGccbdbbdbOdSbccgcdbbbbGbccccdbbbccccbcbdbdEGXVFSPQfbRbbbcebcRbccbccRbcbdbGRccbcRcbbcRdbbdObSRGccbRcdbbRbbcbRcbdbRcGbcgbRdbOSQRccFbbRccGbbRbbccb

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 5 army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
elemental_chaos_earth
Pre precombat 6 trinket_1_buffs Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat 7 trinket_2_buffs Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat 8 trinket_1_sync Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat 9 trinket_2_sync Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat A trinket_1_exclude Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat B trinket_2_exclude Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
Pre precombat C trinket_priority Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
0:00.000 default D auto_attack Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
icy_talons, elemental_chaos_earth
0:00.000 default G outbreak Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, icy_talons, elemental_chaos_earth
0:01.019 garg_setup W potion Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, icy_talons, elemental_chaos_earth
0:01.019 garg_setup Y festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, icy_talons, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.039 garg_setup Y festering_strike Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
bloodlust, icy_talons, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.060 garg_setup X dark_transformation Fluffy_Pillow 63.0/100: 63% runic_power
0.0/6: 0% rune
bloodlust, icy_talons, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.060 garg_setup V summon_gargoyle Fluffy_Pillow 63.0/100: 63% runic_power
0.0/6: 0% rune
bloodlust, icy_talons, dark_transformation, unholy_pact, commander_of_the_dead_window, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.081 default F death_coil Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune
bloodlust, icy_talons, dark_transformation, unholy_pact, commander_of_the_dead_window, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.101 default F death_coil Fluffy_Pillow 70.0/100: 70% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, commander_of_the_dead_window, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.121 garg_setup S apocalypse Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, commander_of_the_dead_window, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.140 cooldowns P empower_rune_weapon Fluffy_Pillow 57.0/100: 57% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.140 cooldowns Q unholy_assault Fluffy_Pillow 62.0/100: 62% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.140 trinkets f use_item_algethar_puzzle_box Fluffy_Pillow 62.0/100: 62% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.029 generic b death_coil Fluffy_Pillow 62.0/100: 62% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.782 generic b death_coil Fluffy_Pillow 67.0/100: 67% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.534 generic b death_coil Fluffy_Pillow 37.0/100: 37% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.289 generic c scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.042 generic c scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.797 generic b death_coil Fluffy_Pillow 43.0/100: 43% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.551 generic c scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.304 generic b death_coil Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.059 generic c scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.814 racials e berserking Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.814 generic c scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.570 generic b death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.325 generic c scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.079 generic d festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(10), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.833 generic b death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(10), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.588 generic c scourge_strike Fluffy_Pillow 15.0/100: 15% runic_power
2.0/6: 33% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.342 default G outbreak Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.095 generic b death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.850 generic c scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.606 generic b death_coil Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(12), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.359 generic b death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.114 generic d festering_strike Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.869 generic c scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.623 generic b death_coil Fluffy_Pillow 39.0/100: 39% runic_power
1.0/6: 17% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.377 generic c scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(13), algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.132 generic c scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.887 generic b death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
bloodlust, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight, algethar_puzzle, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.211 trinkets g use_item_dragon_games_equipment Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
bloodlust, icy_talons(3), dark_transformation, festermight, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.641 generic d festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
bloodlust, icy_talons(3), dark_transformation, festermight, dragon_games_equipment, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.662 generic b death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
bloodlust, icy_talons(3), dark_transformation, festermight, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.683 generic c scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
bloodlust, icy_talons(3), dark_transformation, runic_corruption, festermight, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.704 generic c scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
bloodlust, icy_talons(3), dark_transformation, sudden_doom, festermight(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:31.725 generic b death_coil Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune
bloodlust, icy_talons(3), dark_transformation, sudden_doom, festermight(3), elemental_chaos_earth
0:32.746 generic b death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(3), elemental_chaos_earth
0:33.766 generic c scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(3), elemental_chaos_earth
0:34.786 generic d festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(4), elemental_chaos_earth
0:35.806 generic b death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
0:36.824 generic c scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
0:37.844 generic b death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), festermight(5), elemental_chaos_earth
0:38.865 generic c scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), runic_corruption, festermight(5), elemental_chaos_earth
0:39.886 generic c scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
0:40.906 generic b death_coil Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), elemental_chaos_earth
0:42.231 generic d festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(7), elemental_chaos_earth
0:43.557 generic d festering_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), elemental_chaos_earth
0:44.881 generic b death_coil Fluffy_Pillow 53.0/100: 53% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(7), elemental_chaos_earth
0:46.208 default G outbreak Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_earth
0:47.532 generic b death_coil Fluffy_Pillow 63.0/100: 63% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_earth
0:48.860 cooldowns O dark_transformation Fluffy_Pillow 33.0/100: 33% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, elemental_chaos_earth
0:50.186 garg_setup a scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, elemental_chaos_earth
0:51.511 garg_setup S apocalypse Fluffy_Pillow 51.0/100: 51% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight, commander_of_the_dead_window, elemental_chaos_earth
0:52.835 generic c scourge_strike Fluffy_Pillow 63.0/100: 63% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), commander_of_the_dead_window, elemental_chaos_earth
0:54.160 generic c scourge_strike Fluffy_Pillow 76.0/100: 76% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), elemental_chaos_earth
0:55.487 generic b death_coil Fluffy_Pillow 89.0/100: 89% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_earth
0:56.811 generic d festering_strike Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), elemental_chaos_earth
0:58.138 generic b death_coil Fluffy_Pillow 84.0/100: 84% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_earth
0:59.461 generic c scourge_strike Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), elemental_chaos_earth
1:00.787 generic c scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), elemental_chaos_frost
1:02.112 generic c scourge_strike Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(9), elemental_chaos_frost
1:03.438 generic b death_coil Fluffy_Pillow 98.0/100: 98% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(10), elemental_chaos_frost
1:04.764 generic b death_coil Fluffy_Pillow 98.0/100: 98% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(10), elemental_chaos_frost
1:06.090 generic c scourge_strike Fluffy_Pillow 73.0/100: 73% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(10), elemental_chaos_frost
1:07.416 generic b death_coil Fluffy_Pillow 86.0/100: 86% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(11), elemental_chaos_frost
1:08.741 generic d festering_strike Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, runic_corruption, festermight(11), elemental_chaos_frost
1:10.066 generic b death_coil Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(11), elemental_chaos_frost
1:11.393 generic c scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
icy_talons(3), elemental_chaos_frost
1:12.719 generic b death_coil Fluffy_Pillow 59.0/100: 59% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, elemental_chaos_frost
1:14.045 default G outbreak Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, elemental_chaos_frost
1:15.372 generic b death_coil Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, elemental_chaos_frost
1:16.698 generic c scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, sudden_doom, festermight, elemental_chaos_frost
1:18.023 generic b death_coil Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), sudden_doom, festermight(2), elemental_chaos_frost
1:19.349 generic c scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(2), elemental_chaos_frost
1:20.675 generic c scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight(3), elemental_chaos_frost
1:22.000 generic d festering_strike Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_frost
1:23.325 generic b death_coil Fluffy_Pillow 73.0/100: 73% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_frost
1:24.652 generic b death_coil Fluffy_Pillow 48.0/100: 48% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_frost
1:25.978 generic c scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_frost
1:27.303 generic b death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(5), elemental_chaos_frost
1:28.627 generic d festering_strike Fluffy_Pillow 31.0/100: 31% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(5), elemental_chaos_frost
1:29.952 generic b death_coil Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(5), elemental_chaos_frost
1:31.276 generic c scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), elemental_chaos_frost
1:32.599 generic b death_coil Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_frost
1:33.925 cooldowns O dark_transformation Fluffy_Pillow 14.0/100: 14% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_frost
1:35.249 generic d festering_strike Fluffy_Pillow 19.0/100: 19% runic_power
5.0/6: 83% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, elemental_chaos_frost
1:36.576 garg_setup S apocalypse Fluffy_Pillow 39.0/100: 39% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, elemental_chaos_frost
1:37.900 cooldowns Q unholy_assault Fluffy_Pillow 51.0/100: 51% runic_power
5.0/6: 83% rune
icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, elemental_chaos_frost
1:39.225 generic c scourge_strike Fluffy_Pillow 51.0/100: 51% runic_power
5.0/6: 83% rune
icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), elemental_chaos_frost
1:40.330 default G outbreak Fluffy_Pillow 69.0/100: 69% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), elemental_chaos_frost
1:41.435 generic c scourge_strike Fluffy_Pillow 79.0/100: 79% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), elemental_chaos_frost
1:42.540 default F death_coil Fluffy_Pillow 97.0/100: 97% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_chaos_frost
1:43.647 generic c scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_chaos_frost
1:44.753 generic b death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), elemental_chaos_frost
1:45.860 generic c scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(7), elemental_chaos_frost
1:46.966 generic c scourge_strike Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), elemental_chaos_frost
1:48.070 generic b death_coil Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), elemental_chaos_frost
1:49.175 generic c scourge_strike Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(9), elemental_chaos_frost
1:50.281 generic b death_coil Fluffy_Pillow 64.0/100: 64% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(10), elemental_chaos_frost
1:51.387 generic c scourge_strike Fluffy_Pillow 39.0/100: 39% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), elemental_chaos_frost
1:52.492 generic d festering_strike Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(11), elemental_chaos_frost
1:53.596 generic b death_coil Fluffy_Pillow 77.0/100: 77% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, unholy_assault, festermight(11), elemental_chaos_frost
1:54.701 generic b death_coil Fluffy_Pillow 77.0/100: 77% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(11), elemental_chaos_frost
1:55.807 generic b death_coil Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(11), elemental_chaos_frost
1:56.912 generic c scourge_strike Fluffy_Pillow 17.0/100: 17% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, unholy_assault, elemental_chaos_frost
1:58.016 generic c scourge_strike Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), sudden_doom, festermight, elemental_chaos_frost
1:59.341 generic b death_coil Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(2), elemental_chaos_frost
2:00.669 generic c scourge_strike Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), elemental_chaos_earth
2:01.996 generic d festering_strike Fluffy_Pillow 61.0/100: 61% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight(3), elemental_chaos_earth
2:03.323 generic b death_coil Fluffy_Pillow 81.0/100: 81% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3), elemental_chaos_earth
2:04.649 generic c scourge_strike Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_earth
2:05.974 generic b death_coil Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
2:07.300 default G outbreak Fluffy_Pillow 39.0/100: 39% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), elemental_chaos_earth
2:08.625 generic c scourge_strike Fluffy_Pillow 54.0/100: 54% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
2:09.949 generic c scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(5), elemental_chaos_earth
2:11.274 generic b death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
2:12.599 generic d festering_strike Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
2:13.922 generic b death_coil Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
2:15.247 generic b death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(6), elemental_chaos_earth
2:16.572 generic d festering_strike Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(6), elemental_chaos_earth
2:17.896 generic b death_coil Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), elemental_chaos_earth
2:19.220 cooldowns O dark_transformation Fluffy_Pillow 5.0/100: 5% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_earth
2:20.545 generic d festering_strike Fluffy_Pillow 5.0/100: 5% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, elemental_chaos_earth
2:21.872 garg_setup S apocalypse Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, elemental_chaos_earth
2:23.197 generic b death_coil Fluffy_Pillow 42.0/100: 42% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(4), commander_of_the_dead_window, elemental_chaos_earth
2:24.525 generic c scourge_strike Fluffy_Pillow 42.0/100: 42% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(4), elemental_chaos_earth
2:25.850 generic c scourge_strike Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, unholy_pact, festermight(5), elemental_chaos_earth
2:27.175 trinkets g use_item_dragon_games_equipment Fluffy_Pillow 73.0/100: 73% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), elemental_chaos_earth
2:27.211 generic c scourge_strike Fluffy_Pillow 73.0/100: 73% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), dragon_games_equipment, elemental_chaos_earth
2:28.534 generic d festering_strike Fluffy_Pillow 91.0/100: 91% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_earth
2:29.858 generic b death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_earth
2:31.183 generic b death_coil Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(7), elemental_chaos_earth
2:32.508 generic b death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), elemental_chaos_earth
2:33.834 generic b death_coil Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_pact, festermight(7), elemental_chaos_earth
2:35.160 default G outbreak Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), elemental_chaos_earth
2:36.485 generic b death_coil Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, festermight(7), elemental_chaos_earth
2:37.811 generic c scourge_strike Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), elemental_chaos_earth
2:39.136 generic c scourge_strike Fluffy_Pillow 78.0/100: 78% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(8), elemental_chaos_earth
2:40.463 generic c scourge_strike Fluffy_Pillow 91.0/100: 91% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(9), elemental_chaos_earth
2:41.788 generic c scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(10), elemental_chaos_earth
2:43.115 generic d festering_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), elemental_chaos_earth
2:44.440 generic b death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_earth
2:45.766 generic b death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_earth
2:47.091 generic b death_coil Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, elemental_chaos_earth
2:48.415 generic c scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_earth
2:49.740 generic c scourge_strike Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, elemental_chaos_earth
2:51.066 generic c scourge_strike Fluffy_Pillow 71.0/100: 71% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
2:52.390 generic c scourge_strike Fluffy_Pillow 84.0/100: 84% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), elemental_chaos_earth
2:53.715 generic b death_coil Fluffy_Pillow 97.0/100: 97% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
2:55.039 generic c scourge_strike Fluffy_Pillow 72.0/100: 72% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
2:56.363 generic b death_coil Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), elemental_chaos_earth
2:57.689 generic d festering_strike Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(5), elemental_chaos_earth
2:59.013 generic b death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), elemental_chaos_earth
3:00.336 generic d festering_strike Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(5), elemental_chaos_fire
3:01.660 default E army_of_the_dead Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), elemental_chaos_fire
3:02.983 default G outbreak Fluffy_Pillow 90.0/100: 90% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(5), elemental_chaos_fire
3:04.306 garg_setup X dark_transformation Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(5), elemental_chaos_fire
3:04.306 garg_setup V summon_gargoyle Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), commander_of_the_dead_window, elemental_chaos_fire
3:05.631 default F death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), commander_of_the_dead_window, elemental_chaos_fire
3:06.955 garg_setup S apocalypse Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(5), commander_of_the_dead_window, elemental_chaos_fire
3:08.280 cooldowns P empower_rune_weapon Fluffy_Pillow 87.0/100: 87% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(9), commander_of_the_dead_window, elemental_chaos_fire
3:08.280 cooldowns Q unholy_assault Fluffy_Pillow 92.0/100: 92% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(9), commander_of_the_dead_window, elemental_chaos_fire
3:08.280 trinkets f use_item_algethar_puzzle_box Fluffy_Pillow 92.0/100: 92% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(9), commander_of_the_dead_window, elemental_chaos_fire
3:09.434 generic b death_coil Fluffy_Pillow 92.0/100: 92% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:10.395 cooldowns R soul_reaper Fluffy_Pillow 97.0/100: 97% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:11.357 generic b death_coil Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:12.318 generic b death_coil Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:13.281 generic b death_coil Fluffy_Pillow 50.0/100: 50% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:14.244 generic c scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, algethar_puzzle, elemental_chaos_fire
3:15.206 racials e berserking Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight, algethar_puzzle, elemental_chaos_fire
3:15.206 generic b death_coil Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight, algethar_puzzle, elemental_chaos_fire
3:16.079 generic c scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight, algethar_puzzle, elemental_chaos_fire
3:16.952 cooldowns R soul_reaper Fluffy_Pillow 21.0/100: 21% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(2), algethar_puzzle, elemental_chaos_fire
3:17.826 generic b death_coil Fluffy_Pillow 31.0/100: 31% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(2), algethar_puzzle, elemental_chaos_fire
3:18.700 generic c scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(2), algethar_puzzle, elemental_chaos_fire
3:19.575 generic c scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(3), algethar_puzzle, elemental_chaos_fire
3:20.449 generic b death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), algethar_puzzle, elemental_chaos_fire
3:21.322 generic c scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), algethar_puzzle, elemental_chaos_fire
3:22.197 generic c scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), algethar_puzzle, elemental_chaos_fire
3:23.072 cooldowns R soul_reaper Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), algethar_puzzle, elemental_chaos_fire
3:23.946 generic b death_coil Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(6), algethar_puzzle, elemental_chaos_fire
3:24.820 generic c scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), algethar_puzzle, elemental_chaos_fire
3:25.695 generic b death_coil Fluffy_Pillow 41.0/100: 41% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), algethar_puzzle, elemental_chaos_fire
3:26.571 generic d festering_strike Fluffy_Pillow 11.0/100: 11% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), algethar_puzzle, elemental_chaos_fire
3:27.445 generic b death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), algethar_puzzle, elemental_chaos_fire
3:28.407 default G outbreak Fluffy_Pillow 11.0/100: 11% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), elemental_chaos_fire
3:29.732 cooldowns R soul_reaper Fluffy_Pillow 21.0/100: 21% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(7), elemental_chaos_fire
3:31.057 generic c scourge_strike Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), elemental_chaos_fire
3:32.382 generic c scourge_strike Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(8), elemental_chaos_fire
3:33.708 generic b death_coil Fluffy_Pillow 62.0/100: 62% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(9), elemental_chaos_fire
3:35.032 generic c scourge_strike Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_fire
3:36.357 cooldowns R soul_reaper Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, elemental_chaos_fire
3:37.683 generic c scourge_strike Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, elemental_chaos_fire
3:39.008 generic b death_coil Fluffy_Pillow 73.0/100: 73% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), elemental_chaos_fire
3:40.334 generic b death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_fire
3:41.660 generic c scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), elemental_chaos_fire
3:42.985 cooldowns R soul_reaper Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
3:44.310 generic d festering_strike Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
3:45.636 generic b death_coil Fluffy_Pillow 66.0/100: 66% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), elemental_chaos_fire
3:46.962 generic b death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(3), elemental_chaos_fire
3:48.286 generic d festering_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_fire
3:49.610 cooldowns O dark_transformation Fluffy_Pillow 61.0/100: 61% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_fire
3:50.935 generic b death_coil Fluffy_Pillow 61.0/100: 61% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(3), commander_of_the_dead_window, elemental_chaos_fire
3:52.260 garg_setup S apocalypse Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(3), commander_of_the_dead_window, elemental_chaos_fire
3:53.586 cooldowns R soul_reaper Fluffy_Pillow 43.0/100: 43% runic_power
6.0/6: 100% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), commander_of_the_dead_window, elemental_chaos_fire
3:54.909 default G outbreak Fluffy_Pillow 58.0/100: 58% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), elemental_chaos_fire
3:56.236 generic c scourge_strike Fluffy_Pillow 68.0/100: 68% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, elemental_chaos_fire
3:57.560 generic c scourge_strike Fluffy_Pillow 86.0/100: 86% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, unholy_pact, festermight, elemental_chaos_fire
3:58.887 generic b death_coil Fluffy_Pillow 99.0/100: 99% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_pact, festermight(2), elemental_chaos_fire
4:00.214 cooldowns R soul_reaper Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(2), elemental_chaos_earth
4:01.540 generic c scourge_strike Fluffy_Pillow 79.0/100: 79% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(2), elemental_chaos_earth
4:02.863 generic d festering_strike Fluffy_Pillow 97.0/100: 97% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(3), elemental_chaos_earth
4:04.189 generic b death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(3), elemental_chaos_earth
4:05.513 generic b death_coil Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(3), elemental_chaos_earth
4:06.836 cooldowns R soul_reaper Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(3), elemental_chaos_earth
4:08.162 generic b death_coil Fluffy_Pillow 80.0/100: 80% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(3), elemental_chaos_earth
4:09.487 generic b death_coil Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(3), elemental_chaos_earth
4:10.811 generic c scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(3), elemental_chaos_earth
4:12.137 generic b death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
4:13.462 cooldowns R soul_reaper Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
4:14.786 generic c scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), elemental_chaos_earth
4:16.112 generic b death_coil Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), elemental_chaos_earth
4:17.438 generic d festering_strike Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, elemental_chaos_earth
4:18.764 generic b death_coil Fluffy_Pillow 31.0/100: 31% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), elemental_chaos_earth
4:20.089 cooldowns R soul_reaper Fluffy_Pillow 6.0/100: 6% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), elemental_chaos_earth
4:21.415 generic c scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), elemental_chaos_earth
4:22.741 default G outbreak Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight, elemental_chaos_earth
4:24.065 generic b death_coil Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight, elemental_chaos_earth
4:25.391 generic c scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight, elemental_chaos_earth
4:26.717 Waiting     0.290 sec 27.0/100: 27% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
4:27.007 trinkets g use_item_dragon_games_equipment Fluffy_Pillow 27.0/100: 27% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
4:27.211 generic b death_coil Fluffy_Pillow 32.0/100: 32% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(2), dragon_games_equipment, elemental_chaos_earth
4:28.537 Waiting     1.273 sec 2.0/100: 2% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
4:29.810 cooldowns R soul_reaper Fluffy_Pillow 7.0/100: 7% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
4:31.135 Waiting     1.316 sec 17.0/100: 17% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
4:32.451 generic d festering_strike Fluffy_Pillow 17.0/100: 17% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
4:33.778 generic b death_coil Fluffy_Pillow 37.0/100: 37% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
4:35.102 cooldowns O dark_transformation Fluffy_Pillow 12.0/100: 12% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), elemental_chaos_earth
4:36.428 Waiting     0.654 sec 12.0/100: 12% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(2), commander_of_the_dead_window, elemental_chaos_earth
4:37.082 garg_setup S apocalypse Fluffy_Pillow 12.0/100: 12% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(2), commander_of_the_dead_window, elemental_chaos_earth
4:38.585 cooldowns Q unholy_assault Fluffy_Pillow 29.0/100: 29% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), commander_of_the_dead_window, elemental_chaos_earth
4:39.910 cooldowns R soul_reaper Fluffy_Pillow 29.0/100: 29% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_chaos_earth
4:41.016 generic c scourge_strike Fluffy_Pillow 39.0/100: 39% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_chaos_earth
4:42.122 generic c scourge_strike Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, elemental_chaos_earth
4:43.229 default F death_coil Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight, elemental_chaos_earth
4:44.334 generic b death_coil Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight, elemental_chaos_earth
4:45.439 generic b death_coil Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight, elemental_chaos_earth
4:46.545 cooldowns R soul_reaper Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight, elemental_chaos_earth
4:47.649 generic c scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight, elemental_chaos_earth
4:48.754 generic c scourge_strike Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(2), elemental_chaos_earth
4:49.860 default G outbreak Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(3), elemental_chaos_earth
4:50.965 generic b death_coil Fluffy_Pillow 86.0/100: 86% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(3), elemental_chaos_earth
4:52.071 generic b death_coil Fluffy_Pillow 56.0/100: 56% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(3), elemental_chaos_earth
4:53.178 cooldowns R soul_reaper Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(3), elemental_chaos_earth
4:54.282 generic b death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(3), elemental_chaos_earth
4:55.387 generic b death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(3), elemental_chaos_earth
4:56.492 generic c scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(3), elemental_chaos_earth
4:57.598 generic c scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(4), elemental_chaos_earth
4:58.703 generic b death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(5), elemental_chaos_earth

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6095 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3463 0 12965 12348 6827
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 259300 246960 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 18.98% 15.36% 1504
Haste 13.49% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6400 5922 0
Mastery 44.26% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +687 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +687 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/army_of_the_dead,precombat_time=2
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_use_buff|(trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit)
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_use_buff|(trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit)
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_exclude,value=trinket.1.is.ruby_whelp_shell|trinket.1.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_2_exclude,value=trinket.2.is.ruby_whelp_shell|trinket.2.is.whispering_incarnate_icon
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs&(trinket.2.has_cooldown&!variable.trinket_2_exclude|!trinket.1.has_cooldown)|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
# Variables
actions+=/variable,name=garg_setup,op=setif,value=1,value_else=0,condition=active_enemies>=3|cooldown.summon_gargoyle.remains>1&cooldown.apocalypse.remains>1|!talent.apocalypse&cooldown.summon_gargoyle.remains>1|!talent.summon_gargoyle
actions+=/variable,name=apoc_timing,op=setif,value=10,value_else=2,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<=4
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(3-talent.infected_claws),condition=!pet.gargoyle.active&talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
actions+=/variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4)|fight_remains<10
actions+=/variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# When using 'external_buffs.pool', will use this lines logic to determine when to use Power Infusion.
actions+=/invoke_external_buff,name=power_infusion,if=variable.st_planning&(pet.gargoyle.active&cooldown.apocalypse.remains|!talent.summon_gargoyle&talent.army_of_the_dead&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up|!talent.summon_gargoyle&buff.dark_transformation.up|!pet.gargoyle.active&cooldown.summon_gargoyle.remains+5>cooldown.invoke_external_buff.duration)|fight_remains<=21
# Prioritize Army, Outbreak and Maintaining Plaguebringer
actions+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=34
actions+=/wait_for_cooldown,name=apocalypse,if=cooldown.apocalypse.remains<gcd&buff.commander_of_the_dead_window.up
actions+=/death_coil,if=(active_enemies<=3|!talent.epidemic)&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd*1.1&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions+=/epidemic,if=active_enemies>=4&(pet.gargoyle.active&buff.commander_of_the_dead_window.up&buff.commander_of_the_dead_window.remains>gcd&cooldown.apocalypse.remains<gcd|(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&debuff.death_rot.up&debuff.death_rot.remains<gcd)
actions+=/outbreak,target_if=target.time_to_die>dot.virulent_plague.remains&(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
actions+=/wound_spender,if=(!buff.commander_of_the_dead_window.up|buff.commander_of_the_dead_window.up&cooldown.apocalypse.remains>5)&cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
# Call Action Lists
actions+=/run_action_list,name=garg_setup,if=variable.garg_setup=0
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=aoe,if=active_enemies>=4
actions+=/run_action_list,name=generic,if=active_enemies<=3

# AoE Action List
actions.aoe=any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(talent.festermight&buff.festermight.remains<3|!talent.festermight)&(death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets=8|!talent.bursting_sores&!talent.vile_contagion|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5|(cooldown.vile_contagion.remains|!talent.vile_contagion)&buff.dark_transformation.up&talent.infected_claws&(buff.empower_rune_weapon.up|buff.unholy_assault.up))|fight_remains<10
actions.aoe+=/scourge_strike,if=talent.superstrain&talent.ebon_fever&talent.plaguebringer&buff.plaguebringer.remains<gcd
actions.aoe+=/epidemic,if=!talent.bursting_sores&!variable.pooling_runic_power&active_enemies>=6
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!death_and_decay.ticking&debuff.festering_wound.stack<4&(cooldown.vile_contagion.remains<5|cooldown.apocalypse.ready&cooldown.any_dnd.remains)
actions.aoe+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!death_and_decay.ticking&(cooldown.vile_contagion.remains>5|!talent.vile_contagion)
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=death_and_decay.ticking
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe+=/epidemic,if=!variable.pooling_runic_power
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=cooldown.death_and_decay.remains>10|cooldown.death_and_decay.remains>5&death_knight.fwounded_targets=active_enemies

# Potion
actions.cooldowns=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
# Cooldowns
actions.cooldowns+=/vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.cooldowns+=/summon_gargoyle,if=active_enemies>=3
actions.cooldowns+=/unholy_blight,if=variable.adds_remain|fight_remains<21
actions.cooldowns+=/abomination_limb,if=rune<2&variable.adds_remain
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd*2|cooldown.apocalypse.remains>30|!talent.commander_of_the_dead)
actions.cooldowns+=/dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&(buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead|cooldown.dark_transformation.remains>30)
actions.cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
actions.cooldowns+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.st_planning
actions.cooldowns+=/unholy_assault,target_if=min:debuff.festering_wound.stack,if=variable.adds_remain&debuff.festering_wound.stack<2
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.cooldowns+=/sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# Garg Setup
actions.garg_setup=apocalypse,if=buff.commander_of_the_dead_window.up|cooldown.dark_transformation.remains>20|!talent.commander_of_the_dead&debuff.festering_wound.stack>=4
actions.garg_setup+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<3|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead
actions.garg_setup+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5&(!buff.commander_of_the_dead_window.up|cooldown.apocalypse.remains>3)
actions.garg_setup+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>40
actions.garg_setup+=/potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60|cooldown.summon_gargoyle.ready)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)
actions.garg_setup+=/dark_transformation,if=talent.commander_of_the_dead&debuff.festering_wound.stack>=4|!talent.commander_of_the_dead
actions.garg_setup+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds&debuff.festering_wound.stack<4&talent.apocalypse|!variable.pop_wounds&debuff.festering_wound.stack<1&!talent.apocalypse
actions.garg_setup+=/death_coil,if=rune<=1
actions.garg_setup+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=debuff.festering_wound.stack>4|debuff.festering_wound.stack>=1&!talent.apocalypse

# Generic
actions.generic=death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react|cooldown.apocalypse.remains<10&debuff.festering_wound.stack>3)|fight_remains<10
actions.generic+=/any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,use_off_gcd=1,slot=trinket1,if=variable.trinket_1_buffs&((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_2_exclude|variable.trinket_priority=1|trinket.2.cooldown.remains|!trinket.2.has_cooldown))|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=variable.trinket_2_buffs&((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|(!talent.apocalypse|active_enemies>=2)&buff.dark_transformation.up)&(variable.trinket_1_exclude|variable.trinket_priority=2|trinket.1.cooldown.remains|!trinket.1.has_cooldown))|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!trinket.2.has_cooldown|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,use_off_gcd=1,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!trinket.1.has_cooldown|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=6827
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 46006 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
46006.0 46006.0 32.8 / 0.071% 5701.7 / 12.4% 199.2
APS APS Error APS Range APR
465.2 1.9 / 0.413% 240.2 / 51.6% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
190.4 189.3 Mana 0.00% 44.8 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIk0CBAAAAAAAAAAAAQikkSkmU0iEJlESEkGJJJSIIBh0kWIJAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 46006
Devouring Plague 9700 21.1% 48.0 6.24sec 60545 54830 Direct 48.0 21223 45333 25891 19.4%
Periodic 125.4 11171 22933 13270 17.8% 82.9%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 48.03 48.03 125.44 125.44 26.78 1.1042 1.9822 2908272.81 2908272.81 0.00% 9639.94 54829.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 38.73 24 56 21222.71 14569 33258 21212.61 19196 23514 822062 822062 0.00%
crit 19.36% 9.30 1 23 45332.94 29139 66516 45371.37 33834 66516 421603 421603 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.16% 103.06 68 135 11171.49 72 26506 11171.84 9816 12458 1151385 1151385 0.00%
crit 17.84% 22.38 6 40 22932.83 164 51551 22940.71 17319 29408 513223 513223 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.771336
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.75

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.641092
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 77.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [M]:48.03
  • if_expr:(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
Halo 0 (292) 0.0% (0.6%) 3.6 80.57sec 24633 22543

Stats Details: Halo

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.00 1.0930 0.0000 0.00 0.00 0.00% 22543.22 22543.22

Action Details: Halo

  • id:120644
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Shadow damage to enemies. Healing reduced beyond {$s1=6} targets.

Action Priority List

    main
    [W]:3.57
  • if_expr:raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
    Halo (_damage) 292 0.6% 3.6 80.57sec 24633 0 Direct 3.5 21137 44443 24755 15.5%

Stats Details: Halo Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.56 3.54 0.00 0.00 0.00 0.0000 0.0000 87580.41 87580.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.48% 2.99 0 7 21136.74 16818 35529 20998.40 0 35529 63177 63177 0.00%
crit 15.52% 0.55 0 4 44443.48 33636 71058 19626.64 0 71058 24403 24403 0.00%

Action Details: Halo Damage

  • id:390964
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.442000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390964
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Idol of C'Thun 0 (2801) 0.0% (6.1%) 0.0 0.00sec 0 0

Stats Details: Idol Of Cthun

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Idol Of Cthun

  • id:377349
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377349
  • name:Idol of C'Thun
  • school:physical
  • tooltip:
  • description:Mind Flay and Mind Sear have a chance to spawn a Void Tendril or Void Lasher that channels at your target for {$377355d=15 seconds}, generating {$s1=3} insanity every {$193473t1=1} sec.
    Mind Flay (void_tendril) 7104  / 2801 6.1% 19.4 14.04sec 43303 5783 Periodic 145.4 4972 10058 5783 15.9% 48.5%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.42 0.00 145.42 145.42 0.00 7.4884 1.0000 840914.24 840914.24 0.00% 5782.74 5782.74
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 84.06% 122.23 31 262 4971.87 3703 6701 4969.70 4659 5564 607738 607738 0.00%
crit 15.94% 23.18 3 66 10057.80 7407 13402 10046.93 9259 11840 233176 233176 0.00%

Action Details: Mind Flay

  • id:193473
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:1667.76
  • base_td_mult:1.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:{$?=}{$=}w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=30}%.

Action Priority List

    default
    [ ]:2.61
Mind Blast 4923 10.7% 62.0 4.82sec 23808 21607 Direct 62.0 19143 40590 23808 21.7%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.97 61.97 0.00 0.00 0.00 1.1019 0.0000 1475395.29 1475395.29 0.00% 21607.07 21607.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.25% 48.49 27 72 19143.37 10261 33120 19144.26 16875 21811 928318 928318 0.00%
crit 21.75% 13.48 2 30 40589.63 22321 66240 40620.04 28067 53006 547077 547077 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.32

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.{$?s137033=true}[ |cFFFFFFFFGenerates {$/100;s2=0} Insanity|r][]{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [L]:7.99
  • if_expr:(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
    main
    [Q]:54.15
  • if_expr:variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
    main
    [U]:0.01
  • if_expr:raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
Mind Flay 529 1.2% 5.4 45.76sec 29401 8323 Periodic 32.2 4324 8716 4927 13.7% 6.3%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.40 0.00 32.20 32.20 0.00 3.5324 0.5836 158651.79 158651.79 0.00% 8323.37 8323.37
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.25% 27.77 0 65 4323.64 3624 6737 4314.33 0 5829 120076 120076 0.00%
crit 13.75% 4.43 0 17 8715.94 7248 13474 8449.90 0 13474 38575 38575 0.00%

Action Details: Mind Flay

  • id:15407
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:2.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.282480
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.50
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=4.500 seconds} and slowing their movement speed by {$s2=50}%. |cFFFFFFFFGenerates {$=}{{$s4=6}*{$s3=200}/100} Insanity over the duration.|r

Action Priority List

    main
    [O]:22.44
  • if_expr:buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun
    main
    [V]:13.49
  • if_expr:buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
    main
    [Y]:5.40
  • interrupt_if_expr:ticks>=2
Mind Flay: Insanity 5805 12.6% 35.9 8.13sec 48474 21919 Periodic 143.1 10411 21213 12171 16.3% 26.5%

Stats Details: Mind Flay Insanity

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.93 0.00 143.11 143.11 0.00 2.2115 0.5553 1741782.63 1741782.63 0.00% 21919.14 21919.14
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.71% 119.80 75 176 10411.03 7462 14822 10408.04 9947 11006 1247218 1247218 0.00%
crit 16.29% 23.31 3 47 21212.61 15946 29644 21210.48 19031 23798 494565 494565 0.00%

Action Details: Mind Flay Insanity

  • id:391403
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.621456
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:391403
  • name:Mind Flay: Insanity
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=70}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r
Mind Spike 666 1.4% 7.8 29.61sec 25596 22427 Direct 7.8 22192 46462 25596 14.0%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.79 7.79 0.00 0.00 0.00 1.1414 0.0000 199377.05 199377.05 0.00% 22427.11 22427.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.97% 6.70 0 21 22191.66 15719 50736 22136.00 0 44520 148613 148613 0.00%
crit 14.03% 1.09 0 7 46462.12 31438 101471 30529.54 0 101471 50764 50764 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.528000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage.{$?s391090=true}[ Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times.][] |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity|r{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [X]:7.79
  • if_expr:buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
Mindgames 1226 2.7% 6.7 46.63sec 54494 49647 Direct 6.7 (6.7) 43614 96358 54493 20.6% (20.6%)

Stats Details: Mindgames

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.73 6.73 0.00 0.00 0.00 1.0977 0.0000 366940.63 366940.63 0.00% 49646.95 49646.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.37% 5.34 0 9 43614.13 27910 69296 43529.56 0 63379 233101 233101 0.00%
crit 20.63% 1.39 0 6 96358.24 55821 138592 76641.40 0 138592 133840 133840 0.00%

Action Details: Mindgames

  • id:375901
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:375901
  • name:Mindgames
  • school:shadow
  • tooltip:The next {$=}w2 damage and {$=}w5 healing dealt will be reversed.
  • description:Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target.

Action Priority List

    main
    [R]:6.76
  • if_expr:spell_targets.mind_sear<5&variable.all_dots_up
Shadow Crash 0 (1073) 0.0% (2.3%) 8.0 35.48sec 40471 35574

Stats Details: Shadow Crash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.95 0.00 0.00 0.00 0.00 1.1378 0.0000 0.00 0.00 0.00% 35573.64 35573.64

Action Details: Shadow Crash

  • id:205385
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:15.0

Spelldata

  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r

Action Priority List

    main
    [S]:7.95
  • if_expr:raid_event.adds.in>10
    Shadow Crash (_damage) 1073 2.3% 8.9 35.29sec 36114 0 Direct 8.9 30205 64068 36115 17.4%

Stats Details: Shadow Crash Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.91 8.91 0.00 0.00 0.00 0.0000 0.0000 321905.87 321905.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.55% 7.36 2 11 30205.15 20814 49353 30127.70 24113 36232 222260 222260 0.00%
crit 17.45% 1.56 0 7 64068.04 41627 98706 52473.39 0 98706 99646 99646 0.00%

Action Details: Shadow Crash Damage

  • id:205386
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.103750
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadow Weaving 658 1.4% 130.6 2.24sec 1509 0 Direct 129.5 1521 0 1521 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 130.60 129.53 0.00 0.00 0.00 0.0000 0.0000 197010.48 197010.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 129.53 92 162 1520.94 353 4883 1521.93 1242 2045 197010 197010 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1185.71
  • base_dd_max:1185.71
  • base_dd_mult:1.00

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}
Shadow Word: Death 1151 2.5% 11.7 26.79sec 29648 26434 Direct 11.7 24439 50226 29647 20.2%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.65 11.65 0.00 0.00 0.00 1.1216 0.0000 345468.37 345468.37 0.00% 26434.19 26434.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.80% 9.30 3 15 24438.54 10905 54837 24400.01 13933 37496 227240 227240 0.00%
crit 20.20% 2.35 0 9 50226.33 21810 109674 46122.91 0 109674 118228 118228 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target. {$?=}A364675[Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]

Action Priority List

    main
    [P]:11.65
  • target_if_expr:(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
Shadow Word: Pain 3059 6.7% 17.5 17.52sec 52565 0 Periodic 253.9 3050 6242 3612 17.6% 99.0%

Stats Details: Shadow Word Pain

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.45 0.00 253.95 253.95 16.01 0.0000 1.1694 917395.74 917395.74 0.00% 3089.14 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.38% 209.20 150 265 3049.97 2 4358 3049.38 2917 3208 638046 638046 0.00%
crit 17.62% 44.75 20 71 6242.17 4 8716 6242.55 5709 6856 279349 279349 0.00%

Action Details: Shadow Word Pain

  • id:589
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:3.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.095880
  • base_td:0.00
  • base_td_mult:1.91
  • dot_duration:21.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=2} sec.
  • description:A word of darkness that causes {$?a390707=false}[{$=}{{$s1=0}*(1+{$390707s1=15}/100)}][{$s1=0}] Shadow damage instantly, and an additional {$?a390707=false}[{$=}{{$=}o2*(1+{$390707s1=15}/100)}][{$=}o2] Shadow damage over {$d=16 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m3=300}/100} Insanity.|r][]
Shadowy Apparitions 0 (1292) 0.0% (2.8%) 109.8 2.72sec 3533 0

Stats Details: Shadowy Apparitions

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 109.77 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowy Apparitions

  • id:341491
  • school:physical
  • range:0.0
  • travel_speed:6.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:341491
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:Mind Blast, Devouring Plague, and Void Bolt have a {$s4=100}% chance to conjure Shadowy Apparitions and Mind Sear has a {$s3=50}% chance to conjure Shadowy Apparitions. Shadowy Apparitions float towards all targets afflicted by your Vampiric Touch for {$148859s1=0} Shadow damage. Critical strikes with Mind Blast, Devouring Plague, and Void Bolt increase the damage of the Shadowy Apparitions they conjure by {$s2=100}%.
    Shadowy Apparition 1292 2.8% 108.1 2.71sec 3589 0 Direct 106.3 3647 0 3647 0.0%

Stats Details: Shadowy Apparition

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 108.06 106.34 0.00 0.00 0.00 0.0000 0.0000 387763.71 387763.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 106.34 74 137 3646.52 2347 5828 3645.00 3436 3899 387764 387764 0.00%

Action Details: Shadowy Apparition

  • id:148859
  • school:shadow
  • range:100.0
  • travel_speed:6.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205700
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Spelldata

  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals $148859sw1 Shadow damage.}
Soulseeker Arrow 1251 2.7% 7.2 37.47sec 51862 0 Periodic 86.2 4352 0 4352 0.0% 38.8%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.24 0.00 86.23 86.23 2.44 0.0000 1.3496 375247.16 375247.16 0.00% 3224.69 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 86.23 22 183 4351.90 30 4896 4349.40 4227 4608 375247 375247 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:4032.41
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1922}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 3655 7.9% 17.5 17.52sec 62794 114479 Periodic 166.7 5553 11361 6573 17.6% 98.9%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.45 0.00 166.72 166.72 16.01 0.5485 1.7791 1095910.01 1095910.01 0.00% 3579.17 114479.27
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.43% 137.43 97 180 5552.89 8 7948 5551.82 5312 5841 763130 763130 0.00%
crit 17.57% 29.29 10 52 11360.81 8 15895 11362.59 10137 12755 332780 332780 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.222156
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [N]:8.58
  • target_if_expr:(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
Void Torrent 2679 5.8% 4.7 68.27sec 169353 52343 Periodic 28.3 22887 46432 28332 23.1% 4.7%

Stats Details: Void Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.73 0.00 28.30 28.30 0.00 3.2356 0.4993 801686.95 801686.95 0.00% 52343.10 52343.10
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 76.87% 21.75 9 34 22887.01 600 33450 22866.17 18586 27864 497820 497820 0.00%
crit 23.13% 6.54 0 17 46432.30 1200 66900 46417.01 0 66291 303867 303867 0.00%

Action Details: Void Torrent

  • id:263165
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:15.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.402500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:263165
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=0} Shadow damage to the target every {$t1=1} sec.
  • description:Channel a torrent of void energy into the target, dealing {$=}o Shadow damage over {$d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$289577s1=1500}*{$289577s2=4}/100} Insanity over the duration.|r

Action Priority List

    main
    [T]:4.73
  • if_expr:insanity<=35
  • target_if_expr:variable.dots_up
pet - mindbender 11403 / 5245
Inescapable Torment 0 (2840) 0.0% (6.2%) 41.1 7.11sec 20677 0

Stats Details: Inescapable Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.11 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Inescapable Torment

  • id:373427
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:373427
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.
    Inescapable Torment (_damage) 6170 6.2% 41.1 7.11sec 20677 0 Direct 41.1 16431 34158 20677 24.0%

Stats Details: Inescapable Torment Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.11 41.11 0.00 0.00 0.00 0.0000 0.0000 850116.42 850116.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.05% 31.27 12 53 16431.44 9259 24138 16428.40 14393 18510 513741 513741 0.00%
crit 23.95% 9.85 1 22 34158.04 18518 48275 34180.52 23940 42575 336375 336375 0.00%

Action Details: Inescapable Torment Damage

  • id:373442
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.923780
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:373442
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:{$@spelldesc373427=Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.}
melee 5233 5.2% 130.6 2.24sec 5512 5338 Direct 130.6 4478 9096 5512 22.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 130.60 130.60 0.00 0.00 0.00 1.0326 0.0000 719884.75 719884.75 0.00% 5338.41 5338.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.60% 101.34 64 137 4477.95 3944 6103 4476.75 4239 4833 453809 453809 0.00%
crit 22.40% 29.25 8 52 9095.66 7887 12205 9097.54 8273 10291 266076 266076 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 0
Mental Fortitude 465 100.0% 324.8 0.91sec 429 0 Direct 335.6 416 0 416 0.0%

Stats Details: Mental Fortitude

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 324.85 335.56 0.00 0.00 0.00 0.0000 0.0000 139451.20 6725241.55 97.93% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 335.56 247 421 415.58 0 26666 415.97 207 624 139451 6725242 97.92%

Action Details: Mental Fortitude

  • id:377065
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21610.00
  • base_dd_max:21610.00
  • base_dd_mult:1.00

Spelldata

  • id:377065
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 2.9 123.42sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    default
    [D]:2.95
  • if_expr:buff.power_infusion.up|fight_remains<=15
Dark Ascension 5.3 61.80sec

Stats Details: Dark Ascension

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 103.18 0.00 0.00 1.1672 1.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Dark Ascension

  • id:391109
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:30.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:391109
  • name:Dark Ascension
  • school:shadow
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r

Action Priority List

    cds
    [G]:5.35
  • if_expr:pet.fiend.active|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
Desperate Prayer 0.3 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.30 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [J]:0.30
  • if_expr:health.pct<=75
Devouring Plague (_heal) 173.5 1.72sec

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 173.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 77.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Halo (_heal) 3.6 80.57sec

Stats Details: Halo Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.56 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Halo Heal

  • id:390971
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.610000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390971
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Mindbender 5.4 60.88sec

Stats Details: Mindbender

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.44 0.00 0.00 0.00 0.00 1.1688 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindbender

  • id:200174
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$=}{{$200010s1=300}/100} Insanity each time the Mindbender attacks.|r

Action Priority List

    cds
    [I]:5.44
  • if_expr:(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
Mindgames (_damage_reversal) 6.7 46.63sec

Stats Details: Mindgames Damage Reversal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 6.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindgames Damage Reversal

  • id:323706
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:323706
  • name:Mindgames
  • school:shadow
  • tooltip:
  • description:{$@spelldesc323673=Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. {$?=}c3[For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing generate up to {$=}{{$323706s2=10}*2} Insanity.|r] ][For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing restore up to {$=}{{$323706s3=2}*2}% mana.|r]}
Elemental Potion of Ultimate Power 1.4 309.01sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.41 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.41
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
Power Infusion 2.9 123.61sec

Stats Details: Power Infusion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Power Infusion

  • id:10060
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.

Action Priority List

    cds
    [F]:2.93
  • if_expr:(buff.voidform.up|buff.dark_ascension.up)
Shadow Crash (_dots) 8.0 35.48sec

Stats Details: Shadow Crash Dots

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadow Crash Dots

  • id:391286
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:391286
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 2.9 123.37sec

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 166.7 1.78sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 166.72 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2094.72
  • base_dd_max:2094.72
  • base_dd_mult:1.00

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ancient Madness 5.3 0.0 61.8sec 61.8sec 19.4sec 34.44% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_ancient_madness
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.1s / 64.6s
  • trigger_min/max:61.1s / 64.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • ancient_madness_1:1.67%
  • ancient_madness_2:1.67%
  • ancient_madness_3:1.68%
  • ancient_madness_4:1.68%
  • ancient_madness_5:1.69%
  • ancient_madness_6:1.70%
  • ancient_madness_7:1.70%
  • ancient_madness_8:1.71%
  • ancient_madness_9:1.71%
  • ancient_madness_10:1.72%
  • ancient_madness_11:1.72%
  • ancient_madness_12:1.73%
  • ancient_madness_13:1.74%
  • ancient_madness_14:1.74%
  • ancient_madness_15:1.75%
  • ancient_madness_16:1.75%
  • ancient_madness_17:1.76%
  • ancient_madness_18:1.77%
  • ancient_madness_19:1.77%
  • ancient_madness_20:1.78%

Spelldata

  • id:341240
  • name:Ancient Madness
  • tooltip:
  • description:Voidform and Dark Ascension increase your critical strike chance by {$s1=10}% for {$194249d=20 seconds}, reducing by {$=}{{$s3=5}/10}.1% every sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.9 0.0 123.4sec 123.4sec 14.7sec 14.51% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:120.0s / 127.5s
  • trigger_min/max:120.0s / 127.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.51%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Coalescing Shadows 53.6 144.6 5.6sec 1.5sec 3.6sec 64.34% 75.95% 70.4 (70.4) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 39.0s
  • trigger_min/max:0.0s / 36.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.6s

Stack Uptimes

  • coalescing_shadows_1:21.05%
  • coalescing_shadows_2:14.36%
  • coalescing_shadows_3:28.93%

Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Coalescing Shadows (_dot) 2.1 50.8 121.4sec 5.7sec 138.3sec 97.84% 98.77% 50.8 (50.8) 1.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows_dot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 356.3s
  • trigger_min/max:0.0s / 40.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.1s

Stack Uptimes

  • coalescing_shadows_dot_1:97.84%

Spelldata

  • id:391244
  • name:Coalescing Shadows
  • tooltip:Your periodic damage is increased by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Ascension 5.3 0.0 61.8sec 61.8sec 19.4sec 34.44% 41.75% 98.2 (98.2) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_ascension
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.1s / 64.6s
  • trigger_min/max:61.1s / 64.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • dark_ascension_1:34.44%

Spelldata

  • id:391109
  • name:Dark Ascension
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Dark Evangelism 1.0 202.6 267.2sec 1.4sec 293.5sec 97.90% 98.36% 198.6 (198.6) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_evangelism
  • max_stacks:5
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:193.5s / 322.7s
  • trigger_min/max:0.0s / 27.7s
  • trigger_pct:100.00%
  • duration_min/max:4.8s / 354.3s

Stack Uptimes

  • dark_evangelism_1:0.15%
  • dark_evangelism_2:0.15%
  • dark_evangelism_3:0.15%
  • dark_evangelism_4:0.29%
  • dark_evangelism_5:97.16%

Spelldata

  • id:391099
  • name:Dark Evangelism
  • tooltip:Periodic Shadow damage increased by {$=}w1%.
  • description:{$@spelldesc391095=Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391095
  • name:Dark Evangelism
  • tooltip:
  • description:Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Death and Madness (_insanity_gain) 0.3 0.0 0.0sec 0.0sec 0.0sec 0.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_insanity_gain
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s

Stack Uptimes

Spelldata

  • id:321973
  • name:Death and Madness
  • tooltip:{$=}{{$m1=750}/100} Insanity generated every {$t1=1} sec.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_reset) 2.5 0.0 24.6sec 24.6sec 16.9sec 14.05% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_reset
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.3s / 46.8s
  • trigger_min/max:20.3s / 46.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • death_and_madness_reset_1:14.05%

Spelldata

  • id:390628
  • name:Death and Madness
  • tooltip:
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:321291
  • name:Death and Madness
  • tooltip:
  • description:If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Desperate Prayer 0.3 0.0 0.0sec 0.0sec 9.2sec 0.92% 0.00% 2.5 (2.5) 0.3

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • desperate_prayer_1:0.92%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Devoured Pride 1.5 0.0 60.6sec 0.0sec 22.5sec 10.89% 12.59% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 63.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.0s / 32.0s

Stack Uptimes

  • devoured_pride_1:10.89%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=5}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=5}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 308.9sec 308.9sec 27.4sec 12.64% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:306.1s / 315.3s
  • trigger_min/max:306.1s / 315.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.64%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mental Fortitude 4.2 320.7 88.4sec 0.9sec 67.3sec 93.72% 100.00% 320.7 (320.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.6s / 344.3s
  • trigger_min/max:0.0s / 44.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 336.9s

Stack Uptimes

  • mental_fortitude_1:93.72%

Spelldata

  • id:377065
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Mind Flay: Insanity 36.4 11.7 8.2sec 6.2sec 3.5sec 41.89% 0.00% 11.7 (11.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_flay_insanity
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 42.6s
  • trigger_min/max:0.9s / 19.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 33.8s

Stack Uptimes

  • mind_flay_insanity_1:41.89%

Spelldata

  • id:391401
  • name:Mind Flay: Insanity
  • tooltip:Mind Flay is temporarily empowered.
  • description:{$@spelldesc391399=Devouring Plague transforms your next Mind Flay into Mind Flay: Insanity. Lasts {$391401d=10 seconds}. {$@=}spellicon391403 {$@=}spellname391403 {$@spelldesc391403=Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Mind Melt 6.1 1.7 39.3sec 29.7sec 5.3sec 10.79% 8.68% 0.2 (0.2) 0.3

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_melt
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 322.9s
  • trigger_min/max:0.8s / 322.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.6s

Stack Uptimes

  • mind_melt_1:8.56%
  • mind_melt_2:2.23%

Spelldata

  • id:391092
  • name:Mind Melt
  • tooltip:The cast time of your next Mind Blast is reduced by {$=}w1% and its critical strike chance is increased by {$s2=25}%.
  • description:{$@spelldesc391090=Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times. Lasts {$391092d=10 seconds}.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Infusion 2.9 0.0 123.6sec 123.6sec 19.4sec 19.00% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:122.3s / 127.5s
  • trigger_min/max:122.3s / 127.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • power_infusion_1:19.00%

Spelldata

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 16.8 1.2 17.4sec 16.2sec 1.9sec 10.76% 27.21% 1.2 (1.2) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:2.40
  • modifier:1.00

Trigger Details

  • interval_min/max:0.5s / 73.1s
  • trigger_min/max:0.4s / 69.9s
  • trigger_pct:7.08%
  • duration_min/max:0.0s / 13.9s

Stack Uptimes

  • shadowy_insight_1:10.76%

Spelldata

  • id:375981
  • name:Shadowy Insight
  • tooltip:Your next Mind Blast is instant cast.
  • description:{$@spelldesc375888=Mind Blast gains an additional charge. Shadow Word: Pain periodic damage has a chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 60.6sec 45.6sec 16.5sec 23.78% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 207.4s
  • trigger_min/max:0.0s / 207.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.6s

Stack Uptimes

  • sophic_devotion_1:23.78%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.7 0.0 152.9sec 152.9sec 19.4sec 4.63% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 253.8s
  • trigger_min/max:120.0s / 253.8s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:4.63%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.8 0.0 156.6sec 156.6sec 19.5sec 4.91% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 250.2s
  • trigger_min/max:120.0s / 250.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:4.91%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.7 0.0 154.4sec 154.4sec 19.4sec 4.83% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 251.1s
  • trigger_min/max:120.0s / 251.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:4.83%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.7 0.0 158.3sec 158.3sec 19.4sec 4.81% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:120.0s / 251.9s
  • trigger_min/max:120.0s / 251.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:4.81%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Surge of Darkness 12.2 15.0 24.4sec 10.6sec 13.3sec 54.22% 100.00% 4.1 (4.1) 8.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_surge_of_darkness
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 136.0s
  • trigger_min/max:0.0s / 131.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 111.6s

Stack Uptimes

  • surge_of_darkness_1:25.16%
  • surge_of_darkness_2:14.41%
  • surge_of_darkness_3:14.65%

Spelldata

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike is instant cast, and deals {$s2=200}% additional damage.
  • description:{$@spelldesc162448=Your Vampiric Touch and Devouring Plague damage has a chance to cause your next Mind Spike to be instant cast and deal {$87160s2=200}% additional damage. Stacks up to {$87160u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Twist of Fate 1.0 203.1 0.0sec 0.5sec 104.3sec 34.78% 32.87% 203.1 (203.1) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 4.7s
  • trigger_pct:100.00%
  • duration_min/max:81.1s / 126.0s

Stack Uptimes

  • twist_of_fate_1:34.78%

Spelldata

  • id:390978
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$=}w1%.
  • description:{$@spelldesc390972=After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390972
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Void Torrent 4.7 0.0 68.2sec 68.2sec 3.0sec 4.72% 0.00% 0.0 (0.0) 4.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 185.5s
  • trigger_min/max:60.0s / 185.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s

Stack Uptimes

  • void_torrent_1:4.72%

Spelldata

  • id:263165
  • name:Void Torrent
  • tooltip:Dealing {$s1=0} Shadow damage to the target every {$t1=1} sec.
  • description:Channel a torrent of void energy into the target, dealing {$=}o Shadow damage over {$d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$289577s1=1500}*{$289577s2=4}/100} Insanity over the duration.|r
  • max_stacks:0
  • duration:3.00
  • cooldown:60.00
  • default_chance:0.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Shadowy Apparition from Devouring Plague 47.9 35.0 61.0 6.3s 0.9s 29.3s
Shadowy Apparition from Mind Blast 61.8 42.0 84.0 4.8s 0.0s 21.3s
Void Tendril proc from Idol of C'Thun 9.9 3.0 20.0 27.8s 0.3s 129.2s
Shadowy Insight procs 16.8 5.0 31.0 17.4s 0.5s 73.1s
Shadowy Insight procs lost to overflow 1.2 0.0 7.0 78.4s 0.5s 345.8s
Shadowy Insight procs not consumed 0.0 0.0 2.0 36.1s 36.1s 36.1s
Coalescing Shadows from Mind Fay 43.7 21.0 72.0 6.5s 0.3s 84.9s
Coalescing Shadows from Shadow Word: Pain 15.3 2.0 31.0 18.4s 0.2s 182.1s
Coalescing Shadows from Shadowy Apparition 8.5 0.0 23.0 30.4s 0.0s 268.6s
Surge of Darkness from Vampiric Touch 13.3 2.0 31.0 21.0s 0.0s 229.9s
Surge of Darkness from Devouring Plague 13.9 2.0 32.0 20.3s 0.0s 231.9s
Mind Blast that consumed Mind Melt and Shadowy Insight 1.3 0.0 7.0 83.5s 1.9s 312.3s
Mind Flay: Insanity casts that did not channel for full ticks 0.2 0.0 1.0 0.0s 0.0s 0.0s
Idol of Y'Shaarj Devoured Violence procs 4.0 3.0 5.0 60.9s 60.0s 64.3s
Void Torrent ticks without full Mastery value 2.8 0.0 17.0 33.5s 0.0s 347.9s
Mindgames casts without full Mastery value 1.8 0.0 6.0 88.6s 35.4s 305.3s
Inescapable Torment expired when Mind Blast was ready 3.6 0.0 8.0 91.8s 0.0s 337.6s
Inescapable Torment expired when Shadow Word: Death was ready 1.3 0.0 7.0 116.1s 0.0s 335.9s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 83.05% 73.58% 89.17% 12.0s 0.0s 65.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Auspicious SpiritsInsanity109.77106.454.36%0.973.323.02%
Insanity Gained from Idol of C'thun Mind Flay'sInsanity145.41288.9411.83%1.991.890.65%
MindbenderInsanity130.60381.2415.61%2.9210.552.69%
Throes of PainInsanity1.004.940.20%4.970.030.66%
Dark AscensionInsanity5.33157.956.47%29.612.081.30%
mana_regenMana825.7456802.63100.00%68.79422550.7188.15%
Mind BlastInsanity61.97370.2015.15%5.971.630.44%
Mind FlayInsanity32.2064.372.63%2.000.030.04%
Mind Flay: InsanityInsanity143.11572.3023.43%4.000.140.02%
Mind SpikeInsanity7.7931.161.28%4.000.000.00%
Shadow CrashInsanity8.95134.315.50%15.000.000.00%
Vampiric TouchInsanity8.5434.161.40%4.000.000.00%
Void TorrentInsanity23.60296.9712.16%12.5857.0516.12%
Usage Type Count Total Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 48.032401.7350.0050.001210.91
HaloMana 3.568888.482500.002499.999.85
MindgamesMana 6.7333667.515000.004999.9510.90
Shadow Word: DeathMana 11.6514565.391250.001250.0023.72
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 216100.0 298.92 295.95 1423861.3 210893.0 -17349.0 216100.0
Mana 49999.0 189.34 190.41 422550.5 49680.2 43753.8 49999.0
Insanity 15.0 8.14 8.01 76.7 41.2 4.0 100.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 46006.03
Minimum 41150.62
Maximum 51895.56
Spread ( max - min ) 10744.95
Range [ ( max - min ) / 2 * 100% ] 11.68%
Standard Deviation 1447.4412
5th Percentile 43741.32
95th Percentile 48508.73
( 95th Percentile - 5th Percentile ) 4767.41
Mean Distribution
Standard Deviation 16.7147
95.00% Confidence Interval ( 45973.27 - 46038.79 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3803
0.1 Scale Factor Error with Delta=300 17885
0.05 Scale Factor Error with Delta=300 71540
0.01 Scale Factor Error with Delta=300 1788486
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 46006.03
Minimum 41150.62
Maximum 51895.56
Spread ( max - min ) 10744.95
Range [ ( max - min ) / 2 * 100% ] 11.68%
Standard Deviation 1447.4412
5th Percentile 43741.32
95th Percentile 48508.73
( 95th Percentile - 5th Percentile ) 4767.41
Mean Distribution
Standard Deviation 16.7147
95.00% Confidence Interval ( 45973.27 - 46038.79 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3803
0.1 Scale Factor Error with Delta=300 17885
0.05 Scale Factor Error with Delta=300 71540
0.01 Scale Factor Error with Delta=300 1788486
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 46006.03
Minimum 41150.62
Maximum 51895.56
Spread ( max - min ) 10744.95
Range [ ( max - min ) / 2 * 100% ] 11.68%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 11380388.89
Minimum 8542450.56
Maximum 14032056.00
Spread ( max - min ) 5489605.44
Range [ ( max - min ) / 2 * 100% ] 24.12%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 295.05
Minimum 0.00
Maximum 1541.08
Spread ( max - min ) 1541.08
Range [ ( max - min ) / 2 * 100% ] 261.16%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 297.46
Minimum 0.00
Maximum 1091.34
Spread ( max - min ) 1091.34
Range [ ( max - min ) / 2 * 100% ] 183.44%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
Default consumables potion=elemental_potion_of_ultimate_power flask=phial_of_tepid_versatility food=fated_fortune_cookie augmentation=draconic_augment_run temporary_enchant=main_hand:howling_rune
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 arcane_torrent
7 0.00 use_item,name=shadowed_orb_of_torment
8 0.00 variable,name=mind_sear_cutoff,op=set,value=2
9 0.00 shadow_crash,if=talent.shadow_crash.enabled
A 0.00 mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
B 0.00 vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled
Default action list Executed every time the actor is available.
# count action,conditions
C 1.41 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
0.00 variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
0.00 variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
0.00 variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
0.00 variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
0.00 variable,name=is_vt_possible,op=set,value=0,default=1
0.00 variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
0.00 variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
0.00 variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
D 2.95 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 variable,name=pool_amount,op=set,value=60
E 0.00 run_action_list,name=main
actions.cds
# count action,conditions
F 2.93 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
0.00 invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
G 5.35 dark_ascension,if=pet.fiend.active|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
H 0.00 call_action_list,name=trinkets
I 5.44 mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
J 0.30 desperate_prayer,if=health.pct<=75
actions.main
# count action,conditions
K 0.00 call_action_list,name=cds
0.00 mind_blast,if=cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time&talent.mind_devourer.rank=2&spell_targets.mind_sear>=3&!buff.mind_devourer.up&spell_targets.mind_sear<=7
Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
L 7.99 mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
0.00 damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
0.00 void_bolt,if=variable.dots_up&insanity<=85
0.00 mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
0.00 mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
M 48.03 devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
N 8.58 vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
0.00 shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
O 22.44 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun
P 11.65 shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
Q 54.15 mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
R 6.76 mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
S 7.95 shadow_crash,if=raid_event.adds.in>10
0.00 dark_void,if=raid_event.adds.in>20
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
T 4.73 void_torrent,if=insanity<=35,target_if=variable.dots_up
U 0.01 mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
0.00 vampiric_touch,if=buff.unfurling_darkness.up
V 13.49 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
W 3.57 halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
0.00 divine_star,if=spell_targets.divine_star>1
Use when it will hit at least 2 targets.
0.00 lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75|spell_targets.lights_judgment>1
X 7.79 mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
Y 5.40 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>30
Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain
Use Shadow Word: Pain while moving as a low-priority action
actions.trinkets
# count action,conditions
0.00 use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
0.00 use_item,name=darkmoon_deck_box_inferno
0.00 use_item,name=darkmoon_deck_box_rime
0.00 use_item,name=darkmoon_deck_box_dance
Z 2.95 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
0.00 use_item,name=desperate_invokers_codex,if=fight_remains<20|!talent.ancient_madness|(cooldown.dark_ascension.remains>10&talent.dark_ascension)|(cooldown.void_eruption.remains>10&talent.void_eruption)|(!talent.void_eruption&!talent.dark_ascension)
Sync with cooldowns for Ancient Madness or use when the fight will end soon or at full stacks

Sample Sequence

012589IGCFDZLMPQRTMQVMQVWQMNVXLMOXXQXYMOQSXMOQQQMOQRYMOQQNQIMGMPQQSMQQTMVQMVPMOQNYMOQRQSMOQWXXXXQMOIPGFDZMQNLVMQQMSQQMQRTMPQLMQVWMONQYMOQSQQMOXQXYIGMPQRMNQVMVQMSTMOQMQOQXMOQWNXYQMOQRSMOIMGFDZPLLMPQQVMQVXMNQMTMQLMPPJQOMOQMOQNMOQRSMO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 5 shadowform Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 8 mind_sear_cutoff Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 9 shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
0:00.000 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
bloodlust, static_empowerment
0:00.940 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
bloodlust, coalescing_shadows, static_empowerment
0:01.879 default C potion Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2)
0:01.879 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2), elemental_potion_of_ultimate_power
0:01.879 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, power_infusion, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2), elemental_potion_of_ultimate_power
0:01.879 trinkets Z use_items Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows(2), dark_ascension, static_empowerment(2), elemental_potion_of_ultimate_power
0:01.879 main L mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows(2), dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(2), elemental_potion_of_ultimate_power
0:02.633 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(3), elemental_potion_of_ultimate_power
0:03.389 main P shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(19), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(4), elemental_potion_of_ultimate_power
0:04.144 main Q mind_blast Fluffy_Pillow 49957.0/49999: 100% mana
15.0/100: 15% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(18), mental_fortitude, coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:04.900 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(17), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.654 main T void_torrent Fluffy_Pillow 45008.6/49999: 90% mana
28.0/100: 28% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(17), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.108 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(13), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.863 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(13), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.615 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(12), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.115 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
85.0/100: 85% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(10), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.871 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(10), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.626 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(9), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.127 main W halo Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(7), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.881 main Q mind_blast Fluffy_Pillow 47508.6/49999: 95% mana
74.0/100: 74% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(6), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.852 main M devouring_plague Fluffy_Pillow 49062.2/49999: 98% mana
84.0/100: 84% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(6), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.607 main N vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
bloodlust, power_infusion, ancient_madness(5), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.359 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
bloodlust, power_infusion, ancient_madness(4), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.859 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
bloodlust, power_infusion, ancient_madness(3), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.614 main L mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
bloodlust, power_infusion, ancient_madness(2), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_melt, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.368 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
bloodlust, power_infusion, ancient_madness, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.120 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
bloodlust, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.991 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
bloodlust, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.930 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.869 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt(2), sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.815 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.754 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.561 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
85.0/100: 85% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.498 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, mind_flay_insanity, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.372 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_melt, sophic_devotion, static_empowerment(5)
0:34.310 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:35.248 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:36.187 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
bloodlust, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, sophic_devotion, static_empowerment(5)
0:37.126 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
bloodlust, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, mind_flay_insanity, static_empowerment(5)
0:38.999 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
bloodlust, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_melt, static_empowerment(5)
0:39.939 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:40.879 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:42.099 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:43.319 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:45.755 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:46.975 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:48.195 main Y mind_flay Fluffy_Pillow 45005.4/49999: 90% mana
40.0/100: 40% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:51.846 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:53.066 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
3.0/100: 3% insanity
surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:55.503 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity
surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
0:56.724 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:57.945 main N vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:59.166 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:00.388 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:01.606 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:02.826 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:04.046 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:05.268 main P shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
ancient_madness(19), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:06.489 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
ancient_madness(18), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:07.708 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
ancient_madness(17), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:08.929 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
ancient_madness(16), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:10.150 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
ancient_madness(14), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:11.370 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
13.0/100: 13% insanity
ancient_madness(13), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:12.590 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity
ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:13.938 main T void_torrent Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:17.262 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
99.0/100: 99% insanity
ancient_madness(7), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:18.483 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
ancient_madness(6), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:20.919 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity
ancient_madness(4), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:22.140 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
85.0/100: 85% insanity
ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:23.360 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
ancient_madness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:25.796 main P shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:27.018 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:28.240 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:30.678 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:31.897 main N vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:33.119 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:36.771 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
1:37.991 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:40.428 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:41.648 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:42.870 main Q mind_blast Fluffy_Pillow 45008.6/49999: 90% mana
31.0/100: 31% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:44.092 main S shadow_crash Fluffy_Pillow 46963.8/49999: 94% mana
38.0/100: 38% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:45.314 main M devouring_plague Fluffy_Pillow 48919.0/49999: 98% mana
53.0/100: 53% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:46.533 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:48.969 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:50.425 main W halo Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:51.646 main X mind_spike Fluffy_Pillow 47507.0/49999: 95% mana
27.0/100: 27% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:52.866 main X mind_spike Fluffy_Pillow 49459.0/49999: 99% mana
31.0/100: 31% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
1:54.086 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt(2), static_empowerment(5)
1:55.307 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt(2), static_empowerment(5)
1:56.527 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_melt(2), static_empowerment(5)
1:57.748 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:58.969 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
1.0/100: 1% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:01.406 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
2:02.628 main P shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:03.848 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:05.263 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
ancient_madness(20), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
2:05.263 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
power_infusion, ancient_madness(20), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
2:05.263 trinkets Z use_items Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
blood_fury, power_infusion, ancient_madness(20), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
2:05.263 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
blood_fury, power_infusion, ancient_madness(20), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:06.240 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
blood_fury, power_infusion, ancient_madness(20), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:07.218 main N vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
blood_fury, power_infusion, ancient_madness(19), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:08.194 main L mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
blood_fury, power_infusion, ancient_madness(18), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:09.173 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
blood_fury, power_infusion, ancient_madness(17), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:11.121 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
blood_fury, power_infusion, ancient_madness(15), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:12.099 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
blood_fury, power_infusion, ancient_madness(14), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:13.076 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
blood_fury, power_infusion, ancient_madness(13), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:14.055 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
blood_fury, power_infusion, ancient_madness(12), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:15.033 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
blood_fury, power_infusion, ancient_madness(11), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:16.011 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
blood_fury, power_infusion, ancient_madness(10), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:16.988 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
blood_fury, power_infusion, ancient_madness(9), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:17.965 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
blood_fury, power_infusion, ancient_madness(8), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:18.942 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity
blood_fury, power_infusion, ancient_madness(7), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:19.919 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
blood_fury, power_infusion, ancient_madness(6), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:20.896 main T void_torrent Fluffy_Pillow 45005.4/49999: 90% mana
22.0/100: 22% insanity
power_infusion, ancient_madness(5), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:24.173 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
power_infusion, ancient_madness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:25.151 main P shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
power_infusion, ancient_madness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:26.128 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:27.349 main L mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:28.570 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:29.792 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:31.011 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:33.448 main W halo Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:34.668 main M devouring_plague Fluffy_Pillow 47505.4/49999: 95% mana
62.0/100: 62% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:35.889 main O mind_flay Fluffy_Pillow 49459.0/49999: 99% mana
13.0/100: 13% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:38.327 main N vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:39.549 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:40.771 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:44.424 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:45.645 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
3.0/100: 3% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:48.082 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:49.303 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:50.525 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:51.744 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:52.963 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:54.183 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
6.0/100: 6% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:56.619 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:57.841 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
2:59.060 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:00.280 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
3:03.933 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_melt, static_empowerment(5)
3:05.155 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), mind_melt, static_empowerment(5)
3:06.478 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), mind_melt, dark_ascension, static_empowerment(5)
3:07.697 main P shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
ancient_madness(19), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), mind_melt, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:08.918 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
ancient_madness(18), dark_evangelism(5), coalescing_shadows(3), mind_melt, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:10.139 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
ancient_madness(17), dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:11.360 main M devouring_plague Fluffy_Pillow 45007.0/49999: 90% mana
77.0/100: 77% insanity
ancient_madness(16), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:12.580 main N vampiric_touch Fluffy_Pillow 46959.0/49999: 94% mana
31.0/100: 31% insanity
ancient_madness(14), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:13.800 main Q mind_blast Fluffy_Pillow 48911.0/49999: 98% mana
38.0/100: 38% insanity
ancient_madness(13), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:15.021 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity
twist_of_fate, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:17.458 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity
twist_of_fate, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
3:18.677 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
twist_of_fate, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:21.114 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
twist_of_fate, ancient_madness(6), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
3:22.333 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, ancient_madness(5), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
3:23.553 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
twist_of_fate, ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:24.773 main T void_torrent Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
twist_of_fate, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:28.103 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
94.0/100: 94% insanity
twist_of_fate, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:29.324 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:31.761 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
twist_of_fate, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:32.981 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:34.202 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:35.423 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:37.859 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:39.078 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:40.298 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
3:41.520 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, mind_flay_insanity, static_empowerment(5)
3:43.957 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_melt, static_empowerment(5)
3:45.176 main W halo Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:46.398 main N vampiric_touch Fluffy_Pillow 47508.6/49999: 95% mana
27.0/100: 27% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:47.620 main X mind_spike Fluffy_Pillow 49463.8/49999: 99% mana
31.0/100: 31% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:48.840 main Y mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_melt, static_empowerment(5)
3:52.493 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_melt, static_empowerment(5)
3:53.713 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:54.933 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
5.0/100: 5% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:57.370 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:58.591 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:59.811 main S shadow_crash Fluffy_Pillow 45005.4/49999: 90% mana
42.0/100: 42% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:01.031 main M devouring_plague Fluffy_Pillow 46957.4/49999: 94% mana
61.0/100: 61% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:02.251 main O mind_flay Fluffy_Pillow 48909.4/49999: 98% mana
16.0/100: 16% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:04.687 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:05.907 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:07.127 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:08.349 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
twist_of_fate, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:08.349 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
power_infusion, twist_of_fate, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:08.349 trinkets Z use_items Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
blood_fury, power_infusion, twist_of_fate, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:08.349 main P shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
blood_fury, power_infusion, twist_of_fate, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:09.326 main L mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:10.305 main L mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(19), surge_of_darkness(2), dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:11.284 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(18), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:12.260 main P shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(17), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:13.238 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(16), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:14.216 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(15), surge_of_darkness(2), dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:15.194 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(14), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:17.141 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
79.0/100: 79% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(12), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:18.119 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(11), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:19.097 main V mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(10), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:21.046 main X mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(8), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:22.023 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
82.0/100: 82% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(7), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_melt, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:22.999 main N vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(6), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_melt, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:23.977 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(5), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_melt, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:24.954 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(4), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:25.933 main T void_torrent Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:29.203 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:30.425 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
twist_of_fate, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:31.646 main L mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:32.867 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
77.0/100: 77% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:34.086 main P shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:35.306 main P shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:36.525 cds J desperate_prayer PR_Priest_Shadow 49999.0/49999: 100% mana
37.0/100: 37% insanity
twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:36.525 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:37.747 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:40.183 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, surge_of_darkness, shadowy_insight, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:41.404 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:43.841 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
4:45.062 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:46.282 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
11.0/100: 11% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:48.720 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:49.940 main N vampiric_touch Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:51.160 main M devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:52.380 main O mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:54.816 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:56.036 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:57.257 main S shadow_crash Fluffy_Pillow 45007.0/49999: 90% mana
45.0/100: 45% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:58.477 main M devouring_plague Fluffy_Pillow 46959.0/49999: 94% mana
60.0/100: 60% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:59.698 main O mind_flay Fluffy_Pillow 48912.6/49999: 98% mana
11.0/100: 11% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3463 1 10805 10291 6827
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 216100 205820 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +687 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +515 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +687 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +687 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +89 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +515 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +386 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +386 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +687 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIk0CBAAAAAAAAAAAAQikkSkmU0iEJlESEkGJJJSIIBh0kWIJAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
# Default consumables potion=elemental_potion_of_ultimate_power flask=phial_of_tepid_versatility food=fated_fortune_cookie augmentation=draconic_augment_run temporary_enchant=main_hand:howling_rune
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/use_item,name=shadowed_orb_of_torment
actions.precombat+=/variable,name=mind_sear_cutoff,op=set,value=2
actions.precombat+=/shadow_crash,if=talent.shadow_crash.enabled
actions.precombat+=/mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
actions.precombat+=/vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled

# Executed every time the actor is available.
actions=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
actions+=/variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions+=/variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
actions+=/variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
actions+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
actions+=/variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
actions+=/variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
actions+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
actions+=/variable,name=pool_amount,op=set,value=60
actions+=/run_action_list,name=main

actions.cds=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)&!buff.power_infusion.up
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
actions.cds+=/dark_ascension,if=pet.fiend.active|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
actions.cds+=/call_action_list,name=trinkets
actions.cds+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.main=call_action_list,name=cds
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
actions.main+=/mind_blast,if=cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time&talent.mind_devourer.rank=2&spell_targets.mind_sear>=3&!buff.mind_devourer.up&spell_targets.mind_sear<=7
actions.main+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max+cast_time|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
actions.main+=/damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
actions.main+=/void_bolt,if=variable.dots_up&insanity<=85
# Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
actions.main+=/mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
# Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
actions.main+=/mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.main+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd)&variable.dp_cutoff
actions.main+=/vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
actions.main+=/shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(talent.inescapable_torment.rank<2|!pet.fiend.active)&cooldown.mind_blast.full_recharge_time>=gcd*3&talent.idol_of_cthun
actions.main+=/shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment.rank>1&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
actions.main+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
actions.main+=/mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
actions.main+=/shadow_crash,if=raid_event.adds.in>10
actions.main+=/dark_void,if=raid_event.adds.in>20
actions.main+=/devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
actions.main+=/void_torrent,if=insanity<=35,target_if=variable.dots_up
actions.main+=/mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
actions.main+=/vampiric_touch,if=buff.unfurling_darkness.up
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
# Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
actions.main+=/halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
# Use when it will hit at least 2 targets.
actions.main+=/divine_star,if=spell_targets.divine_star>1
actions.main+=/lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75|spell_targets.lights_judgment>1
actions.main+=/mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&!talent.idol_of_cthun
actions.main+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
actions.main+=/shadow_crash,if=raid_event.adds.in>30
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.main+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.main+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.main+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.main+=/shadow_word_pain

actions.trinkets=use_item,name=voidmenders_shadowgem,if=buff.power_infusion.up|fight_remains<20
actions.trinkets+=/use_item,name=darkmoon_deck_box_inferno
actions.trinkets+=/use_item,name=darkmoon_deck_box_rime
actions.trinkets+=/use_item,name=darkmoon_deck_box_dance
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|(cooldown.void_eruption.remains>10&trinket.cooldown.duration<=60)|fight_remains<20
# Sync with cooldowns for Ancient Madness or use when the fight will end soon or at full stacks
actions.trinkets+=/use_item,name=desperate_invokers_codex,if=fight_remains<20|!talent.ancient_madness|(cooldown.dark_ascension.remains>10&talent.dark_ascension)|(cooldown.void_eruption.remains>10&talent.void_eruption)|(!talent.void_eruption&!talent.dark_ascension)

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=6827
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 45440 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45439.9 45439.9 43.8 / 0.096% 7618.8 / 16.8% 58.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
738.1 736.0 Mana 0.64% 52.5 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 45440
Elemental Blast 8038 17.7% 20.9 14.23sec 115123 99008 Direct 20.9 94946 190680 115169 21.1% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.93 20.92 0.00 0.00 0.00 1.1628 0.0000 2409568.34 2409568.34 0.00% 99008.44 99008.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.87% 16.50 8 26 94945.88 45563 202561 94970.91 73236 116876 1566799 1566799 0.00%
crit 21.13% 4.42 0 13 190680.04 91126 395184 189780.61 0 336285 842769 842769 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [L]:10.42
  • if_expr:talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
    single
    [O]:1.25
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
    single
    [S]:9.26
  • if_expr:talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
Flame Shock 4732 10.4% 83.9 3.57sec 16905 129383 Direct 83.9 6115 12282 7186 17.4% 0.0%
Periodic 192.2 3611 7254 4244 17.4% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 83.92 83.92 192.19 192.19 82.92 0.1307 1.5510 1418686.20 1418686.20 0.00% 4590.50 129383.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 69.36 42 105 6115.36 3343 14041 6115.09 5407 7272 424140 424140 0.00%
crit 17.35% 14.56 2 33 12281.99 6685 27102 12283.92 9911 15952 178871 178871 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.62% 158.78 115 206 3610.85 1715 8027 3610.82 3189 4205 573339 573339 0.00%
crit 17.38% 33.41 11 61 7253.68 3496 15686 7253.72 6089 8726 242336 242336 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [X]:9.13
Flametongue Weapon 0 (924) 0.0% (2.0%) 1.0 0.00sec 277138 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 924 2.0% 676.6 0.72sec 410 0 Direct 676.6 348 700 410 17.4% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 676.58 676.58 0.00 0.00 0.00 0.0000 0.0000 277137.79 277137.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 558.76 392 731 348.42 289 593 348.43 321 395 194681 194681 0.00%
crit 17.41% 117.82 63 192 699.86 579 1186 699.90 629 801 82456 82456 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1092 2.4% 28.4 7.72sec 11533 0 Direct 28.4 9805 19714 11533 17.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.42 28.42 0.00 0.00 0.00 0.0000 0.0000 327715.39 327715.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 23.46 2 64 9804.96 9732 10030 9804.94 9732 10030 230033 230033 0.00%
crit 17.44% 4.95 0 19 19714.12 19463 20059 19314.60 0 20059 97682 97682 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 5251 11.6% 39.8 7.51sec 39516 34073 Direct 39.8 33620 67231 39516 17.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.83 39.83 0.00 0.00 0.00 1.1598 0.0000 1574070.98 1574070.98 0.00% 34073.01 34073.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.46% 32.85 17 49 33620.24 7659 106960 33693.63 25307 43962 1104325 1104325 0.00%
crit 17.54% 6.99 0 19 67230.84 15318 221340 67275.16 0 130147 469746 469746 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [N]:35.43
  • if_expr:buff.hailstorm.up
    single
    [V]:4.40
Ice Strike 1883 4.1% 24.5 12.35sec 22996 19788 Direct 24.5 19596 39305 22996 17.3% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.54 24.54 0.00 0.00 0.00 1.1622 0.0000 564216.16 564216.16 0.00% 19788.03 19788.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 20.30 9 30 19596.31 15010 42683 19601.09 17031 23799 397860 397860 0.00%
crit 17.25% 4.23 0 13 39305.39 30020 82771 38868.13 0 80444 166357 166357 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:24.54
  • if_expr:talent.hailstorm.enabled
Lava Lash 9197 20.2% 67.9 4.37sec 40622 34898 Direct 67.9 (67.9) 34550 69362 40622 17.4% (17.4%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.86 67.86 0.00 0.00 0.00 1.1640 0.0000 2756551.66 2756551.66 0.00% 34897.92 34897.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 56.02 25 91 34550.41 17705 119558 34564.27 29324 41796 1935582 1935582 0.00%
crit 17.44% 11.84 2 29 69361.74 35409 247937 69407.13 50440 104223 820969 820969 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [I]:50.02
  • if_expr:buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
    single
    [R]:17.84
Lightning Bolt 3327 7.3% 16.3 18.74sec 61311 51427 Direct 16.3 50442 101049 61309 21.5% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.26 16.26 0.00 0.00 0.00 1.1922 0.0000 996762.42 996762.42 0.00% 51427.22 51427.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.52% 12.77 4 22 50441.86 28816 126696 50584.49 36817 70038 643952 643952 0.00%
crit 21.48% 3.49 0 11 101048.52 57633 244549 98942.01 0 213693 352811 352811 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [K]:7.00
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [P]:0.27
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [T]:8.99
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1731 3.8% 193.3 1.81sec 2685 1508 Direct 193.3 2653 5332 2685 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.31 193.31 0.00 0.00 0.00 1.7809 0.0000 519119.86 741618.70 30.00% 1507.86 1507.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.22% 128.02 85 175 2652.78 2257 4339 2652.80 2455 3015 339606 485164 30.00%
crit 17.42% 33.67 13 60 5331.99 4513 8588 5332.31 4700 6133 179513 256454 30.00%
miss 16.36% 31.63 13 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 867 1.9% 193.4 1.80sec 1344 755 Direct 193.4 1328 2670 1344 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.39 193.39 0.00 0.00 0.00 1.7810 0.0000 259912.47 371312.99 30.00% 754.61 754.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.23% 128.08 80 178 1327.75 1128 2169 1327.87 1219 1468 170054 242940 30.00%
crit 17.40% 33.66 12 59 2669.74 2257 4294 2669.49 2401 3058 89859 128373 30.00%
miss 16.37% 31.66 12 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 162 (2855) 0.4% (6.3%) 7.0 45.72sec 121578 102078 Direct 7.0 (14.0) 5884 11871 6919 17.3% (19.2%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.00 1.1911 0.0000 48627.70 48627.70 0.00% 102078.36 102078.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.72% 5.81 1 8 5884.19 4707 9102 5886.26 4707 7727 34210 34210 0.00%
crit 17.28% 1.21 0 6 11871.14 9413 18203 8752.96 0 18016 14418 14418 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:7.03
  • if_expr:buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
    Lightning Bolt (_pw) 2692 5.9% 7.0 45.90sec 115243 0 Direct 7.0 94998 190892 115238 21.1% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.00 0.0000 0.0000 806176.48 806176.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.89% 5.52 0 8 94998.47 67238 190043 95061.55 0 141025 524281 524281 0.00%
crit 21.11% 1.48 0 8 190892.37 134477 377136 153720.52 0 366381 281895 281895 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (1956) 0.0% (4.3%) 51.6 5.75sec 11360 9714

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.62 0.00 0.00 0.00 0.00 1.1694 0.0000 0.00 0.00 0.00% 9714.27 9714.27

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [Q]:51.62
    Stormstrike (_mh) 1304 2.9% 51.6 5.75sec 7573 0 Direct 51.6 6443 12936 7573 17.4% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.62 51.62 0.00 0.00 0.00 0.0000 0.0000 390939.69 558499.51 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 42.64 22 68 6443.23 5465 10690 6442.69 5855 7349 274717 392462 30.00%
crit 17.40% 8.98 0 24 12935.80 10930 21381 12937.48 0 17654 116223 166037 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 652 1.4% 51.6 5.75sec 3787 0 Direct 51.6 3220 6479 3787 17.4% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.62 51.62 0.00 0.00 0.00 0.0000 0.0000 195491.39 279280.54 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 42.65 23 67 3220.41 2733 5345 3220.25 2913 3643 137337 196200 30.00%
crit 17.39% 8.98 0 23 6479.33 5465 10690 6477.36 0 8732 58155 83080 29.99%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 777 1.7% 5.7 53.70sec 40606 34912 Direct 5.7 34481 69229 40604 17.6% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.74 5.74 0.00 0.00 0.00 1.1632 0.0000 232968.44 232968.44 0.00% 34912.10 34912.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.37% 4.73 0 8 34481.05 26685 75072 34475.96 0 51492 162955 162955 0.00%
crit 17.63% 1.01 0 5 69228.52 53369 155062 45779.62 0 150333 70013 70013 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [U]:5.74
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (715) 0.0% (1.6%) 1.0 0.00sec 214324 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 715 1.6% 151.8 4.06sec 1412 0 Direct 151.8 1201 2414 1412 17.4% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 151.78 151.78 0.00 0.00 0.00 0.0000 0.0000 214323.64 306184.44 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 125.37 59 200 1201.05 1016 1988 1201.08 1087 1381 150581 215121 30.00%
crit 17.40% 26.41 9 51 2413.87 2032 3976 2413.58 2121 2810 63743 91063 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
pet - greater_earth_elemental 415 / 87
melee 415 0.2% 40.1 2.27sec 643 422 Direct 40.1 547 1094 643 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.05 40.05 0.00 0.00 0.00 1.5238 0.0000 25737.67 36769.04 30.00% 421.73 421.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.57% 33.07 11 63 547.31 475 919 546.39 475 698 18099 25857 30.00%
crit 17.43% 6.98 0 21 1093.90 950 1783 1092.13 0 1501 7638 10912 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2295 / 670
melee 2295 1.5% 89.2 3.41sec 2248 1998 Direct 89.2 1916 3824 2248 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.16 89.16 0.00 0.00 0.00 1.1254 0.0000 200461.29 286380.58 30.00% 1997.78 1997.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 73.63 8 167 1915.93 1588 3071 1914.03 1588 2421 141063 201524 30.00%
crit 17.42% 15.53 0 51 3824.25 3176 6141 3821.36 0 5592 59398 84857 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2300 / 671
melee 2300 1.5% 89.3 3.42sec 2249 1997 Direct 89.3 1915 3825 2249 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.30 89.30 0.00 0.00 0.00 1.1261 0.0000 200805.96 286872.97 30.00% 1996.98 1996.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.52% 73.69 9 176 1914.85 1588 3071 1912.80 1588 2563 141100 201576 30.00%
crit 17.48% 15.61 1 45 3825.26 3176 6141 3822.37 3176 5258 59706 85297 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2282 / 668
melee 2282 1.5% 89.4 3.42sec 2235 1984 Direct 89.4 1904 3803 2235 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.43 89.43 0.00 0.00 0.00 1.1261 0.0000 199831.78 285481.25 30.00% 1984.39 1984.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 73.86 7 178 1904.05 1588 3071 1902.84 1588 2480 140637 200915 30.00%
crit 17.41% 15.57 0 42 3802.80 3176 6082 3798.58 0 5415 59195 84566 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 309.92sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.13 0.00 0.00 0.00 0.00 1.0230 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [W]:1.13
Feral Spirit 10.7 30.07sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.73 0.00 0.00 0.00 0.00 1.1802 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:10.73
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.65sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.47
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 67.4 124.8 4.4sec 1.6sec 3.6sec 81.45% 98.19% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.4s

Stack Uptimes

  • ashen_catalyst_1:31.47%
  • ashen_catalyst_2:16.73%
  • ashen_catalyst_3:12.08%
  • ashen_catalyst_4:9.85%
  • ashen_catalyst_5:6.16%
  • ashen_catalyst_6:3.11%
  • ashen_catalyst_7:1.60%
  • ashen_catalyst_8:0.44%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.0 0.0 48.4sec 48.4sec 14.7sec 29.24% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 310.8s
  • trigger_min/max:12.3s / 310.8s
  • trigger_pct:85.00%
  • duration_min/max:0.0s / 29.8s

Stack Uptimes

  • crackling_surge_1:23.38%
  • crackling_surge_2:5.85%
  • crackling_surge_3:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.5sec 12.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 165.0s
  • trigger_pct:100.00%
  • duration_min/max:16.2s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.35%
  • crumbling_power_3:0.58%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.67%
  • crumbling_power_7:0.66%
  • crumbling_power_8:0.66%
  • crumbling_power_9:0.65%
  • crumbling_power_10:0.63%
  • crumbling_power_11:0.63%
  • crumbling_power_12:0.63%
  • crumbling_power_13:0.63%
  • crumbling_power_14:0.64%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.73%
  • crumbling_power_17:0.78%
  • crumbling_power_18:0.82%
  • crumbling_power_19:1.00%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 6.1 0.8 45.2sec 39.0sec 10.8sec 21.86% 0.00% 0.8 (0.8) 5.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 325.8s
  • trigger_min/max:1.6s / 318.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.3s

Stack Uptimes

  • elemental_blast_critical_strike_1:21.86%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 6.1 0.9 45.2sec 38.7sec 10.8sec 22.02% 0.00% 0.9 (0.9) 5.9

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 294.0s
  • trigger_min/max:1.6s / 294.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.3s

Stack Uptimes

  • elemental_blast_haste_1:22.02%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 6.2 0.8 44.6sec 38.6sec 10.7sec 22.09% 0.00% 0.8 (0.8) 6.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 304.2s
  • trigger_min/max:1.6s / 304.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.2s

Stack Uptimes

  • elemental_blast_mastery_1:22.09%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 124.0sec 98.6sec 58.0sec 25.12% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 332.8s

Stack Uptimes

  • elemental_chaos_air_1:25.12%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.8sec 100.4sec 58.2sec 24.94% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 336.2s

Stack Uptimes

  • elemental_chaos_earth_1:24.94%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 120.9sec 96.3sec 58.2sec 25.55% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:25.55%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.5sec 99.8sec 57.4sec 24.40% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:24.40%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.7sec 302.7sec 27.5sec 13.17% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.0s
  • trigger_min/max:300.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.17%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 0.0 29.2sec 30.1sec 14.7sec 52.54% 0.00% 42.0 (42.0) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 49.1s
  • trigger_min/max:16.6s / 46.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • feral_spirit_1:52.54%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 49.6 231.5 6.1sec 1.1sec 4.8sec 79.02% 87.95% 231.5 (500.2) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 50.4s
  • trigger_min/max:0.0s / 17.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.2s

Stack Uptimes

  • flurry_1:21.75%
  • flurry_2:34.30%
  • flurry_3:22.98%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.4sec 46.2sec 13.0sec 19.45% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 198.2s
  • trigger_min/max:0.3s / 198.2s
  • trigger_pct:98.82%
  • duration_min/max:0.0s / 60.0s

Stack Uptimes

  • forgestorm_ignited_1:19.45%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 35.7 1.5 8.4sec 8.1sec 2.2sec 26.06% 89.06% 1.5 (10.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 33.0s
  • trigger_min/max:1.2s / 33.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.2s

Stack Uptimes

  • hailstorm_5:4.81%
  • hailstorm_6:3.42%
  • hailstorm_7:2.66%
  • hailstorm_8:4.40%
  • hailstorm_9:2.56%
  • hailstorm_10:8.22%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.6 5.6 27.6sec 17.5sec 9.9sec 35.05% 88.55% 5.6 (5.6) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 211.8s
  • trigger_min/max:0.0s / 211.8s
  • trigger_pct:5.02%
  • duration_min/max:0.0s / 54.4s

Stack Uptimes

  • hot_hand_1:35.05%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.5 0.0 12.4sec 12.3sec 3.9sec 32.23% 60.23% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 28.1s
  • trigger_min/max:7.7s / 25.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.8s

Stack Uptimes

  • ice_strike_1:32.23%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 6.0 0.0 48.4sec 48.4sec 14.7sec 29.16% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 295.0s
  • trigger_min/max:12.3s / 295.0s
  • trigger_pct:84.89%
  • duration_min/max:0.0s / 29.2s

Stack Uptimes

  • icy_edge_1:23.29%
  • icy_edge_2:5.87%
  • icy_edge_3:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 38.1 227.3 8.0sec 2.3sec 6.9sec 87.39% 100.00% 16.9 (36.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 33.3s
  • trigger_min/max:0.0s / 17.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.9s

Stack Uptimes

  • maelstrom_weapon_1:11.18%
  • maelstrom_weapon_2:12.85%
  • maelstrom_weapon_3:13.20%
  • maelstrom_weapon_4:13.16%
  • maelstrom_weapon_5:10.15%
  • maelstrom_weapon_6:8.02%
  • maelstrom_weapon_7:6.21%
  • maelstrom_weapon_8:4.08%
  • maelstrom_weapon_9:2.27%
  • maelstrom_weapon_10:6.26%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 5.9 0.0 48.3sec 48.3sec 14.7sec 29.15% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 296.6s
  • trigger_min/max:12.2s / 296.6s
  • trigger_pct:85.09%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • molten_weapon_1:23.34%
  • molten_weapon_2:5.81%
  • molten_weapon_3:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Primordial Wave 7.0 0.0 45.7sec 45.7sec 2.0sec 4.58% 43.60% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 53.5s
  • trigger_min/max:45.0s / 53.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.7s

Stack Uptimes

  • primordial_wave_1:4.58%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.2 60.9sec 45.5sec 16.5sec 23.72% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 228.4s
  • trigger_min/max:0.0s / 221.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.4s

Stack Uptimes

  • sophic_devotion_1:23.72%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.9sec 45.6sec 32.2sec 38.34% 0.00% 25.8 (25.8) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 248.4s
  • trigger_min/max:0.0s / 208.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 175.4s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.84%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 7.0 0.0 45.9sec 45.9sec 11.8sec 27.59% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:39.1s / 53.8s
  • trigger_min/max:39.1s / 53.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • splintered_elements_1:27.59%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 30.7 8.7 9.6sec 7.4sec 2.8sec 29.12% 58.32% 8.7 (8.7) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 104.3s
  • trigger_min/max:0.0s / 104.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.5s

Stack Uptimes

  • stormbringer_1:29.12%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.8 10.0 46.0 10.9s 1.1s 132.5s
windfury_totem_extra_attack_oh 26.8 9.0 50.0 10.9s 1.1s 127.3s
Maelstrom Weapon: Feral Spirit 63.0 47.0 80.0 4.8s 0.0s 31.6s
Maelstrom Weapon: Swirling Maelstrom 60.0 43.0 79.0 5.0s 0.8s 25.2s
Maelstrom Weapon: Primordial Wave 70.3 60.0 80.0 45.7s 45.0s 53.5s
Flametongue: Windfury Attack 151.8 80.0 240.0 4.1s 0.0s 50.4s
Stormbringer: Windfury Attack 16.9 4.0 37.0 17.9s 0.0s 234.6s
Maelstrom Weapon: Windfury Attack 30.3 10.0 61.0 10.8s 0.0s 137.9s
Flametongue: main_hand 161.7 109.0 216.0 2.2s 1.1s 20.1s
Hot Hand: main_hand 8.1 0.0 22.0 33.0s 1.1s 314.8s
Maelstrom Weapon: main_hand 32.4 11.0 58.0 9.4s 1.1s 118.0s
Windfury: main_hand 50.4 23.0 83.0 6.2s 1.1s 76.3s
Flametongue: offhand 161.7 114.0 215.0 2.2s 1.1s 20.0s
Hot Hand: offhand 8.2 1.0 23.0 32.7s 1.1s 279.4s
Maelstrom Weapon: offhand 32.4 13.0 58.0 9.4s 1.1s 111.9s
Flametongue: Sundering 5.7 2.0 8.0 53.7s 40.0s 201.4s
Stormbringer: Sundering 0.6 0.0 6.0 115.9s 40.0s 343.7s
Maelstrom Weapon: Sundering 1.1 0.0 6.0 105.9s 40.0s 337.1s
Windfury: Sundering 1.8 0.0 6.0 96.5s 40.0s 334.6s
Flametongue: Lava Lash 67.9 37.0 107.0 4.4s 0.8s 15.7s
Stormbringer: Lava Lash 7.5 0.0 20.0 34.5s 0.8s 325.4s
Maelstrom Weapon: Lava Lash 13.6 2.0 34.0 20.7s 0.8s 266.4s
Flametongue: Ice Strike 24.5 18.0 30.0 12.3s 7.7s 25.9s
Stormbringer: Ice Strike 2.7 0.0 10.0 69.9s 7.8s 348.9s
Maelstrom Weapon: Ice Strike 4.9 0.0 14.0 50.8s 7.7s 333.3s
Windfury: Ice Strike 7.7 0.0 18.0 35.9s 7.8s 286.0s
Flametongue: Stormstrike 51.6 31.0 75.0 5.7s 0.8s 41.0s
Stormbringer: Stormstrike 5.8 0.0 18.0 41.6s 0.8s 330.8s
Maelstrom Weapon: Stormstrike 10.4 1.0 22.0 26.4s 0.8s 247.0s
Windfury: Stormstrike 16.1 4.0 33.0 17.7s 0.8s 188.9s
Flametongue: Stormstrike Off-Hand 51.6 31.0 75.0 5.7s 0.8s 41.0s
Stormbringer: Stormstrike Off-Hand 5.8 0.0 18.0 41.8s 0.8s 318.3s
Maelstrom Weapon: Stormstrike Off-Hand 10.3 1.0 24.0 26.7s 0.8s 256.8s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 23.22% 13.47% 30.31% 0.5s 0.0s 4.3s
Hot Hand 35.05% 7.63% 65.45% 9.9s 0.0s 54.4s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.8530.0011.5267.6052.05613.496
Sundering14.1630.001161.39764.7436.458181.728
Primordial Wave0.8920.0018.5454.3120.05514.029
Lava Lash0.8860.00111.62957.99923.44395.658
Flame Shock22.5440.001279.579180.8610.000309.065
Ice Strike0.7860.00113.54915.9861.74844.428
Frost Shock3.0000.00128.000110.71861.032167.101
Elemental Blast5.4970.00136.27947.9472.662110.052
Stormstrike1.9690.00125.46794.62937.919161.268
Earth Elemental10.7600.00344.6571.3070.00044.657

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana624.05220811.87100.00%353.84258574.0053.94%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 736.04 738.10 258575.3 49380.7 47000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 20.9328779.501375.001375.0183.73
Flame ShockMana 9.136848.99750.0081.61207.14
Frost ShockMana 39.8319917.14500.00500.0079.03
Ice StrikeMana 24.5440483.181650.001650.0113.94
Lava LashMana 67.8627142.83400.00399.99101.56
Lightning BoltMana 16.268128.85500.00500.01122.62
Primordial WaveMana 7.0310546.391500.001500.0081.05
StormstrikeMana 51.6251622.051000.001000.0111.36
SunderingMana 5.7417212.113000.003000.0413.54

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 45439.85
Minimum 39545.02
Maximum 53818.15
Spread ( max - min ) 14273.13
Range [ ( max - min ) / 2 * 100% ] 15.71%
Standard Deviation 1936.2416
5th Percentile 42410.66
95th Percentile 48775.11
( 95th Percentile - 5th Percentile ) 6364.46
Mean Distribution
Standard Deviation 22.3593
95.00% Confidence Interval ( 45396.03 - 45483.68 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6975
0.1 Scale Factor Error with Delta=300 32004
0.05 Scale Factor Error with Delta=300 128016
0.01 Scale Factor Error with Delta=300 3200389
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 45439.85
Minimum 39545.02
Maximum 53818.15
Spread ( max - min ) 14273.13
Range [ ( max - min ) / 2 * 100% ] 15.71%
Standard Deviation 1936.2416
5th Percentile 42410.66
95th Percentile 48775.11
( 95th Percentile - 5th Percentile ) 6364.46
Mean Distribution
Standard Deviation 22.3593
95.00% Confidence Interval ( 45396.03 - 45483.68 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6975
0.1 Scale Factor Error with Delta=300 32004
0.05 Scale Factor Error with Delta=300 128016
0.01 Scale Factor Error with Delta=300 3200389
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 45439.85
Minimum 39545.02
Maximum 53818.15
Spread ( max - min ) 14273.13
Range [ ( max - min ) / 2 * 100% ] 15.71%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 12992268.62
Minimum 9592402.91
Maximum 17423348.70
Spread ( max - min ) 7830945.79
Range [ ( max - min ) / 2 * 100% ] 30.14%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.47 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 10.73 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
G 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
H 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
I 50.02 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
0.00 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
0.00 ice_strike,if=buff.doom_winds.up
0.00 sundering,if=buff.doom_winds.up
J 7.03 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking
K 7.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
L 10.42 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
M 24.54 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
N 35.43 frost_shock,if=buff.hailstorm.up
0.00 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
0.00 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
O 1.25 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
P 0.27 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
Q 51.62 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
R 17.84 lava_lash
S 9.26 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
T 8.99 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
U 5.74 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
V 4.40 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
W 1.13 earth_elemental
X 9.13 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ACDEFBJKMNQRQQQLNQMQLINQUWTIMFINIQILNXMQQRSNQXRIMIQIQIJFKNMQRQQSNURQMTNXQRVQSXMNQQRTNXQFMRSJKNQQRLMNQTRNUQQFIMIILINIQLNMQQONQRIVIJFIKMNQRILINIQIMTNQQQRUVXMQRSNXFQVDERMLIJIKINIQMTNRQXVIIFILIMINIQILINIMQTNUIJFIKIIMINILINQQQMONIQIVIXQMQFLNRIQIILIJIIKIMINQQRTNFQMIQISI

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_earth
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_earth
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, crumbling_power(20), elemental_chaos_earth
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, crumbling_power(20), elemental_chaos_earth
0:00.895 default B potion Fluffy_Pillow 40682.0/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon(2), crumbling_power(19), elemental_chaos_earth
0:00.895 single J primordial_wave Fluffy_Pillow 40682.0/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon(2), crumbling_power(19), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:01.790 single K lightning_bolt Fluffy_Pillow 40614.0/50000: 81% mana bloodlust, berserking, flurry, primordial_wave, feral_spirit, molten_weapon, crackling_surge, maelstrom_weapon(10), crumbling_power(19), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.684 single M ice_strike Fluffy_Pillow 41544.4/50000: 83% mana bloodlust, berserking, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hailstorm(10), crumbling_power(18), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.498 single N frost_shock Fluffy_Pillow 41196.8/50000: 82% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(17), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.311 single Q stormstrike Fluffy_Pillow 41997.6/50000: 84% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), crumbling_power(16), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.123 single R lava_lash Fluffy_Pillow 42296.8/50000: 85% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), crumbling_power(15), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.937 single Q stormstrike Fluffy_Pillow 43199.2/50000: 86% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(5), crumbling_power(14), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.751 single Q stormstrike Fluffy_Pillow 43501.6/50000: 87% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), crumbling_power(13), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.565 single Q stormstrike Fluffy_Pillow 43804.0/50000: 88% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), crumbling_power(12), spiraling_winds, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.378 single L elemental_blast Fluffy_Pillow 44104.8/50000: 88% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(8), crumbling_power(11), spiraling_winds, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.190 single N frost_shock Fluffy_Pillow 44029.0/50000: 88% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon, hailstorm(8), crumbling_power(10), spiraling_winds(2), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.982 single Q stormstrike Fluffy_Pillow 44796.2/50000: 90% mana bloodlust, berserking, flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(3), crumbling_power(9), spiraling_winds(2), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.771 single M ice_strike Fluffy_Pillow 45058.6/50000: 90% mana bloodlust, berserking, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(5), crumbling_power(8), spiraling_winds(2), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.560 single Q stormstrike Fluffy_Pillow 44671.0/50000: 89% mana bloodlust, berserking, flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), stormbringer, maelstrom_weapon(7), ice_strike, crumbling_power(7), spiraling_winds(3), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.348 single L elemental_blast Fluffy_Pillow 44931.8/50000: 90% mana bloodlust, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(7), maelstrom_weapon(8), ice_strike, crumbling_power(6), spiraling_winds(3), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.216 single I lava_lash Fluffy_Pillow 44945.6/50000: 90% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(8), hailstorm(8), ice_strike, crumbling_power(5), spiraling_winds(4), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.086 single N frost_shock Fluffy_Pillow 45937.6/50000: 92% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hailstorm(8), ice_strike, crumbling_power(4), spiraling_winds(4), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.042 single Q stormstrike Fluffy_Pillow 46967.2/50000: 94% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, ashen_catalyst, stormbringer, maelstrom_weapon(2), crumbling_power(3), spiraling_winds(4), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.996 single U sundering Fluffy_Pillow 47493.6/50000: 95% mana bloodlust, flurry(3), elemental_blast_haste, elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(4), crumbling_power(2), spiraling_winds(5), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.951 single W earth_elemental Fluffy_Pillow 46021.6/50000: 92% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(4), crumbling_power, spiraling_winds(5), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.906 single T lightning_bolt Fluffy_Pillow 47549.6/50000: 95% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(5), spiraling_winds(6), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.862 single I lava_lash Fluffy_Pillow 48579.2/50000: 97% mana bloodlust, elemental_blast_mastery, ashen_catalyst(4), hot_hand, hailstorm(5), spiraling_winds(6), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.845 single M ice_strike Fluffy_Pillow 49752.0/50000: 100% mana bloodlust, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(5), spiraling_winds(7), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.869 default F feral_spirit Fluffy_Pillow 49740.4/50000: 99% mana bloodlust, elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(7), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.851 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(4), hailstorm(5), ice_strike, spiraling_winds(8), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.836 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, molten_weapon(2), hot_hand, maelstrom_weapon(4), hailstorm(5), ice_strike, spiraling_winds(8), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.820 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), spiraling_winds(9), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.804 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(6), spiraling_winds(9), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.787 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(8), spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.770 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), feral_spirit, molten_weapon(2), maelstrom_weapon(8), spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.754 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon, hailstorm(8), spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.710 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.665 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.620 single Q stormstrike Fluffy_Pillow 49878.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(5), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:31.576 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
0:32.531 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(6), ice_strike, sophic_devotion, elemental_chaos_earth
0:33.487 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(7), ice_strike, sophic_devotion, elemental_chaos_earth
0:34.442 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, hailstorm(7), ice_strike, elemental_chaos_earth
0:35.397 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon, spiraling_winds, elemental_chaos_earth
0:36.351 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds, elemental_chaos_earth
0:37.305 Waiting     0.611 sec 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(2), spiraling_winds(2), forgestorm_ignited, elemental_chaos_earth
0:37.916 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(2), forgestorm_ignited, elemental_chaos_earth
0:39.095 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(3), forgestorm_ignited, elemental_chaos_earth
0:40.051 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(3), forgestorm_ignited, elemental_chaos_earth
0:41.291 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth
0:42.532 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth
0:43.772 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth
0:45.048 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth
0:46.325 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), ice_strike, spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth
0:47.603 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
0:48.882 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst, maelstrom_weapon(10), ice_strike, spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
0:50.159 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(10), ice_strike, spiraling_winds(8), forgestorm_ignited, elemental_chaos_earth
0:51.438 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), hailstorm(10), ice_strike, spiraling_winds(9), forgestorm_ignited, elemental_chaos_earth
0:52.599 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(2), spiraling_winds(9), forgestorm_ignited, elemental_chaos_earth
0:53.762 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
0:54.923 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_earth
0:56.085 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_earth
0:57.246 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_earth
0:58.408 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_earth
0:59.569 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), hailstorm(7), ice_strike, spiraling_winds(10), elemental_chaos_earth
1:00.698 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon, spiraling_winds(10), elemental_chaos_air
1:01.791 single R lava_lash Fluffy_Pillow 48748.8/50000: 97% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_air
1:02.883 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), stormbringer, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_air
1:04.085 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:05.287 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:06.487 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), hailstorm(7), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:07.689 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon, spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:08.890 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), maelstrom_weapon, spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:10.127 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:11.365 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:12.602 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, stormbringer, maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:13.840 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:15.077 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(3), hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:16.315 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(4), hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:17.553 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon, hailstorm(5), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:18.791 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:20.028 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(6), stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_air
1:21.265 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(7), maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_air
1:22.503 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:23.742 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:24.978 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon, spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:26.216 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon, sophic_devotion, elemental_chaos_air
1:27.454 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon(2), sophic_devotion, elemental_chaos_air
1:28.691 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(3), sophic_devotion, elemental_chaos_air
1:29.929 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_air
1:31.167 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(6), ice_strike, sophic_devotion, elemental_chaos_air
1:32.406 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hailstorm(6), ice_strike, sophic_devotion, elemental_chaos_air
1:33.841 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(10), hailstorm(6), ice_strike, sophic_devotion, elemental_chaos_air
1:35.080 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), hailstorm(10), ice_strike, sophic_devotion, elemental_chaos_air
1:36.207 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), maelstrom_weapon(2), sophic_devotion, elemental_chaos_air
1:37.332 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(5), stormbringer, maelstrom_weapon(6), elemental_chaos_air
1:38.458 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(7), elemental_chaos_air
1:39.584 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(8), elemental_chaos_air
1:40.712 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), stormbringer, hailstorm(8), elemental_chaos_air
1:41.837 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(2), hailstorm(8), ice_strike, elemental_chaos_air
1:42.962 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), elemental_chaos_air
1:44.086 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst(4), maelstrom_weapon(5), elemental_chaos_air
1:45.209 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, ashen_catalyst(5), hailstorm(5), elemental_chaos_air
1:46.336 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hailstorm(5), sophic_devotion, elemental_chaos_air
1:47.607 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, maelstrom_weapon, sophic_devotion, elemental_chaos_air
1:48.844 single Q stormstrike Fluffy_Pillow 48979.2/50000: 98% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(2), sophic_devotion, elemental_chaos_air
1:50.082 single Q stormstrike Fluffy_Pillow 49960.0/50000: 100% mana flurry(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(3), sophic_devotion, elemental_chaos_air
1:51.321 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), hot_hand, stormbringer, maelstrom_weapon(4), sophic_devotion, elemental_chaos_air
1:52.693 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hot_hand, stormbringer, maelstrom_weapon(5), sophic_devotion, elemental_chaos_air
1:53.931 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(5), sophic_devotion, elemental_chaos_air
1:55.167 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, sophic_devotion, elemental_chaos_air
1:56.405 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, sophic_devotion, elemental_chaos_air
1:57.642 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_air
1:58.880 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(9), ice_strike, sophic_devotion, elemental_chaos_air
2:00.117 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(9), ice_strike, sophic_devotion, elemental_chaos_fire
2:01.395 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), elemental_chaos_fire
2:02.672 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), elemental_chaos_fire
2:03.950 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(10), elemental_chaos_fire
2:05.227 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hailstorm(10), elemental_chaos_fire
2:06.469 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_fire
2:07.709 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(4), stormbringer, maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_fire
2:08.948 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), stormbringer, maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_fire
2:10.187 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(5), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_fire
2:11.427 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(6), stormbringer, hailstorm(10), ice_strike, sophic_devotion, elemental_chaos_fire
2:12.666 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(7), stormbringer, maelstrom_weapon, sophic_devotion, elemental_chaos_fire
2:13.907 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(7), maelstrom_weapon, sophic_devotion, elemental_chaos_fire
2:15.148 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon, sophic_devotion, elemental_chaos_fire
2:16.388 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon, sophic_devotion, elemental_chaos_fire
2:17.630 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon, sophic_devotion, elemental_chaos_fire
2:18.870 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, hot_hand, maelstrom_weapon, sophic_devotion, elemental_chaos_fire
2:20.111 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(10), sophic_devotion, elemental_chaos_fire
2:21.353 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), sophic_devotion, elemental_chaos_fire
2:22.633 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), elemental_chaos_fire
2:23.910 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(10), elemental_chaos_fire
2:25.071 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), hailstorm(10), ice_strike, elemental_chaos_fire
2:26.233 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(6), elemental_chaos_fire
2:27.393 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(7), elemental_chaos_fire
2:28.554 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(7), elemental_chaos_fire
2:29.717 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), elemental_chaos_fire
2:30.878 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, hailstorm(10), elemental_chaos_fire
2:32.038 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), elemental_chaos_fire
2:33.199 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), elemental_chaos_fire
2:34.359 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), elemental_chaos_fire
2:35.522 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), elemental_chaos_fire
2:36.801 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(6), elemental_chaos_fire
2:38.077 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(8), ice_strike, elemental_chaos_fire
2:39.355 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), hailstorm(8), ice_strike, elemental_chaos_fire
2:40.634 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), maelstrom_weapon, elemental_chaos_fire
2:41.974 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(4), stormbringer, maelstrom_weapon, elemental_chaos_fire
2:43.252 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(4), stormbringer, maelstrom_weapon, elemental_chaos_fire
2:44.529 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon, elemental_chaos_fire
2:45.808 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, maelstrom_weapon, sophic_devotion, elemental_chaos_fire
2:47.084 single V frost_shock Fluffy_Pillow 49041.6/50000: 98% mana flurry(3), ashen_catalyst(2), maelstrom_weapon, sophic_devotion, elemental_chaos_fire
2:48.363 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
2:49.641 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
2:50.918 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_fire
2:52.198 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_fire
2:53.493 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(6), ice_strike, sophic_devotion, elemental_chaos_fire
2:54.771 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst, hailstorm(6), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:56.012 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:57.252 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(2), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:58.494 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(3), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:59.734 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:00.974 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
3:00.974 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(5), crumbling_power(20), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
3:00.974 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(5), crumbling_power(20), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
3:02.101 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(5), crumbling_power(19), spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
3:03.229 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(9), ice_strike, crumbling_power(18), spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
3:04.356 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(9), ice_strike, crumbling_power(17), spiraling_winds(3), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:05.485 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(9), ice_strike, crumbling_power(16), spiraling_winds(3), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:06.611 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_haste, primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(10), hailstorm(9), ice_strike, crumbling_power(16), spiraling_winds(4), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:07.740 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, primordial_wave, feral_spirit, molten_weapon(2), hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(9), ice_strike, crumbling_power(15), spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:08.867 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, hailstorm(10), ice_strike, crumbling_power(14), spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:09.893 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, crumbling_power(13), spiraling_winds(6), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:10.919 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), crumbling_power(12), spiraling_winds(6), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:11.944 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon(2), crumbling_power(11), spiraling_winds(7), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:12.969 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst, maelstrom_weapon(3), crumbling_power(10), spiraling_winds(7), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:13.996 single T lightning_bolt Fluffy_Pillow 49993.2/50000: 100% mana flurry, splintered_elements, ashen_catalyst(2), maelstrom_weapon(5), ice_strike, crumbling_power(9), spiraling_winds(8), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:15.157 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(3), hailstorm(5), ice_strike, crumbling_power(8), spiraling_winds(8), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:16.318 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(3), maelstrom_weapon, crumbling_power(7), spiraling_winds(9), sophic_devotion, elemental_chaos_fire
3:17.533 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, stormbringer, maelstrom_weapon, crumbling_power(6), spiraling_winds(9), sophic_devotion, elemental_chaos_fire
3:18.694 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, maelstrom_weapon(3), crumbling_power(5), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:19.855 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(3), crumbling_power(4), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:21.134 Waiting     0.193 sec 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:21.327 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(3), hot_hand, maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:22.606 Waiting     0.892 sec 50000.0/50000: 100% mana flurry(2), hot_hand, maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:23.498 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:25.027 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), sophic_devotion, elemental_chaos_fire
3:26.357 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), sophic_devotion, elemental_chaos_fire
3:27.635 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(8), elemental_chaos_fire
3:28.911 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(8), sophic_devotion, elemental_chaos_fire
3:30.187 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(8), sophic_devotion, elemental_chaos_fire
3:31.465 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), hailstorm(8), ice_strike, sophic_devotion, elemental_chaos_fire
3:32.744 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(5), hailstorm(8), ice_strike, sophic_devotion, elemental_chaos_fire
3:34.020 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(6), sophic_devotion, elemental_chaos_fire
3:35.298 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(7), sophic_devotion, elemental_chaos_fire
3:36.575 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), sophic_devotion, elemental_chaos_fire
3:37.853 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(10), sophic_devotion, elemental_chaos_fire
3:39.131 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), sophic_devotion, elemental_chaos_fire
3:40.409 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), sophic_devotion, elemental_chaos_fire
3:41.688 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
3:42.967 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, stormbringer, maelstrom_weapon(4), sophic_devotion, elemental_chaos_fire
3:44.244 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_fire
3:45.520 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(6), ice_strike, sophic_devotion, elemental_chaos_fire
3:46.798 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), hailstorm(6), ice_strike, sophic_devotion, elemental_chaos_fire
3:48.075 single U sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
3:49.353 single I lava_lash Fluffy_Pillow 49044.8/50000: 98% mana flurry, ashen_catalyst(4), hot_hand, maelstrom_weapon(7), sophic_devotion, elemental_chaos_fire
3:50.629 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(7), sophic_devotion, elemental_chaos_fire
3:51.905 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), sophic_devotion, elemental_chaos_fire
3:53.181 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:54.460 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(10), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:55.739 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), forgestorm_ignited, elemental_chaos_fire
3:56.901 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), forgestorm_ignited, elemental_chaos_fire
3:58.063 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), forgestorm_ignited, elemental_chaos_fire
3:59.224 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(4), hailstorm(10), ice_strike, forgestorm_ignited, elemental_chaos_fire
4:00.386 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(10), ice_strike, forgestorm_ignited, elemental_chaos_air
4:01.510 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_air
4:02.633 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_air
4:03.758 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, hailstorm(8), forgestorm_ignited, elemental_chaos_air
4:04.883 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(8), forgestorm_ignited, elemental_chaos_air
4:06.009 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_air
4:07.136 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
4:08.374 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_air
4:09.611 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_air
4:10.859 single O elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(5), maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_air
4:12.097 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(6), hailstorm(10), ice_strike, forgestorm_ignited, elemental_chaos_air
4:13.299 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(6), hot_hand, stormbringer, maelstrom_weapon, forgestorm_ignited, elemental_chaos_air
4:14.502 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_air
4:15.704 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_air
4:16.906 single V frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
4:18.107 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
4:19.309 single X flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
4:20.509 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(5), elemental_chaos_air
4:21.710 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), stormbringer, maelstrom_weapon(7), sophic_devotion, elemental_chaos_air
4:22.949 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(8), ice_strike, sophic_devotion, elemental_chaos_air
4:24.187 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_air
4:25.423 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, crackling_surge(2), ashen_catalyst(5), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_air
4:26.660 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(6), hailstorm(10), ice_strike, sophic_devotion, elemental_chaos_air
4:27.861 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(6), maelstrom_weapon(3), sophic_devotion, elemental_chaos_air
4:29.063 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), sophic_devotion, elemental_chaos_air
4:30.265 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(6), sophic_devotion, elemental_chaos_air
4:31.465 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(7), sophic_devotion, elemental_chaos_air
4:32.665 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, crackling_surge(2), hot_hand, maelstrom_weapon(7), sophic_devotion, elemental_chaos_air
4:33.866 single L elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), sophic_devotion, elemental_chaos_air
4:35.068 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, stormbringer, hailstorm(10), sophic_devotion, elemental_chaos_air
4:36.269 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), sophic_devotion, elemental_chaos_air
4:37.507 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), elemental_chaos_air
4:38.745 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), forgestorm_ignited, elemental_chaos_air
4:39.981 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), forgestorm_ignited, elemental_chaos_air
4:41.218 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), forgestorm_ignited, elemental_chaos_air
4:42.342 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), forgestorm_ignited, elemental_chaos_air
4:43.468 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, forgestorm_ignited, elemental_chaos_air
4:44.596 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, forgestorm_ignited, elemental_chaos_air
4:45.721 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
4:46.845 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
4:47.970 single R lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(3), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_air
4:49.097 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_air
4:50.221 single N frost_shock Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(2), hailstorm(6), elemental_chaos_air
4:51.346 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(2), maelstrom_weapon, elemental_chaos_air
4:52.471 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_air
4:53.734 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(2), elemental_chaos_air
4:54.971 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, molten_weapon(2), ashen_catalyst(5), hot_hand, stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_air
4:56.208 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, molten_weapon(2), hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, elemental_chaos_air
4:57.445 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(6), ice_strike, elemental_chaos_air
4:58.684 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(6), ice_strike, elemental_chaos_air
4:59.922 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, hailstorm(6), ice_strike, elemental_chaos_air

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 19.44% 15.82% 1047
Haste 17.79% 17.79% 3025
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 58.70% 58.70% 3843
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +386 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1047
# gear_haste_rating=3025
# gear_mastery_rating=3843
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Gamba : 46438 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
46437.9 46437.9 85.1 / 0.183% 14720.5 / 31.7% 51.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
843.4 840.8 Mana 1.46% 52.2 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Gamba 46438
Ascendance (_dre) 0 (1010) 0.0% (2.2%) 8.3 30.48sec 36388 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.31 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1010 2.2% 8.3 30.48sec 36388 0 Direct 8.3 30465 61288 36387 19.2% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.31 8.31 0.00 0.00 0.00 0.0000 0.0000 302565.50 302565.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 6.72 0 23 30465.22 25297 51599 30406.83 0 45922 204639 204639 0.00%
crit 19.22% 1.60 0 8 61287.93 50593 103198 48271.06 0 97950 97927 97927 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 78 0.2% 3.7 90.41sec 6248 5711 Direct 3.7 6248 0 6248 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0941 0.0000 23319.67 33314.67 30.00% 5711.41 5711.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 6248.31 3670 12883 6260.60 4839 8731 23320 33315 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6903 14.9% 25.1 11.75sec 82368 70133 Direct 25.1 68039 136489 82400 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.13 25.12 0.00 0.00 0.00 1.1745 0.0000 2069564.92 2069564.92 0.00% 70133.35 70133.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.02% 19.85 10 30 68038.85 43658 140130 68052.05 53994 82794 1350456 1350456 0.00%
crit 20.98% 5.27 0 15 136489.05 87317 270089 135968.59 0 218054 719109 719109 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [R]:25.13
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
Flame Shock 1498 3.2% 30.0 9.87sec 14987 34045 Direct 30.0 2711 5447 3187 17.4% 0.0%
Periodic 186.8 1611 3234 1893 17.4% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.97 29.97 186.80 186.80 28.67 0.4402 1.5558 449221.08 449221.08 0.00% 1478.62 34044.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 24.76 12 40 2711.41 2272 4687 2712.68 2407 3088 67125 67125 0.00%
crit 17.40% 5.22 0 14 5446.96 4543 9038 5412.57 0 7419 28416 28416 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.60% 154.30 103 202 1610.99 1 2788 1611.54 1476 1826 248576 248576 0.00%
crit 17.40% 32.50 10 65 3234.06 3 5577 3235.23 2872 3759 105103 105103 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [N]:1.30
  • if_expr:!ticking
    single
    [Z]:10.12
Flametongue Weapon 0 (1485) 0.0% (3.2%) 1.0 0.00sec 444683 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1485 3.2% 1128.5 0.67sec 394 0 Direct 1128.5 336 674 394 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1128.50 1128.50 0.00 0.00 0.00 0.0000 0.0000 444682.82 444682.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.72% 933.52 629 1264 335.68 277 570 335.84 310 375 313362 313362 0.00%
crit 17.28% 194.98 107 303 673.50 555 1140 673.93 623 760 131321 131321 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1110 2.4% 28.9 7.59sec 11529 0 Direct 28.9 9807 19716 11529 17.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.86 28.86 0.00 0.00 0.00 0.0000 0.0000 332730.01 332730.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 23.85 3 67 9806.64 9732 10030 9806.57 9732 10030 233845 233845 0.00%
crit 17.38% 5.02 0 18 19716.10 19463 20059 19379.73 0 20059 98885 98885 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1009 2.2% 16.6 16.95sec 18264 15597 Direct 16.6 15552 31255 18263 17.3% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.57 16.57 0.00 0.00 0.00 1.1710 0.0000 302637.10 302637.10 0.00% 15597.44 15597.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 13.71 3 28 15552.34 7339 30286 15621.68 11589 20441 213203 213203 0.00%
crit 17.27% 2.86 0 11 31254.56 14678 59196 29642.25 0 53309 89434 89434 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [X]:16.57
Ice Strike 1373 3.0% 20.2 14.97sec 20376 17589 Direct 20.2 17346 34781 20375 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.18 20.18 0.00 0.00 0.00 1.1584 0.0000 411257.62 411257.62 0.00% 17589.39 17589.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 16.68 7 26 17346.39 14383 29677 17354.27 15347 20077 289287 289287 0.00%
crit 17.37% 3.51 0 10 34780.66 28765 58489 33913.28 0 57888 121970 121970 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:2.57
  • if_expr:buff.doom_winds.up
    single
    [T]:17.61
Lava Lash 1316 2.8% 18.6 15.78sec 21263 18127 Direct 18.6 18076 36259 21263 17.5% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.56 18.56 0.00 0.00 0.00 1.1730 0.0000 394528.49 394528.49 0.00% 18126.74 18126.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.47% 15.30 7 24 18076.05 15147 31254 18082.91 15719 21451 276621 276621 0.00%
crit 17.53% 3.25 0 11 36259.28 30294 61598 35061.50 0 53963 117908 117908 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [O]:4.27
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [U]:14.29
Lightning Bolt 2781 6.0% 16.7 16.90sec 49984 42551 Direct 16.7 41011 82513 49984 21.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.68 16.68 0.00 0.00 0.00 1.1747 0.0000 833949.35 833949.35 0.00% 42550.61 42550.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.38% 13.08 2 27 41010.93 27612 85775 41035.96 31283 52666 536325 536325 0.00%
crit 21.62% 3.61 0 14 82512.94 55224 172874 80537.23 0 145014 297624 297624 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [S]:4.29
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [V]:12.40
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1449 3.1% 163.1 2.15sec 2663 1567 Direct 163.1 2633 5290 2663 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 163.10 163.10 0.00 0.00 0.00 1.6993 0.0000 434414.08 620607.37 30.00% 1567.43 1567.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.23% 108.02 57 165 2633.07 2257 4339 2634.18 2381 2955 284422 406327 30.00%
crit 17.38% 28.35 6 55 5289.94 4513 8677 5291.72 4733 6097 149992 214280 30.00%
miss 16.39% 26.73 8 52 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 743 1.6% 166.8 2.09sec 1335 786 Direct 166.8 1318 2650 1335 17.4% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 166.80 166.80 0.00 0.00 0.00 1.6994 0.0000 222717.12 318175.43 30.00% 785.69 785.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.26% 110.52 54 167 1318.35 1128 2169 1318.93 1206 1489 145708 208159 30.00%
crit 17.42% 29.06 10 53 2649.90 2257 4339 2650.43 2335 3088 77009 110016 30.00%
miss 16.32% 27.22 9 50 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7510) 0.0% (16.2%) 92.0 3.25sec 24456 21042

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.02 0.00 0.00 0.00 0.00 1.1623 0.0000 0.00 0.00 0.00% 21041.96 21041.96

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:12.94
  • if_expr:buff.doom_winds.up
    single
    [Q]:79.07
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Stormstrike (_mh) 4047 (5006) 8.7% (10.8%) 122.7 3.25sec 12227 0 Direct 122.7 (183.7) 8414 16920 9887 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.67 122.67 0.00 0.00 0.00 0.0000 0.0000 1212782.89 1732591.17 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 101.44 50 163 8414.33 2623 23559 8434.86 7359 10084 853553 1219393 30.00%
crit 17.31% 21.23 5 42 16920.42 5246 47118 16955.27 11519 22765 359230 513198 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 959 2.1% 61.1 5.48sec 4702 0 Direct 61.1 4702 0 4702 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.08 61.08 0.00 0.00 0.00 0.0000 0.0000 287172.18 287172.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.08 25 110 4701.89 1152 20690 4717.92 3572 6349 287172 287172 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2025 (2504) 4.4% (5.4%) 122.7 3.25sec 6117 0 Direct 122.7 (183.7) 4208 8454 4946 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.67 122.67 0.00 0.00 0.00 0.0000 0.0000 606736.36 866788.34 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 101.35 57 164 4207.79 1312 11780 4217.66 3605 5027 426434 609207 30.00%
crit 17.39% 21.33 5 44 8454.17 2623 22860 8477.61 4852 11496 180302 257581 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 480 1.0% 61.1 5.48sec 2352 0 Direct 61.1 2352 0 2352 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.08 61.08 0.00 0.00 0.00 0.0000 0.0000 143641.28 143641.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.08 25 110 2351.82 576 9716 2359.71 1801 3041 143641 143641 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 996 2.1% 6.4 49.36sec 46742 40312 Direct 6.4 39894 79853 46742 17.1% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.38 6.38 0.00 0.00 0.00 1.1596 0.0000 298230.42 298230.42 0.00% 40312.30 40312.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.86% 5.29 0 9 39894.36 25569 86905 39943.21 0 54028 210922 210922 0.00%
crit 17.14% 1.09 0 6 79852.73 51138 165905 55631.40 0 146008 87308 87308 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [M]:1.64
  • if_expr:buff.doom_winds.up
    single
    [W]:4.74
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (6780) 0.0% (14.6%) 1.0 0.00sec 2028833 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6780 14.6% 417.0 2.40sec 4865 0 Direct 417.0 4145 8320 4865 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 417.04 417.04 0.00 0.00 0.00 0.0000 0.0000 2028832.85 2898406.54 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.76% 345.13 207 517 4144.96 1423 11556 4143.18 3547 4932 1430538 2043678 30.00%
crit 17.24% 71.91 34 116 8319.68 2845 23111 8315.37 6698 10514 598295 854728 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 510 1.1% 33.5 8.41sec 4558 3242 Direct 33.5 3760 7552 4558 21.1% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.52 33.52 0.00 0.00 0.00 1.4059 0.0000 152782.37 152782.37 0.00% 3242.20 3242.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.94% 26.46 0 84 3759.67 3224 6198 3760.91 0 5420 99484 99484 0.00%
crit 21.06% 7.06 0 27 7552.09 6448 12257 7488.50 0 11082 53299 53299 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 296 0.6% 38.8 7.28sec 2282 1571 Direct 38.8 1881 3778 2282 21.2% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.81 38.81 0.00 0.00 0.00 1.4527 0.0000 88562.24 88562.24 0.00% 1570.98 1570.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.85% 30.60 0 95 1880.87 1612 3099 1881.29 0 2739 57550 57550 0.00%
crit 21.15% 8.21 0 27 3778.12 3224 6134 3760.06 0 5465 31012 31012 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (6794) 0.0% (14.6%) 27.4 8.59sec 74294 64574

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.38 0.00 0.00 0.00 0.00 1.1505 0.0000 0.00 0.00 0.00% 64573.93 64573.93

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:27.38
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [P]:0.00
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1832 (2163) 3.9% (4.7%) 36.4 8.59sec 17795 0 Direct 36.4 (48.8) 12861 25788 15080 17.2% (12.8%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.37 36.36 0.00 0.00 0.00 0.0000 0.0000 548245.78 548245.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.83% 30.11 0 97 12860.62 3748 32283 12841.69 0 19958 387279 387279 0.00%
crit 17.17% 6.24 0 26 25788.34 7495 64083 25351.18 0 48023 160967 160967 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 331 0.7% 12.4 18.43sec 7985 0 Direct 12.4 7985 0 7985 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.40 12.40 0.00 0.00 0.00 0.0000 0.0000 99035.37 99035.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.40 0 44 7984.93 1842 28389 7906.19 0 14678 99035 99035 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 916 (1082) 2.0% (2.3%) 36.4 8.59sec 8901 0 Direct 36.4 (48.8) 6428 12920 7544 17.2% (12.8%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.37 36.36 0.00 0.00 0.00 0.0000 0.0000 274249.42 274249.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.81% 30.11 0 99 6427.77 1874 16142 6419.59 0 9979 193519 193519 0.00%
crit 17.19% 6.25 0 23 12919.59 3748 31607 12701.92 0 22816 80731 80731 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 166 0.4% 12.4 18.43sec 3993 0 Direct 12.4 3993 0 3993 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.40 12.40 0.00 0.00 0.00 0.0000 0.0000 49523.33 49523.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.40 0 44 3992.81 1019 14427 3947.09 0 8325 49523 49523 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3550 7.6% 27.4 8.59sec 38831 0 Direct 27.4 32044 64276 38831 21.1% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.37 27.37 0.00 0.00 0.00 0.0000 0.0000 1062960.44 1062960.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.94% 21.61 0 78 32044.29 15340 56974 32042.85 0 47112 692456 692456 0.00%
crit 21.06% 5.76 0 19 64276.34 30680 109812 63053.59 0 103210 370505 370505 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 412 / 87
melee 412 0.2% 41.0 2.45sec 629 419 Direct 41.0 536 1071 629 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.02 41.02 0.00 0.00 0.00 1.5010 0.0000 25816.81 36882.10 30.00% 419.35 419.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.49% 33.83 18 66 535.67 475 908 535.12 475 714 18124 25892 30.00%
crit 17.51% 7.18 0 21 1071.13 950 1796 1069.16 0 1469 7693 10990 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 3868 / 2709
melee 3868 5.8% 370.1 1.61sec 2192 1918 Direct 370.1 1869 3735 2192 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 370.15 370.15 0.00 0.00 0.00 1.1425 0.0000 811259.68 1158971.94 30.00% 1918.31 1918.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.71% 306.17 179 445 1869.22 1588 3106 1870.15 1715 2085 572292 817581 30.00%
crit 17.29% 63.98 22 109 3735.00 3176 6141 3737.04 3341 4285 238968 341391 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Gamba
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.2 308.59sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.16 0.00 0.00 0.00 0.00 1.0065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Y]:1.16
Feral Spirit 14.9 21.11sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.87 0.00 0.00 0.00 0.00 1.1540 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:14.88
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.00
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 6.4 0.0 41.5sec 41.5sec 7.7sec 16.45% 91.82% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 305.2s
  • trigger_min/max:6.0s / 305.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 96.0s

Stack Uptimes

  • ascendance_1:16.45%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.2s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.73%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.74%
  • crumbling_power_19:1.21%
  • crumbling_power_20:0.06%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.4sec 90.4sec 7.9sec 9.88% 11.42% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.3s
  • trigger_min/max:90.0s / 92.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 14.9 0.0 24.3sec 20.7sec 17.9sec 69.99% 100.00% 0.0 (0.0) 11.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.6s / 143.1s
  • trigger_min/max:6.6s / 44.3s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 125.8s

Stack Uptimes

  • earthen_weapon_2:67.23%
  • earthen_weapon_4:2.76%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.4 1.0 37.7sec 32.8sec 10.8sec 26.42% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 265.4s
  • trigger_min/max:1.7s / 258.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.6s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.42%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.5 1.0 37.2sec 32.4sec 10.7sec 26.68% 0.00% 1.0 (1.0) 7.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 293.6s
  • trigger_min/max:1.7s / 293.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.1s

Stack Uptimes

  • elemental_blast_haste_1:26.68%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.4 1.0 37.7sec 32.9sec 10.7sec 26.44% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 276.4s
  • trigger_min/max:1.7s / 276.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.5s

Stack Uptimes

  • elemental_blast_mastery_1:26.44%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.8sec 99.3sec 58.1sec 24.90% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:24.91%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.2sec 100.3sec 58.2sec 25.11% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 316.6s

Stack Uptimes

  • elemental_chaos_earth_1:25.11%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.7sec 100.8sec 58.1sec 25.17% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:25.17%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.2sec 99.2sec 57.9sec 24.82% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 301.7s

Stack Uptimes

  • elemental_chaos_frost_1:24.82%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0sec 0.0sec 29.4sec 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.6s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 11.8 3.1 26.5sec 21.1sec 17.9sec 70.00% 0.00% 60.1 (60.1) 11.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 143.1s
  • trigger_min/max:6.6s / 44.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 125.8s

Stack Uptimes

  • feral_spirit_1:70.00%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.5 388.0 6.9sec 0.7sec 5.9sec 85.20% 90.87% 388.0 (921.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 72.3s
  • trigger_min/max:0.0s / 14.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.8s

Stack Uptimes

  • flurry_1:19.82%
  • flurry_2:34.81%
  • flurry_3:30.58%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 121.6 17.7sec 2.1sec 14.6sec 84.95% 100.00% 58.2 (58.2) 16.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 55.6s
  • trigger_min/max:0.0s / 42.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.52%
  • forceful_winds_2:13.85%
  • forceful_winds_3:12.41%
  • forceful_winds_4:10.62%
  • forceful_winds_5:33.55%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.4sec 46.5sec 13.0sec 19.53% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 214.6s
  • trigger_min/max:0.2s / 206.5s
  • trigger_pct:98.85%
  • duration_min/max:0.0s / 47.1s

Stack Uptimes

  • forgestorm_ignited_1:19.53%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 19.1 1.1 15.9sec 15.0sec 7.7sec 48.86% 79.27% 1.1 (1.1) 5.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.3s / 114.7s
  • trigger_min/max:8.3s / 110.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.1s

Stack Uptimes

  • ice_strike_1:48.86%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 23.1 20.9 12.9sec 6.7sec 8.0sec 61.91% 0.00% 20.9 (20.9) 22.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 110.5s
  • trigger_min/max:0.8s / 33.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 99.4s

Stack Uptimes

  • legacy_of_the_frost_witch_1:61.91%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 49.4 424.8 6.1sec 1.2sec 5.3sec 86.88% 100.00% 69.1 (74.2) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 57.5s
  • trigger_min/max:0.0s / 8.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.0s

Stack Uptimes

  • maelstrom_weapon_1:8.80%
  • maelstrom_weapon_2:10.25%
  • maelstrom_weapon_3:11.99%
  • maelstrom_weapon_4:12.52%
  • maelstrom_weapon_5:8.42%
  • maelstrom_weapon_6:7.19%
  • maelstrom_weapon_7:5.62%
  • maelstrom_weapon_8:4.90%
  • maelstrom_weapon_9:3.98%
  • maelstrom_weapon_10:13.22%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.6sec 45.3sec 16.5sec 23.82% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 232.2s
  • trigger_min/max:0.0s / 202.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.6s

Stack Uptimes

  • sophic_devotion_1:23.82%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.9sec 45.6sec 32.1sec 38.27% 0.00% 25.6 (25.6) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 225.3s
  • trigger_min/max:0.0s / 214.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 194.6s

Stack Uptimes

  • spiraling_winds_1:2.36%
  • spiraling_winds_2:2.33%
  • spiraling_winds_3:2.32%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.27%
  • spiraling_winds_7:2.25%
  • spiraling_winds_8:2.24%
  • spiraling_winds_9:2.22%
  • spiraling_winds_10:17.72%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 6.4 0.0 41.5sec 41.5sec 7.7sec 16.45% 100.00% 43.0 (43.0) 6.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 305.2s
  • trigger_min/max:6.0s / 305.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 96.0s

Stack Uptimes

  • static_accumulation_1:16.45%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 62.9 19.3 4.7sec 3.6sec 1.1sec 23.71% 52.36% 19.3 (19.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 74.9s
  • trigger_min/max:0.0s / 74.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • stormbringer_1:23.71%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.8 36.0 66.0 17.8s 15.0s 65.0s
Windfury-ForcefulWinds: 2 51.5 33.0 69.0 18.0s 1.0s 69.0s
Windfury-ForcefulWinds: 3 49.9 27.0 69.0 18.5s 0.9s 75.8s
Windfury-ForcefulWinds: 4 46.8 21.0 69.0 19.7s 0.1s 136.9s
Windfury-ForcefulWinds: 5 217.0 87.0 369.0 4.6s 0.0s 136.1s
windfury_totem_extra_attack_mh 28.0 8.0 54.0 10.5s 1.2s 114.9s
windfury_totem_extra_attack_oh 29.5 12.0 53.0 9.9s 0.1s 119.0s
Windfury: Unruly Winds 139.0 83.0 209.0 2.4s 0.0s 42.2s
Maelstrom Weapon: Feral Spirit 79.8 53.0 110.0 3.8s 0.0s 29.3s
Maelstrom Weapon: Elemental Assault 119.4 74.0 169.0 2.5s 0.8s 9.7s
Maelstrom Weapon: Static Accumulation 98.5 0.0 300.0 4.7s 1.0s 300.2s
Stormflurry 39.7 12.0 75.0 9.8s 0.8s 136.1s
Flametongue: Windfury Attack 417.0 249.0 627.0 2.4s 0.0s 42.2s
Stormbringer: Windfury Attack 44.0 16.0 77.0 7.7s 0.0s 112.7s
Maelstrom Weapon: Windfury Attack 83.4 40.0 136.0 4.6s 0.0s 74.6s
Flametongue: main_hand 136.4 75.0 196.0 2.6s 1.2s 97.8s
Maelstrom Weapon: main_hand 27.3 7.0 50.0 11.1s 1.2s 165.0s
Windfury: main_hand 52.1 21.0 87.0 6.2s 1.2s 101.8s
Flametongue: Windlash 33.5 0.0 105.0 8.5s 1.2s 300.3s
Maelstrom Weapon: Windlash 6.7 0.0 24.0 32.5s 1.2s 318.4s
Windfury: Windlash 12.6 0.0 41.0 19.6s 1.2s 310.3s
Flametongue: offhand 139.6 78.0 198.0 2.6s 1.2s 96.2s
Maelstrom Weapon: offhand 27.9 8.0 54.0 10.8s 1.2s 124.8s
Flametongue: Windlash Off-Hand 38.8 0.0 112.0 7.3s 0.2s 299.6s
Maelstrom Weapon: Windlash Off-Hand 7.8 0.0 28.0 29.1s 0.2s 315.3s
Flametongue: Sundering 6.4 3.0 9.0 49.3s 40.0s 180.1s
Stormbringer: Sundering 0.7 0.0 4.0 111.9s 40.0s 331.3s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 105.1s 40.0s 346.2s
Windfury: Sundering 3.1 0.0 8.0 88.6s 40.0s 342.0s
Flametongue: Windstrike 36.4 0.0 121.0 8.6s 0.8s 300.8s
Stormbringer: Windstrike 3.8 0.0 18.0 45.7s 0.8s 336.7s
Maelstrom Weapon: Windstrike 7.3 0.0 26.0 30.6s 0.8s 314.0s
Windfury: Windstrike 13.8 0.0 46.0 18.8s 0.8s 294.9s
Flametongue: Windstrike Off-Hand 36.4 0.0 121.0 8.6s 0.8s 300.8s
Stormbringer: Windstrike Off-Hand 3.8 0.0 17.0 45.7s 0.8s 346.1s
Maelstrom Weapon: Windstrike Off-Hand 7.3 0.0 31.0 30.7s 0.8s 320.7s
Flametongue: Lava Lash 18.6 8.0 26.0 15.8s 8.4s 88.3s
Stormbringer: Lava Lash 2.0 0.0 10.0 76.6s 8.9s 328.3s
Maelstrom Weapon: Lava Lash 3.7 0.0 12.0 58.7s 8.5s 323.9s
Flametongue: Ice Strike 20.2 11.0 28.0 15.0s 8.3s 110.4s
Stormbringer: Ice Strike 2.1 0.0 10.0 78.0s 8.3s 330.5s
Maelstrom Weapon: Ice Strike 4.0 0.0 12.0 57.9s 8.3s 332.6s
Windfury: Ice Strike 8.0 1.0 17.0 37.3s 8.3s 288.8s
Flametongue: Stormstrike 122.7 66.0 196.0 3.2s 0.8s 96.9s
Stormbringer: Stormstrike 12.9 1.0 29.0 22.0s 0.8s 248.3s
Maelstrom Weapon: Stormstrike 24.5 6.0 50.0 12.6s 0.8s 139.9s
Windfury: Stormstrike 49.4 20.0 86.0 7.1s 0.8s 106.8s
Flametongue: Stormstrike Off-Hand 122.7 66.0 196.0 3.2s 0.8s 96.9s
Stormbringer: Stormstrike Off-Hand 12.9 1.0 30.0 22.1s 0.8s 273.6s
Maelstrom Weapon: Stormstrike Off-Hand 24.6 7.0 47.0 12.6s 0.8s 131.5s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 26.37% 14.37% 47.25% 0.8s 0.0s 34.1s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7890.0011.48510.3383.36518.204
Doom Winds0.5250.0012.3181.1180.0004.720
Sundering9.7770.001140.09850.1462.137173.227
Windstrike1.0570.0014.07328.6960.00095.021
Lava Lash4.1200.00176.27270.44021.928137.635
Flame Shock21.3270.001237.865219.99243.225319.591
Ice Strike3.5000.00198.11964.61812.188141.356
Frost Shock12.6150.001208.668190.24960.678285.762
Elemental Blast3.8340.00150.4682.9870.00060.389
Stormstrike1.0540.0014.95592.37250.307145.713
Earth Elemental9.4290.01943.0551.4230.00043.055

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Gamba
mana_regenMana668.86252222.59100.00%377.09227168.6947.39%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 840.75 843.43 227165.1 49198.1 42980.8 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Gamba
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 25.1334548.041375.001375.0059.90
Flame ShockMana 11.428563.66750.00285.7152.46
Frost ShockMana 16.578284.90500.00500.0036.53
Ice StrikeMana 20.1833302.901650.001649.9712.35
Lava LashMana 18.567422.05400.00400.0053.16
Lightning BoltMana 16.688342.09500.00499.9999.97
StormstrikeMana 122.67122670.181000.001333.1518.34
SunderingMana 6.3819141.053000.003000.0215.58

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Gamba Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Gamba Damage Per Second
Count 7499
Mean 46437.94
Minimum 34732.64
Maximum 63451.11
Spread ( max - min ) 28718.46
Range [ ( max - min ) / 2 * 100% ] 30.92%
Standard Deviation 3762.0888
5th Percentile 40685.32
95th Percentile 53131.24
( 95th Percentile - 5th Percentile ) 12445.92
Mean Distribution
Standard Deviation 43.4438
95.00% Confidence Interval ( 46352.79 - 46523.09 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 253
0.1% Error 25213
0.1 Scale Factor Error with Delta=300 120821
0.05 Scale Factor Error with Delta=300 483284
0.01 Scale Factor Error with Delta=300 12082082
Priority Target DPS
PR_Shaman_Enhancement_Gamba Priority Target Damage Per Second
Count 7499
Mean 46437.94
Minimum 34732.64
Maximum 63451.11
Spread ( max - min ) 28718.46
Range [ ( max - min ) / 2 * 100% ] 30.92%
Standard Deviation 3762.0888
5th Percentile 40685.32
95th Percentile 53131.24
( 95th Percentile - 5th Percentile ) 12445.92
Mean Distribution
Standard Deviation 43.4438
95.00% Confidence Interval ( 46352.79 - 46523.09 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 253
0.1% Error 25213
0.1 Scale Factor Error with Delta=300 120821
0.05 Scale Factor Error with Delta=300 483284
0.01 Scale Factor Error with Delta=300 12082082
DPS(e)
PR_Shaman_Enhancement_Gamba Damage Per Second (Effective)
Count 7499
Mean 46437.94
Minimum 34732.64
Maximum 63451.11
Spread ( max - min ) 28718.46
Range [ ( max - min ) / 2 * 100% ] 30.92%
Damage
PR_Shaman_Enhancement_Gamba Damage
Count 7499
Mean 13074342.71
Minimum 7955029.93
Maximum 18750915.24
Spread ( max - min ) 10795885.31
Range [ ( max - min ) / 2 * 100% ] 41.29%
DTPS
PR_Shaman_Enhancement_Gamba Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Gamba Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Gamba Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Gamba Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Gamba Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Gamba Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_GambaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Gamba Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.00 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 14.88 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
G 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 27.38 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
K 12.94 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
L 2.57 ice_strike,if=buff.doom_winds.up
M 1.64 sundering,if=buff.doom_winds.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
N 1.30 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
0.00 frost_shock,if=buff.hailstorm.up
O 4.27 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
P 0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
Q 79.07 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 25.13 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
S 4.29 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
0.00 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
T 17.61 ice_strike
U 14.29 lava_lash
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
V 12.40 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 4.74 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
X 16.57 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Y 1.16 earth_elemental
Z 10.12 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGKKKKKKKLKNRQFRUWQTXYZQVQURXQQQSQQQTQFQRQUXZVQTXZRQQQQSQTUWXQQFRQQTRQQQUSQXZTQRQUXZGKFKKKKQQRQQRTOWQQQFQSQRQTUVQQQSQXZQFQRQTURXQQQVQWTURQJFJJQSQQRQQJFJJOSQDETGRKVKXUVZQTWFQQRQQRQTUXZQVQJXJFQQRQTQQORQXZWQSQJFJJQRQTUVQXZRQQFQRQTQQSQBUGXMKLKKQFJJJJRJOJJFJJRQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 2 augmentation PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_frost
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), forceful_winds, maelstrom_weapon, elemental_chaos_frost
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), forceful_winds, maelstrom_weapon, crumbling_power(20), elemental_chaos_frost
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry(2), forceful_winds, maelstrom_weapon, crumbling_power(20), elemental_chaos_frost
0:00.870 default G doom_winds Fluffy_Pillow 40642.0/50000: 81% mana bloodlust, berserking, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), crumbling_power(19), elemental_chaos_frost
0:01.738 single K stormstrike Fluffy_Pillow 42030.8/50000: 84% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), doom_winds, crumbling_power(19), elemental_chaos_frost
0:02.605 single K stormstrike Fluffy_Pillow 42418.0/50000: 85% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds, crumbling_power(18), elemental_chaos_frost
0:03.473 single K stormstrike Fluffy_Pillow 42806.8/50000: 86% mana bloodlust, berserking, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(17), elemental_chaos_frost
0:04.339 single K stormstrike Fluffy_Pillow 43192.4/50000: 86% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(16), elemental_chaos_frost
0:05.208 single K stormstrike Fluffy_Pillow 43582.8/50000: 87% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(15), elemental_chaos_frost
0:06.075 single K stormstrike Fluffy_Pillow 41970.0/50000: 84% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(14), elemental_chaos_frost
0:06.945 single K stormstrike Fluffy_Pillow 39362.0/50000: 79% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, crumbling_power(13), elemental_chaos_frost
0:07.812 single L ice_strike Fluffy_Pillow 39749.2/50000: 79% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, crumbling_power(12), elemental_chaos_frost
0:08.681 single K stormstrike Fluffy_Pillow 39489.6/50000: 79% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, crumbling_power(11), elemental_chaos_frost
0:09.548 single N flame_shock Fluffy_Pillow 39876.8/50000: 80% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(10), elemental_chaos_frost
0:10.417 single R elemental_blast Fluffy_Pillow 40517.2/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(9), elemental_chaos_frost
0:11.285 single Q stormstrike Fluffy_Pillow 40531.0/50000: 81% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_frost
0:12.152 default F feral_spirit Fluffy_Pillow 40918.2/50000: 82% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_frost
0:13.107 single R elemental_blast Fluffy_Pillow 42446.2/50000: 85% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_frost
0:14.060 single U lava_lash Fluffy_Pillow 42596.0/50000: 85% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_frost
0:15.015 single W sundering Fluffy_Pillow 43724.0/50000: 87% mana bloodlust, elemental_blast_critical_strike, feral_spirit, earthen_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), elemental_chaos_frost
0:15.967 single Q stormstrike Fluffy_Pillow 42247.2/50000: 84% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, crumbling_power(3), elemental_chaos_frost
0:16.921 single T ice_strike Fluffy_Pillow 42773.6/50000: 86% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, crumbling_power(2), elemental_chaos_frost
0:17.873 single X frost_shock Fluffy_Pillow 42646.8/50000: 85% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, crumbling_power, elemental_chaos_frost
0:18.824 single Y earth_elemental Fluffy_Pillow 43668.4/50000: 87% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_frost
0:19.779 single Z flame_shock Fluffy_Pillow 45196.4/50000: 90% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_frost
0:20.732 single Q stormstrike Fluffy_Pillow 45971.2/50000: 92% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_frost
0:21.686 single V lightning_bolt Fluffy_Pillow 46497.6/50000: 93% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), elemental_chaos_frost
0:22.639 single Q stormstrike Fluffy_Pillow 47522.4/50000: 95% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
0:23.591 single U lava_lash Fluffy_Pillow 48045.6/50000: 96% mana bloodlust, flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_frost
0:24.544 single R elemental_blast Fluffy_Pillow 49170.4/50000: 98% mana bloodlust, flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_frost
0:25.498 single X frost_shock Fluffy_Pillow 49321.8/50000: 99% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_frost
0:26.422 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_frost
0:27.350 single Q stormstrike Fluffy_Pillow 49484.8/50000: 99% mana bloodlust, flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(4), spiraling_winds(3), elemental_chaos_frost
0:28.275 single Q stormstrike Fluffy_Pillow 45964.8/50000: 92% mana bloodlust, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(9), spiraling_winds(3), elemental_chaos_frost
0:29.200 single S lightning_bolt Fluffy_Pillow 46444.8/50000: 93% mana bloodlust, flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(10), spiraling_winds(4), elemental_chaos_frost
0:30.125 single Q stormstrike Fluffy_Pillow 47424.8/50000: 95% mana bloodlust, flurry, elemental_blast_haste, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_frost
0:31.052 single Q stormstrike Fluffy_Pillow 46908.0/50000: 94% mana bloodlust, flurry(2), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_frost
0:31.976 single Q stormstrike Fluffy_Pillow 47386.4/50000: 95% mana bloodlust, elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_frost
0:32.902 single T ice_strike Fluffy_Pillow 47868.0/50000: 96% mana bloodlust, elemental_blast_haste, forceful_winds(3), maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_frost
0:33.829 single Q stormstrike Fluffy_Pillow 47701.2/50000: 95% mana bloodlust, flurry(3), elemental_blast_haste, forceful_winds(4), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_frost
0:34.753 default F feral_spirit Fluffy_Pillow 48179.6/50000: 96% mana bloodlust, flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(7), elemental_chaos_frost
0:35.707 single Q stormstrike Fluffy_Pillow 49706.0/50000: 99% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(7), elemental_chaos_frost
0:36.662 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(8), forgestorm_ignited, elemental_chaos_frost
0:37.615 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_frost
0:38.568 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_frost
0:39.522 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_frost
0:40.476 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
0:41.712 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
0:42.951 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
0:44.189 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
0:45.427 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
0:46.664 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
0:47.902 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_frost
0:49.139 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon, spiraling_winds(10), elemental_chaos_frost
0:50.377 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
0:51.616 single Q stormstrike Fluffy_Pillow 48982.4/50000: 98% mana flurry(3), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_frost
0:52.856 single Q stormstrike Fluffy_Pillow 49966.4/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_frost
0:54.095 single S lightning_bolt Fluffy_Pillow 49948.8/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_frost
0:55.334 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:56.573 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:57.812 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:59.051 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:00.290 single X frost_shock Fluffy_Pillow 48982.4/50000: 98% mana flurry, forceful_winds(5), maelstrom_weapon(3), ice_strike, spiraling_winds(10), elemental_chaos_frost
1:01.529 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_frost
1:02.767 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), stormbringer, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_frost
1:04.006 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_frost
1:05.242 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_frost
1:06.482 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:07.720 single Q stormstrike Fluffy_Pillow 49980.8/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:08.960 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:10.198 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:11.656 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:12.896 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:14.135 single Q stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:15.374 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:16.613 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_frost
1:17.851 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:19.091 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:20.328 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
1:21.565 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:22.804 Waiting     1.071 sec 50000.0/50000: 100% mana maelstrom_weapon(4), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:23.875 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(4), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:25.262 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(5), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
1:26.501 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:27.739 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:28.976 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:30.215 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:31.454 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(3), sophic_devotion, elemental_chaos_frost
1:32.691 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(4), doom_winds, sophic_devotion, elemental_chaos_frost
1:33.929 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(7), doom_winds, sophic_devotion, elemental_chaos_frost
1:35.169 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds, sophic_devotion, forgestorm_ignited, elemental_chaos_frost
1:36.407 single K stormstrike Fluffy_Pillow 49980.8/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds, forgestorm_ignited, elemental_chaos_frost
1:37.647 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, forgestorm_ignited, elemental_chaos_frost
1:38.885 single K stormstrike Fluffy_Pillow 48980.8/50000: 98% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, forgestorm_ignited, elemental_chaos_frost
1:40.123 single Q stormstrike Fluffy_Pillow 49961.6/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_frost
1:41.363 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_frost
1:42.602 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_frost
1:43.841 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
1:45.045 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
1:46.248 single R elemental_blast Fluffy_Pillow 49924.8/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
1:47.620 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), elemental_chaos_frost
1:48.822 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, forgestorm_ignited, elemental_chaos_frost
1:50.025 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), ice_strike, forgestorm_ignited, elemental_chaos_frost
1:51.229 single Q stormstrike Fluffy_Pillow 48926.4/50000: 98% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, forgestorm_ignited, elemental_chaos_frost
1:52.430 single Q stormstrike Fluffy_Pillow 49848.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(6), ice_strike, forgestorm_ignited, elemental_chaos_frost
1:53.632 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_frost
1:54.870 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_frost
1:56.107 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_frost
1:57.344 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_frost
1:58.582 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
1:59.822 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:01.060 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
2:02.262 single T ice_strike Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth
2:03.463 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:04.666 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:05.867 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:07.069 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:08.270 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:09.472 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:10.675 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:11.913 single X frost_shock Fluffy_Pillow 49980.8/50000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:13.153 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
2:14.390 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth
2:15.628 default F feral_spirit Fluffy_Pillow 49980.8/50000: 100% mana flurry(3), forceful_winds(2), stormbringer, maelstrom_weapon(7), elemental_chaos_earth
2:16.865 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), elemental_chaos_earth
2:18.103 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_earth
2:19.342 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth
2:20.580 single T ice_strike Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_earth
2:21.818 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:23.058 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:24.297 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, elemental_chaos_earth
2:25.536 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, elemental_chaos_earth
2:26.775 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), elemental_chaos_earth
2:28.015 single Q stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), elemental_chaos_earth
2:29.254 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), elemental_chaos_earth
2:30.493 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
2:31.731 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_earth
2:32.970 single T ice_strike Fluffy_Pillow 48982.4/50000: 98% mana flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_earth
2:34.209 single U lava_lash Fluffy_Pillow 49314.8/50000: 99% mana flurry, forceful_winds(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_earth
2:35.448 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(4), maelstrom_weapon(7), ice_strike, spiraling_winds(3), elemental_chaos_earth
2:36.687 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
2:37.926 single J windstrike Fluffy_Pillow 49982.4/50000: 100% mana ascendance, flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
2:39.164 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth
2:40.401 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth
2:41.638 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth
2:42.876 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth
2:44.114 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth
2:45.352 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth
2:46.591 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
2:47.831 single R elemental_blast Fluffy_Pillow 49984.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
2:49.070 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:50.308 single Q stormstrike Fluffy_Pillow 48980.8/50000: 98% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:51.547 single J windstrike Fluffy_Pillow 49963.2/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:52.788 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:54.025 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, spiraling_winds(10), elemental_chaos_earth
2:55.264 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:56.502 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_chaos_earth
2:57.741 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_chaos_earth
2:58.980 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth
3:00.218 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
3:00.218 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(20), elemental_chaos_fire
3:00.218 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(20), elemental_chaos_fire
3:01.344 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(19), elemental_chaos_fire
3:02.580 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), elemental_chaos_fire
3:03.707 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(18), elemental_chaos_fire
3:04.833 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(17), elemental_chaos_fire
3:05.959 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(16), elemental_chaos_fire
3:07.086 single X frost_shock Fluffy_Pillow 49803.2/50000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), elemental_chaos_fire
3:08.213 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(5), doom_winds, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_fire
3:09.338 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(6), doom_winds, legacy_of_the_frost_witch, crumbling_power(13), sophic_devotion, elemental_chaos_fire
3:10.466 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, forceful_winds(4), crumbling_power(12), sophic_devotion, elemental_chaos_fire
3:11.590 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, forceful_winds(4), crumbling_power(11), sophic_devotion, elemental_chaos_fire
3:12.716 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(3), crumbling_power(10), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:13.955 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(4), ice_strike, crumbling_power(9), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:15.192 default F feral_spirit Fluffy_Pillow 48979.2/50000: 98% mana flurry, forceful_winds(4), maelstrom_weapon(4), ice_strike, crumbling_power(8), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:16.431 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, crumbling_power(7), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:17.671 single Q stormstrike Fluffy_Pillow 48984.0/50000: 98% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, crumbling_power(6), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:18.910 single R elemental_blast Fluffy_Pillow 49966.4/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(5), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:20.147 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:21.386 single Q stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:22.627 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
3:23.868 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:25.071 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
3:26.274 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:27.478 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:28.682 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_fire
3:29.884 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_fire
3:31.086 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(7), elemental_chaos_fire
3:32.288 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), legacy_of_the_frost_witch, elemental_chaos_fire
3:33.492 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds(3), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
3:34.730 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds(3), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
3:35.968 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, forceful_winds(4), stormbringer, maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_fire
3:37.206 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), stormbringer, maelstrom_weapon(6), static_accumulation, spiraling_winds(2), elemental_chaos_fire
3:38.444 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(2), elemental_chaos_fire
3:39.681 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(3), elemental_chaos_fire
3:40.919 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(4), elemental_chaos_fire
3:42.157 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_fire
3:43.396 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_fire
3:44.636 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_fire
3:45.873 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
3:47.110 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, spiraling_winds(7), forgestorm_ignited, elemental_chaos_fire
3:48.349 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, spiraling_winds(7), forgestorm_ignited, elemental_chaos_fire
3:49.588 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_fire
3:50.828 single X frost_shock Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_fire
3:52.067 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_fire
3:53.305 Waiting     0.404 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:53.709 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:55.193 single Q stormstrike Fluffy_Pillow 48980.8/50000: 98% mana flurry(3), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:56.432 single S lightning_bolt Fluffy_Pillow 46963.2/50000: 94% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:57.670 single Q stormstrike Fluffy_Pillow 48444.0/50000: 97% mana flurry(2), elemental_blast_mastery, forceful_winds(5), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:58.909 single J windstrike Fluffy_Pillow 48426.4/50000: 97% mana ascendance, flurry(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
4:00.148 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds, stormbringer, maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
4:01.385 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
4:02.623 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
4:03.861 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:05.101 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:06.338 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:07.576 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:08.815 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:10.052 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:11.291 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:12.530 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:13.770 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:15.009 Waiting     0.177 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:15.186 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon(5), sophic_devotion, elemental_chaos_fire
4:16.425 Waiting     0.784 sec 50000.0/50000: 100% mana flurry, elemental_blast_haste, sophic_devotion, elemental_chaos_fire
4:17.209 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, sophic_devotion, elemental_chaos_fire
4:18.598 single Q stormstrike Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(3), elemental_chaos_fire
4:19.799 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(6), elemental_chaos_fire
4:21.002 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7), elemental_chaos_fire
4:22.203 single R elemental_blast Fluffy_Pillow 49921.6/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), elemental_chaos_fire
4:23.621 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
4:24.823 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
4:26.026 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:27.264 single Q stormstrike Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:28.503 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_fire
4:29.740 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:30.977 default B potion Fluffy_Pillow 47979.2/50000: 96% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:30.977 single U lava_lash Fluffy_Pillow 47979.2/50000: 96% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:32.215 default G doom_winds Fluffy_Pillow 49560.0/50000: 99% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:33.452 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), doom_winds, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:34.692 single M sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), doom_winds, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:35.930 single K stormstrike Fluffy_Pillow 48980.8/50000: 98% mana forceful_winds(5), stormbringer, maelstrom_weapon(8), doom_winds, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:37.169 single L ice_strike Fluffy_Pillow 49963.2/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(10), doom_winds, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:38.408 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:39.647 single K stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:40.886 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:42.123 default F feral_spirit Fluffy_Pillow 49979.2/50000: 100% mana ascendance, flurry, forceful_winds(5), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:43.362 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:44.600 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:45.838 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:47.075 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:48.314 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:49.553 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:50.755 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:51.957 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:53.159 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:54.362 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:55.563 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:56.765 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:57.965 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
4:59.167 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.51% 21.51% 3656
Versatility 7.11% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.07% 52.07% 3246
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Gamba"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Phys : 44675 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
44675.3 44675.3 50.3 / 0.113% 8716.2 / 19.5% 49.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
848.4 845.4 Mana 1.93% 52.0 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Phys 44675
Ascendance 0 (324) 0.0% (0.7%) 2.0 180.43sec 47989 44353

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0824 0.0000 0.00 0.00 0.00% 44352.54 44352.54

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [G]:2.00
  • if_expr:(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
    Ascendance (_damage) 324 0.7% 2.0 180.43sec 47989 0 Direct 2.0 40335 80854 47987 18.9% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 95978.91 95978.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.11% 1.62 0 2 40335.39 35125 52197 38910.62 0 52197 65434 65434 0.00%
crit 18.89% 0.38 0 2 80853.84 70251 104393 27683.22 0 104393 30545 30545 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 77 0.2% 3.7 90.47sec 6154 5626 Direct 3.7 6154 0 6154 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0939 0.0000 22915.64 32737.46 30.00% 5626.23 5626.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.72 3 4 6154.12 3670 9854 6173.24 4974 8207 22916 32737 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.72
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6449 14.5% 24.7 11.69sec 78207 65966 Direct 24.7 64689 130033 78246 20.7% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.74 24.73 0.00 0.00 0.00 1.1856 0.0000 1935049.67 1935049.67 0.00% 65966.10 65966.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.25% 19.60 10 29 64689.39 43658 131974 64677.03 53523 78000 1267886 1267886 0.00%
crit 20.75% 5.13 0 15 130032.86 87317 270089 129569.67 0 223386 667163 667163 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.92

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [S]:24.74
  • if_expr:(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
Flame Shock 1501 3.4% 32.9 8.83sec 13688 27713 Direct 32.9 2687 5395 3156 17.3% 0.0%
Periodic 183.1 1612 3235 1893 17.3% 0.0% 95.5%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.91 32.91 183.11 183.11 31.76 0.4939 1.5645 450478.32 450478.32 0.00% 1488.08 27713.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 27.22 13 42 2687.36 2272 4687 2686.36 2413 3081 73145 73145 0.00%
crit 17.30% 5.69 0 15 5394.87 4543 9143 5375.57 0 7658 30713 30713 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.66% 151.36 106 196 1611.58 1 2788 1611.18 1481 1792 243933 243933 0.00%
crit 17.34% 31.75 12 64 3234.64 33 5513 3234.29 2863 3792 102687 102687 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.96
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [O]:1.15
  • if_expr:!ticking
    single
    [b]:12.67
Flametongue Weapon 0 (1450) 0.0% (3.2%) 1.0 0.00sec 434410 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1450 3.2% 1083.9 0.69sec 401 0 Direct 1083.9 342 685 401 17.2% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1083.89 1083.89 0.00 0.00 0.00 0.0000 0.0000 434410.42 434410.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.78% 897.22 628 1216 341.68 277 570 341.76 312 384 306562 306562 0.00%
crit 17.22% 186.67 115 275 684.90 555 1140 685.11 618 774 127848 127848 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.16

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1102 2.5% 28.7 7.61sec 11520 0 Direct 28.7 9806 19713 11519 17.3% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.70 28.70 0.00 0.00 0.00 0.0000 0.0000 330633.59 330633.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 23.74 2 67 9805.75 9732 10030 9805.51 9732 10030 232754 232754 0.00%
crit 17.30% 4.97 0 18 19712.51 19463 20059 19345.20 0 20059 97879 97879 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1188 2.7% 20.0 13.79sec 17831 15004 Direct 20.0 15168 30468 17831 17.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 0.00 1.1884 0.0000 356970.87 356970.87 0.00% 15004.45 15004.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 16.54 4 31 15168.24 7339 29187 15203.47 11687 18734 250821 250821 0.00%
crit 17.40% 3.48 0 12 30468.47 14678 57962 29711.04 0 53639 106150 106150 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.96

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [Z]:20.02
Ice Strike 1433 3.2% 21.2 14.13sec 20283 17361 Direct 21.2 17250 34663 20283 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.20 21.20 0.00 0.00 0.00 1.1683 0.0000 430030.39 430030.39 0.00% 17360.94 17360.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 17.51 8 26 17249.85 14383 29677 17244.60 15124 19964 302021 302021 0.00%
crit 17.42% 3.69 0 12 34663.39 28765 55980 33957.84 0 54677 128010 128010 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:2.38
  • if_expr:buff.doom_winds.up
    single
    [V]:18.83
Lava Lash 1337 3.0% 19.1 14.97sec 21043 17749 Direct 19.1 17904 35967 21043 17.4% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.08 19.08 0.00 0.00 0.00 1.1856 0.0000 401566.37 401566.37 0.00% 17748.79 17748.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 15.77 7 25 17904.41 15147 31254 17895.78 15944 20221 282306 282306 0.00%
crit 17.38% 3.32 0 10 35967.33 30294 60239 34934.50 0 51878 119261 119261 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [P]:2.56
  • if_expr:talent.molten_assault.enabled&dot.flame_shock.refreshable
    single
    [W]:16.52
Lightning Bolt 2943 6.6% 18.1 15.37sec 48784 41321 Direct 18.1 40049 80263 48785 21.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.13 18.13 0.00 0.00 0.00 1.1806 0.0000 884279.59 884279.59 0.00% 41321.48 41321.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.28% 14.19 4 26 40048.95 27612 88626 40041.70 31969 50746 568258 568258 0.00%
crit 21.72% 3.94 0 13 80262.57 55224 163051 78964.63 0 148178 316022 316022 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [T]:4.06
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [X]:14.06
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1496 3.4% 172.1 1.93sec 2612 1467 Direct 172.1 2582 5189 2612 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 172.09 172.09 0.00 0.00 0.00 1.7803 0.0000 449482.52 642134.25 30.00% 1467.11 1467.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.22% 113.96 66 166 2581.71 2257 4339 2580.34 2372 2881 294198 420294 30.00%
crit 17.39% 29.93 8 52 5188.65 4513 8580 5186.19 4631 5929 155284 221840 30.00%
miss 16.39% 28.21 10 52 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 757 1.7% 173.8 2.01sec 1309 736 Direct 173.8 1295 2604 1309 17.3% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 173.80 173.80 0.00 0.00 0.00 1.7796 0.0000 227542.23 325068.61 30.00% 735.70 735.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.27% 115.17 69 163 1294.80 1128 2169 1294.25 1194 1427 149129 213046 30.00%
crit 17.33% 30.12 12 58 2603.74 2257 4339 2602.46 2340 3004 78414 112022 30.00%
miss 16.40% 28.51 11 50 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (6868) 0.0% (15.4%) 88.6 3.21sec 23307 19669

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 88.55 0.00 0.00 0.00 0.00 1.1850 0.0000 0.00 0.00 0.00% 19668.52 19668.52

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:5.67
  • if_expr:buff.doom_winds.up
    single
    [R]:70.24
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    single
    [U]:12.65
    Stormstrike (_mh) 3716 (4579) 8.4% (10.3%) 118.0 3.21sec 11656 0 Direct 118.0 (176.0) 8046 16174 9460 17.4% (11.7%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.03 118.03 0.00 0.00 0.00 0.0000 0.0000 1116589.56 1595168.61 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 97.51 51 154 8046.45 2623 20119 8057.20 6801 9422 784596 1120880 30.00%
crit 17.39% 20.53 5 43 16174.21 5246 40687 16196.09 9990 22157 331993 474288 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 862 1.9% 58.0 5.47sec 4471 0 Direct 58.0 4471 0 4471 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.97 57.97 0.00 0.00 0.00 0.0000 0.0000 259201.52 259201.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 57.97 18 111 4471.31 1152 18571 4482.33 3353 5974 259202 259202 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 1859 (2290) 4.2% (5.1%) 118.0 3.21sec 5829 0 Direct 118.0 (176.0) 4022 8094 4731 17.4% (11.7%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.03 118.03 0.00 0.00 0.00 0.0000 0.0000 558439.79 797791.46 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 97.49 55 152 4022.45 1312 10060 4027.55 3384 4765 392153 560232 30.00%
crit 17.40% 20.54 4 43 8094.42 2623 20343 8106.39 4931 11758 166287 237559 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 431 1.0% 58.0 5.47sec 2235 0 Direct 58.0 2235 0 2235 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.97 57.97 0.00 0.00 0.00 0.0000 0.0000 129586.51 129586.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 57.97 18 111 2235.43 576 9285 2240.22 1653 3044 129587 129587 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 989 2.2% 6.5 46.68sec 45277 38725 Direct 6.5 38503 77704 45277 17.3% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.55 6.55 0.00 0.00 0.00 1.1693 0.0000 296557.70 296557.70 0.00% 38725.22 38725.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.72% 5.42 0 9 38503.20 25569 82449 38511.06 0 57317 208605 208605 0.00%
crit 17.28% 1.13 0 6 77704.06 51138 164668 55260.98 0 163054 87952 87952 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [N]:0.80
  • if_expr:buff.doom_winds.up
    single
    [Y]:5.75
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (6853) 0.0% (15.3%) 1.0 0.00sec 2048779 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 6853 15.3% 408.6 2.45sec 5014 0 Direct 408.6 4283 8552 5014 17.1% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 408.60 408.60 0.00 0.00 0.00 0.0000 0.0000 2048778.55 2926901.12 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.87% 338.62 210 494 4283.08 1423 11363 4287.19 3615 5339 1450353 2071985 30.00%
crit 17.13% 69.97 35 119 8551.97 2845 22177 8558.22 6820 11098 598426 854916 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 448 1.0% 24.0 10.20sec 5524 4068 Direct 24.0 4569 9195 5524 20.6% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.00 24.00 0.00 0.00 0.00 1.3580 0.0000 132550.18 132550.18 0.00% 4067.58 4067.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.36% 19.04 8 27 4569.01 3559 6128 4569.58 4136 5594 87006 87006 0.00%
crit 20.64% 4.95 0 13 9195.24 7118 12257 9146.78 0 11858 45545 45545 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 236 0.5% 25.2 9.69sec 2770 2028 Direct 25.2 2289 4603 2770 20.8% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.21 25.21 0.00 0.00 0.00 1.3661 0.0000 69821.17 69821.17 0.00% 2027.74 2027.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.21% 19.96 11 29 2288.83 1813 3064 2289.06 2064 2809 45696 45696 0.00%
crit 20.79% 5.24 0 14 4603.26 3626 6128 4585.05 0 5962 24126 24126 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (6562) 0.0% (14.5%) 20.3 10.01sec 95873 97567

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.26 0.00 0.00 0.00 0.00 0.9827 0.0000 0.00 0.00 0.00% 97567.16 97567.16

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [K]:20.25
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [Q]:0.01
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1804 (2207) 4.0% (4.9%) 27.0 10.01sec 24189 0 Direct 27.0 (38.6) 16904 34146 19764 16.6% (11.6%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.01 27.01 0.00 0.00 0.00 0.0000 0.0000 533734.11 533734.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.41% 22.53 10 37 16903.74 4954 31744 17011.89 12537 23384 380766 380766 0.00%
crit 16.59% 4.48 0 15 34146.05 9922 62071 34057.94 0 58596 152968 152968 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 404 0.9% 11.6 17.84sec 10288 0 Direct 11.6 10287 0 10287 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 0.0000 0.0000 119494.15 119494.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.62 3 22 10287.31 3298 27286 10277.94 7177 16885 119494 119494 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 903 (1105) 2.0% (2.4%) 27.0 10.01sec 12111 0 Direct 27.0 (38.6) 8460 16988 9894 16.8% (11.8%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.01 27.01 0.00 0.00 0.00 0.0000 0.0000 267179.63 267179.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.19% 22.47 10 40 8460.28 2434 15585 8514.88 6280 11624 190072 190072 0.00%
crit 16.81% 4.54 0 13 16987.78 4961 31744 17000.00 0 29831 77108 77108 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 202 0.4% 11.6 17.84sec 5156 0 Direct 11.6 5156 0 5156 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.62 11.62 0.00 0.00 0.00 0.0000 0.0000 59891.32 59891.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.62 3 22 5156.19 1584 13939 5150.11 3478 8224 59891 59891 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3250 7.2% 20.3 10.01sec 47499 0 Direct 20.3 39295 78928 47500 20.7% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.25 20.25 0.00 0.00 0.00 0.0000 0.0000 961872.61 961872.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.30% 16.06 8 23 39294.91 18282 56321 39293.25 33254 48482 630994 630994 0.00%
crit 20.70% 4.19 0 12 78927.89 37683 112643 78110.69 0 111357 330879 330879 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.07

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 401 / 84
melee 401 0.2% 39.4 2.39sec 630 408 Direct 39.4 537 1074 630 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.40 39.40 0.00 0.00 0.00 1.5454 0.0000 24838.79 35484.89 30.00% 407.88 407.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 32.56 22 58 537.02 475 797 536.50 475 682 17486 24980 30.00%
crit 17.37% 6.84 0 17 1074.45 950 1582 1072.79 0 1475 7353 10505 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4144 / 2578
melee 4144 5.8% 342.3 1.73sec 2252 2009 Direct 342.3 1921 3834 2252 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 342.30 342.30 0.00 0.00 0.00 1.1210 0.0000 770738.57 1101083.17 30.00% 2008.65 2008.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.72% 283.16 209 368 1921.15 1588 3071 1921.58 1757 2188 543998 777160 30.00%
crit 17.28% 59.14 28 96 3833.90 3176 6141 3834.86 3417 4431 226740 323923 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Phys
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.70sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 306.44sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.15 0.00 0.00 0.00 0.00 1.0067 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [a]:1.15
Feral Spirit 13.5 24.02sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.50 0.00 0.00 0.00 0.00 1.1405 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:13.50
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.50
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 95.65% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 180.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.2s / 182.7s
  • trigger_min/max:180.2s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.6sec 5.5sec 18.8sec 12.74% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:128.62

Trigger Details

  • interval_min/max:180.0s / 181.4s
  • trigger_min/max:0.0s / 164.2s
  • trigger_pct:100.00%
  • duration_min/max:17.0s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.72%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.70%
  • crumbling_power_7:0.70%
  • crumbling_power_8:0.68%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.71%
  • crumbling_power_18:1.24%
  • crumbling_power_19:0.84%
  • crumbling_power_20:0.02%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds 3.7 0.0 90.5sec 90.5sec 7.9sec 9.85% 12.52% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.5s
  • trigger_min/max:90.0s / 92.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • doom_winds_1:9.85%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 13.5 0.0 26.0sec 22.9sec 17.5sec 62.21% 100.00% 0.0 (0.0) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 75.1s
  • trigger_min/max:6.2s / 45.2s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 55.7s

Stack Uptimes

  • earthen_weapon_2:58.11%
  • earthen_weapon_4:4.09%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.3 1.0 37.2sec 32.5sec 10.8sec 26.27% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 258.7s
  • trigger_min/max:0.9s / 258.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.7s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.27%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.3 0.9 37.1sec 32.6sec 10.7sec 26.15% 0.00% 0.9 (0.9) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 252.1s
  • trigger_min/max:1.7s / 252.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.2s

Stack Uptimes

  • elemental_blast_haste_1:26.15%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.3 0.9 37.5sec 32.7sec 10.7sec 26.01% 0.00% 0.9 (0.9) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 268.4s
  • trigger_min/max:1.7s / 265.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.5s

Stack Uptimes

  • elemental_blast_mastery_1:26.01%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 124.0sec 99.0sec 58.3sec 24.99% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:24.99%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.1sec 98.3sec 58.0sec 25.63% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:25.63%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.1sec 100.2sec 58.3sec 24.59% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 295.8s

Stack Uptimes

  • elemental_chaos_fire_1:24.59%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.2sec 98.9sec 58.3sec 24.79% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.4s

Stack Uptimes

  • elemental_chaos_frost_1:24.80%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 308.1sec 0.0sec 27.4sec 13.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 331.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.41%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.6 2.9 29.6sec 24.0sec 17.5sec 62.21% 0.00% 53.3 (53.3) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 75.1s
  • trigger_min/max:6.2s / 45.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.7s

Stack Uptimes

  • feral_spirit_1:62.21%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.9 367.3 6.9sec 0.7sec 5.7sec 84.10% 90.46% 367.3 (870.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 94.5s
  • trigger_min/max:0.0s / 15.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 94.3s

Stack Uptimes

  • flurry_1:20.25%
  • flurry_2:33.20%
  • flurry_3:30.65%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 119.0 17.8sec 2.2sec 14.6sec 83.97% 100.00% 57.6 (57.6) 16.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 50.5s
  • trigger_min/max:0.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:15.31%
  • forceful_winds_2:14.31%
  • forceful_winds_3:12.75%
  • forceful_winds_4:10.58%
  • forceful_winds_5:31.01%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.3sec 46.3sec 12.9sec 19.48% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 214.7s
  • trigger_min/max:0.1s / 209.1s
  • trigger_pct:98.80%
  • duration_min/max:0.0s / 60.5s

Stack Uptimes

  • forgestorm_ignited_1:19.48%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.5 0.7 14.7sec 14.1sec 7.1sec 48.23% 76.85% 0.7 (0.7) 4.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.9s / 65.4s
  • trigger_min/max:8.4s / 65.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.5s

Stack Uptimes

  • ice_strike_1:48.23%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 24.2 16.0 12.5sec 7.4sec 7.1sec 57.11% 0.00% 16.0 (16.0) 23.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 55.2s
  • trigger_min/max:0.8s / 33.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.8s

Stack Uptimes

  • legacy_of_the_frost_witch_1:57.11%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 46.7 380.1 6.5sec 1.4sec 5.5sec 85.52% 100.00% 42.9 (46.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 36.9s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.6s

Stack Uptimes

  • maelstrom_weapon_1:9.74%
  • maelstrom_weapon_2:11.39%
  • maelstrom_weapon_3:13.05%
  • maelstrom_weapon_4:13.70%
  • maelstrom_weapon_5:8.80%
  • maelstrom_weapon_6:7.07%
  • maelstrom_weapon_7:5.25%
  • maelstrom_weapon_8:4.28%
  • maelstrom_weapon_9:3.43%
  • maelstrom_weapon_10:8.81%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 60.5sec 45.4sec 16.5sec 23.75% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 232.1s
  • trigger_min/max:0.0s / 230.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s

Stack Uptimes

  • sophic_devotion_1:23.75%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.1sec 45.8sec 32.0sec 38.16% 0.00% 25.5 (25.5) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 242.3s
  • trigger_min/max:0.0s / 214.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 191.6s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.33%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.66%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 59.7 18.8 5.0sec 3.8sec 1.2sec 23.15% 54.42% 18.8 (18.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 80.5s
  • trigger_min/max:0.0s / 80.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.1s

Stack Uptimes

  • stormbringer_1:23.15%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.2 33.0 66.0 17.9s 15.0s 57.1s
Windfury-ForcefulWinds: 2 50.6 33.0 69.0 18.1s 0.4s 67.1s
Windfury-ForcefulWinds: 3 48.6 24.0 69.0 18.8s 1.0s 75.7s
Windfury-ForcefulWinds: 4 45.0 21.0 69.0 20.4s 1.1s 109.7s
Windfury-ForcefulWinds: 5 213.2 114.0 369.0 4.7s 0.0s 93.7s
windfury_totem_extra_attack_mh 27.8 10.0 50.0 10.6s 1.2s 105.5s
windfury_totem_extra_attack_oh 28.2 9.0 60.0 10.4s 0.1s 116.9s
Windfury: Unruly Winds 136.2 87.0 198.0 2.5s 0.0s 40.5s
Maelstrom Weapon: Feral Spirit 71.2 52.0 95.0 4.2s 0.0s 30.2s
Maelstrom Weapon: Elemental Assault 108.8 77.0 147.0 2.7s 0.8s 11.0s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.4s
Stormflurry 36.2 11.0 71.0 10.8s 0.8s 151.0s
Flametongue: Windfury Attack 408.6 261.0 594.0 2.5s 0.0s 40.5s
Stormbringer: Windfury Attack 42.9 15.0 80.0 7.9s 0.0s 104.0s
Maelstrom Weapon: Windfury Attack 81.6 40.0 134.0 4.7s 0.0s 73.8s
Flametongue: main_hand 143.9 94.0 206.0 2.5s 1.3s 28.2s
Maelstrom Weapon: main_hand 28.8 10.0 52.0 10.2s 1.3s 120.9s
Windfury: main_hand 48.9 24.0 80.0 6.3s 1.3s 78.8s
Flametongue: Windlash 24.0 19.0 31.0 10.2s 1.2s 170.2s
Maelstrom Weapon: Windlash 4.8 0.0 15.0 43.9s 1.2s 194.6s
Windfury: Windlash 16.2 10.0 24.0 14.7s 1.2s 176.9s
Flametongue: offhand 145.3 93.0 202.0 2.5s 1.3s 29.7s
Maelstrom Weapon: offhand 29.2 7.0 56.0 10.0s 1.3s 113.3s
Flametongue: Windlash Off-Hand 25.2 21.0 33.0 9.7s 1.2s 168.1s
Maelstrom Weapon: Windlash Off-Hand 5.1 0.0 13.0 42.0s 1.2s 192.0s
Flametongue: Sundering 6.5 4.0 9.0 46.7s 40.0s 138.1s
Stormbringer: Sundering 0.7 0.0 5.0 109.9s 40.0s 320.7s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 103.2s 40.0s 341.1s
Windfury: Sundering 2.6 0.0 8.0 86.7s 40.0s 332.7s
Flametongue: Windstrike 27.0 17.0 44.0 10.0s 0.8s 171.7s
Stormbringer: Windstrike 2.8 0.0 11.0 59.6s 0.8s 193.8s
Maelstrom Weapon: Windstrike 5.4 0.0 18.0 40.7s 0.8s 193.3s
Windfury: Windstrike 19.1 9.0 36.0 13.8s 0.8s 177.4s
Flametongue: Windstrike Off-Hand 27.0 17.0 44.0 10.0s 0.8s 171.7s
Stormbringer: Windstrike Off-Hand 2.8 0.0 11.0 58.7s 0.8s 193.6s
Maelstrom Weapon: Windstrike Off-Hand 5.4 0.0 16.0 40.6s 0.8s 193.4s
Flametongue: Lava Lash 19.1 11.0 26.0 15.0s 9.0s 55.7s
Stormbringer: Lava Lash 2.0 0.0 8.0 75.4s 9.2s 330.2s
Maelstrom Weapon: Lava Lash 3.8 0.0 12.0 56.8s 9.0s 319.2s
Flametongue: Ice Strike 21.2 13.0 28.0 14.1s 8.4s 65.4s
Stormbringer: Ice Strike 2.3 0.0 9.0 75.8s 9.0s 329.2s
Maelstrom Weapon: Ice Strike 4.2 0.0 12.0 55.2s 8.7s 324.9s
Windfury: Ice Strike 8.1 1.0 17.0 36.1s 8.4s 256.0s
Flametongue: Stormstrike 118.0 70.0 181.0 3.2s 0.9s 28.4s
Stormbringer: Stormstrike 12.5 1.0 36.0 21.8s 0.9s 240.2s
Maelstrom Weapon: Stormstrike 23.6 7.0 46.0 12.5s 0.9s 170.0s
Windfury: Stormstrike 41.3 15.0 76.0 7.7s 0.9s 119.9s
Flametongue: Stormstrike Off-Hand 118.0 70.0 181.0 3.2s 0.9s 28.4s
Stormbringer: Stormstrike Off-Hand 12.4 0.0 31.0 21.8s 0.9s 279.5s
Maelstrom Weapon: Stormstrike Off-Hand 23.6 5.0 47.0 12.5s 0.9s 150.2s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 24.06% 17.03% 30.89% 0.7s 0.0s 18.4s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7980.0011.4629.2893.06116.381
Ascendance0.5520.0012.3840.4290.0002.384
Doom Winds0.5830.0012.5411.2850.2104.971
Sundering7.0840.00198.11037.1630.223114.756
Windstrike0.8960.0013.74117.74410.10024.987
Lava Lash3.2120.00143.35756.31921.349119.384
Flame Shock16.6490.001199.718211.10492.499303.104
Ice Strike2.5660.00153.03349.5329.214108.397
Frost Shock9.3880.001128.241172.34666.162253.415
Elemental Blast3.4360.00120.3262.1460.00023.498
Stormstrike1.0480.0015.14088.42244.348139.964
Earth Elemental6.8040.00631.8470.9110.00031.847

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Phys
mana_regenMana675.05253630.43100.00%375.72225753.9347.09%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 845.44 848.38 225753.6 49116.0 41944.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Phys
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 24.7434021.031375.001375.0056.88
Flame ShockMana 13.8310371.52750.00315.1443.43
Frost ShockMana 20.0210010.07500.00500.0135.66
Ice StrikeMana 21.2034983.041650.001650.0212.29
Lava LashMana 19.087633.33400.00400.0052.61
Lightning BoltMana 18.139063.19500.00500.0097.57
StormstrikeMana 118.03118032.661000.001332.9417.49
SunderingMana 6.5519649.383000.002999.9915.09

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Phys Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Phys Damage Per Second
Count 7499
Mean 44675.25
Minimum 37970.84
Maximum 55020.66
Spread ( max - min ) 17049.82
Range [ ( max - min ) / 2 * 100% ] 19.08%
Standard Deviation 2220.6227
5th Percentile 41242.18
95th Percentile 48587.53
( 95th Percentile - 5th Percentile ) 7345.34
Mean Distribution
Standard Deviation 25.6433
95.00% Confidence Interval ( 44624.99 - 44725.51 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9491
0.1 Scale Factor Error with Delta=300 42096
0.05 Scale Factor Error with Delta=300 168382
0.01 Scale Factor Error with Delta=300 4209527
Priority Target DPS
PR_Shaman_Enhancement_Phys Priority Target Damage Per Second
Count 7499
Mean 44675.25
Minimum 37970.84
Maximum 55020.66
Spread ( max - min ) 17049.82
Range [ ( max - min ) / 2 * 100% ] 19.08%
Standard Deviation 2220.6227
5th Percentile 41242.18
95th Percentile 48587.53
( 95th Percentile - 5th Percentile ) 7345.34
Mean Distribution
Standard Deviation 25.6433
95.00% Confidence Interval ( 44624.99 - 44725.51 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9491
0.1 Scale Factor Error with Delta=300 42096
0.05 Scale Factor Error with Delta=300 168382
0.01 Scale Factor Error with Delta=300 4209527
DPS(e)
PR_Shaman_Enhancement_Phys Damage Per Second (Effective)
Count 7499
Mean 44675.25
Minimum 37970.84
Maximum 55020.66
Spread ( max - min ) 17049.82
Range [ ( max - min ) / 2 * 100% ] 19.08%
Damage
PR_Shaman_Enhancement_Phys Damage
Count 7499
Mean 12573035.30
Minimum 9283704.10
Maximum 16479717.79
Spread ( max - min ) 7196013.69
Range [ ( max - min ) / 2 * 100% ] 28.62%
DTPS
PR_Shaman_Enhancement_Phys Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Phys Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Phys Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Phys Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Phys Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Phys Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_PhysTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Phys Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.50 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 13.50 feral_spirit
G 2.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
H 3.72 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
K 20.25 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
0.00 windfury_totem,if=!buff.windfury_totem.up
L 5.67 stormstrike,if=buff.doom_winds.up
0.00 crash_lightning,if=buff.doom_winds.up
M 2.38 ice_strike,if=buff.doom_winds.up
N 0.80 sundering,if=buff.doom_winds.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
O 1.15 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
0.00 frost_shock,if=buff.hailstorm.up
P 2.56 lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
Q 0.01 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 70.24 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
S 24.74 elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
T 4.06 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
U 12.65 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
V 18.83 ice_strike
W 16.52 lava_lash
0.00 elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
0.00 bag_of_tricks
X 14.06 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 5.75 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
Z 20.02 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
a 1.15 earth_elemental
b 12.67 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ABCDFGEHKKMKKKKKKFKKKKORRSRSRVRFRRTRPYZVRSZabRWXRRRVZbSRRWZbVFRSRZXWbRRSRRRVXRRWYZbUFRSRRSHLLMLLLPSRZbVUFXWZRSRRRRTRVRSWYZUbUXFRRRRSRVRWSRRRXRRVZWbFRRSRZVYWRSRZbDXGEHKKFKKMKKSKWKFRSRVRRRRRRSRPVRUTFRYSZWRVXRRXZbUUSRRRVSRFWRRXRRVRSRWYZXUUUSRHFMLLLPRRSRXVZXRWRFZSb

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 2 augmentation PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
0:00.000 default B potion Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_earth
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), crumbling_power(20), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:00.952 default G ascendance Fluffy_Pillow 40773.2/50000: 82% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:01.904 default E berserking Fluffy_Pillow 42296.4/50000: 85% mana bloodlust, ascendance, feral_spirit, earthen_weapon(2), maelstrom_weapon, static_accumulation, crumbling_power(18), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:01.904 default H doom_winds Fluffy_Pillow 42296.4/50000: 85% mana bloodlust, berserking, ascendance, feral_spirit, earthen_weapon(2), maelstrom_weapon, static_accumulation, crumbling_power(18), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.772 single K windstrike Fluffy_Pillow 43685.2/50000: 87% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), static_accumulation, doom_winds, crumbling_power(18), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.640 single K windstrike Fluffy_Pillow 45074.0/50000: 90% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds, crumbling_power(17), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.506 single M ice_strike Fluffy_Pillow 46459.6/50000: 93% mana bloodlust, berserking, ascendance, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, doom_winds, crumbling_power(16), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.373 single K windstrike Fluffy_Pillow 46196.8/50000: 92% mana bloodlust, berserking, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, doom_winds, ice_strike, crumbling_power(15), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.239 single K windstrike Fluffy_Pillow 47582.4/50000: 95% mana bloodlust, berserking, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.108 single K windstrike Fluffy_Pillow 48972.8/50000: 98% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.976 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.842 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.709 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.577 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.447 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.313 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.180 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(2), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.048 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(2), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.001 single O flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(3), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.953 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(3), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.907 single R stormstrike Fluffy_Pillow 49526.4/50000: 99% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(2), spiraling_winds(4), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.859 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power, spiraling_winds(4), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.812 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.766 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.717 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.672 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.626 single R stormstrike Fluffy_Pillow 49876.4/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.579 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.531 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.484 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(8), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.438 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(8), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.390 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.343 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.298 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.253 single Z frost_shock Fluffy_Pillow 48528.0/50000: 97% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
0:31.207 single V ice_strike Fluffy_Pillow 49554.4/50000: 99% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
0:32.159 single R stormstrike Fluffy_Pillow 49427.6/50000: 99% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_earth
0:33.112 single S elemental_blast Fluffy_Pillow 49952.4/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), elemental_chaos_earth
0:34.065 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, spiraling_winds(10), elemental_chaos_earth
0:34.991 single a earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, spiraling_winds(10), elemental_chaos_earth
0:35.916 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_earth
0:36.841 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
0:37.766 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), sophic_devotion, elemental_chaos_earth
0:38.692 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(9), sophic_devotion, elemental_chaos_earth
0:39.618 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, forceful_winds, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:40.544 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:41.744 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:42.947 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:44.149 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(3), maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_earth
0:45.387 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(3), maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
0:46.626 Waiting     0.401 sec 50000.0/50000: 100% mana forceful_winds(3), maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
0:47.027 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(4), maelstrom_weapon(5), sophic_devotion, elemental_chaos_earth
0:48.265 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:49.504 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:50.743 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:51.982 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth
0:53.220 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(4), elemental_chaos_earth
0:54.459 Waiting     0.623 sec 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(4), elemental_chaos_earth
0:55.082 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(4), elemental_chaos_earth
0:56.525 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(7), ice_strike, elemental_chaos_earth
0:57.763 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), ice_strike, elemental_chaos_earth
0:59.000 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, elemental_chaos_earth
1:00.239 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:01.477 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:02.716 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:03.955 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:05.193 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, sophic_devotion, elemental_chaos_fire
1:06.432 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
1:07.670 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(4), sophic_devotion, elemental_chaos_fire
1:08.908 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), sophic_devotion, elemental_chaos_fire
1:10.147 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:11.350 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:12.554 single R stormstrike Fluffy_Pillow 48926.4/50000: 98% mana flurry, elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:13.758 single V ice_strike Fluffy_Pillow 48852.8/50000: 98% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(8), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:14.960 single X lightning_bolt Fluffy_Pillow 49126.0/50000: 98% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_fire
1:16.164 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:17.366 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(4), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:18.570 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:19.772 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:21.011 single Z frost_shock Fluffy_Pillow 48982.4/50000: 98% mana flurry(3), forceful_winds(5), maelstrom_weapon(3), ice_strike, elemental_chaos_fire
1:22.251 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(3), elemental_chaos_fire
1:23.489 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(3), elemental_chaos_fire
1:24.729 default F feral_spirit Fluffy_Pillow 48980.8/50000: 98% mana flurry, forceful_winds, stormbringer, maelstrom_weapon(7), elemental_chaos_fire
1:25.966 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), elemental_chaos_fire
1:27.204 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), elemental_chaos_fire
1:28.443 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
1:29.680 single R stormstrike Fluffy_Pillow 49979.2/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:30.918 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:32.156 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:33.393 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), doom_winds, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:34.631 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:35.869 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), doom_winds, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:37.108 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, sophic_devotion, elemental_chaos_fire
1:38.346 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds, ice_strike, sophic_devotion, elemental_chaos_fire
1:39.585 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, sophic_devotion, elemental_chaos_fire
1:40.823 single P lava_lash Fluffy_Pillow 49980.8/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_fire
1:42.062 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_fire
1:43.300 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(4), stormbringer, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:44.539 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:45.777 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
1:47.016 Waiting     1.030 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
1:48.046 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(3), elemental_chaos_fire
1:49.452 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_fire
1:50.690 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(6), ice_strike, elemental_chaos_fire
1:51.968 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, elemental_chaos_fire
1:53.206 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, spiraling_winds, elemental_chaos_fire
1:54.445 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds, elemental_chaos_fire
1:55.683 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, spiraling_winds(2), elemental_chaos_fire
1:56.922 single S elemental_blast Fluffy_Pillow 49982.4/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(3), elemental_chaos_fire
1:58.159 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, elemental_chaos_fire
1:59.359 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
2:00.560 single R stormstrike Fluffy_Pillow 48921.6/50000: 98% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth
2:01.764 single R stormstrike Fluffy_Pillow 49848.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth
2:02.967 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth
2:04.170 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth
2:05.374 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
2:06.576 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
2:07.778 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_earth
2:09.015 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), ice_strike, spiraling_winds(9), forgestorm_ignited, elemental_chaos_earth
2:10.217 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), ice_strike, spiraling_winds(9), elemental_chaos_earth
2:11.420 single Z frost_shock Fluffy_Pillow 48924.8/50000: 98% mana elemental_blast_haste, forceful_winds, maelstrom_weapon(2), ice_strike, spiraling_winds(10), elemental_chaos_earth
2:12.621 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_earth
2:13.824 single b flame_shock Fluffy_Pillow 49924.8/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_earth
2:15.026 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_earth
2:16.229 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_earth
2:17.433 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:18.635 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_earth
2:19.873 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_earth
2:21.112 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_earth
2:22.351 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), spiraling_winds(3), elemental_chaos_earth
2:23.590 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(3), elemental_chaos_earth
2:24.829 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
2:26.033 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
2:27.236 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth
2:28.439 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth
2:29.641 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(6), elemental_chaos_earth
2:31.062 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth
2:32.266 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth
2:33.469 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
2:34.670 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
2:35.910 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:37.147 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:38.386 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:39.624 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:40.863 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(4), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:42.101 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(4), maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:43.340 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(4), maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:44.671 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:45.909 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:47.148 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:48.383 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:49.584 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:50.787 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:51.990 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:53.193 single W lava_lash Fluffy_Pillow 48924.8/50000: 98% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), elemental_chaos_earth
2:54.394 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), elemental_chaos_earth
2:55.596 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_earth
2:56.799 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:58.001 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:59.202 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
3:00.406 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
3:00.406 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power(20), spiraling_winds(10), elemental_chaos_earth
3:01.607 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, crumbling_power(19), spiraling_winds(10), elemental_chaos_earth
3:02.809 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(2), static_accumulation, crumbling_power(18), spiraling_winds(10), elemental_chaos_earth
3:02.809 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(2), static_accumulation, crumbling_power(18), spiraling_winds(10), elemental_chaos_earth
3:03.903 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(7), static_accumulation, doom_winds, crumbling_power(18), spiraling_winds(10), elemental_chaos_earth
3:04.997 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(5), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(17), spiraling_winds(10), elemental_chaos_earth
3:06.092 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(16), spiraling_winds(10), elemental_chaos_earth
3:07.219 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(15), spiraling_winds(10), elemental_chaos_earth
3:08.347 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(14), spiraling_winds(10), elemental_chaos_earth
3:09.473 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, doom_winds, legacy_of_the_frost_witch, crumbling_power(13), spiraling_winds(10), elemental_chaos_earth
3:10.601 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), spiraling_winds(10), elemental_chaos_earth
3:11.726 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds(10), elemental_chaos_earth
3:12.852 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(10), elemental_chaos_earth
3:13.980 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(10), elemental_chaos_earth
3:15.106 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(10), elemental_chaos_earth
3:16.345 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(10), elemental_chaos_earth
3:17.603 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(10), elemental_chaos_earth
3:18.840 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(4), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(10), elemental_chaos_earth
3:20.079 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(4), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(10), elemental_chaos_earth
3:21.315 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
3:22.555 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
3:23.793 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
3:25.032 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
3:26.268 single R stormstrike Fluffy_Pillow 49977.6/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_earth
3:27.506 single R stormstrike Fluffy_Pillow 47958.4/50000: 96% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_earth
3:28.745 single R stormstrike Fluffy_Pillow 48940.8/50000: 98% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_earth
3:29.983 single R stormstrike Fluffy_Pillow 48921.6/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_earth
3:31.221 single S elemental_blast Fluffy_Pillow 49902.4/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_earth
3:32.458 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:33.695 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:34.933 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:36.171 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:37.409 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(7), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:38.646 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:39.886 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), stormbringer, ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:41.125 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:42.363 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
3:43.601 single S elemental_blast Fluffy_Pillow 48980.8/50000: 98% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
3:44.842 single Z frost_shock Fluffy_Pillow 49591.4/50000: 99% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, forgestorm_ignited, elemental_chaos_earth
3:46.080 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_earth
3:47.321 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), elemental_chaos_earth
3:48.560 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_earth
3:49.798 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_earth
3:51.037 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:52.277 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:53.517 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:54.755 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
3:55.994 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(3), maelstrom_weapon, elemental_chaos_earth
3:57.233 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(3), elemental_chaos_earth
3:58.471 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(4), elemental_chaos_earth
3:59.710 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(5), elemental_chaos_earth
4:00.948 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
4:02.185 single R stormstrike Fluffy_Pillow 49979.2/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
4:03.421 single R stormstrike Fluffy_Pillow 49956.8/50000: 100% mana flurry(2), elemental_blast_critical_strike, stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_chaos_fire
4:04.658 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(8), legacy_of_the_frost_witch, elemental_chaos_fire
4:05.898 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_fire
4:07.137 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:08.376 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:09.615 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:10.853 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:12.090 single R stormstrike Fluffy_Pillow 49979.2/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, sophic_devotion, elemental_chaos_fire
4:13.329 single X lightning_bolt Fluffy_Pillow 49961.6/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), ice_strike, sophic_devotion, elemental_chaos_fire
4:14.567 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:15.806 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:17.043 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:18.283 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:19.523 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_fire
4:20.760 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:21.998 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:23.236 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:24.474 single Z frost_shock Fluffy_Pillow 48980.8/50000: 98% mana flurry, elemental_blast_mastery, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:25.712 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, maelstrom_weapon(5), elemental_chaos_fire
4:26.951 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, elemental_chaos_fire
4:28.189 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, stormbringer, maelstrom_weapon(2), elemental_chaos_fire
4:29.427 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, stormbringer, maelstrom_weapon(4), elemental_chaos_fire
4:30.666 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon(5), elemental_chaos_fire
4:31.904 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
4:33.141 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_fire
4:34.381 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, maelstrom_weapon(4), doom_winds, legacy_of_the_frost_witch, elemental_chaos_fire
4:35.619 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), doom_winds, legacy_of_the_frost_witch, elemental_chaos_fire
4:36.859 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds, ice_strike, elemental_chaos_fire
4:38.098 single L stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_fire
4:39.337 single L stormstrike Fluffy_Pillow 49964.8/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_fire
4:40.575 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds, ice_strike, elemental_chaos_fire
4:41.812 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
4:43.052 single R stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
4:44.293 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_fire
4:45.533 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:46.735 single X lightning_bolt Fluffy_Pillow 49923.2/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:47.938 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
4:49.140 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:50.342 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(5), elemental_chaos_fire
4:51.542 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, legacy_of_the_frost_witch, elemental_chaos_fire
4:52.745 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
4:53.947 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
4:55.150 default F feral_spirit Fluffy_Pillow 49924.8/50000: 100% mana flurry, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
4:56.390 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_fire
4:57.626 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_fire
4:58.865 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, elemental_chaos_fire

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 25.34% 21.51% 3656
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.07% 52.07% 3246
Armor 3603 3603 3603
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Phys"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&(active_dot.flame_shock<active_enemies)&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&(buff.converging_storms.stack=6|(set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5))
actions.aoe+=/lava_lash,if=buff.crash_lightning.up,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=buff.crash_lightning.up,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash,if=talent.molten_assault.enabled
actions.aoe+=/ice_strike,if=talent.swirling_maelstrom.enabled
actions.aoe+=/stormstrike
actions.aoe+=/ice_strike
actions.aoe+=/lava_lash
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8|(buff.ashen_catalyst.stack>=5&buff.maelstrom_of_elements.up&buff.maelstrom_weapon.stack<=6)
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds.up
actions.single+=/crash_lightning,if=buff.doom_winds.up
actions.single+=/ice_strike,if=buff.doom_winds.up
actions.single+=/sundering,if=buff.doom_winds.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=8
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/stormstrike,if=set_bonus.tier29_2pc&buff.maelstrom_of_elements.down&buff.maelstrom_weapon.stack<=5
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=talent.molten_assault.enabled&dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack=10)|(!talent.elemental_spirits.enabled&buff.maelstrom_weapon.stack>=5)
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/elemental_blast,if=talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)&buff.maelstrom_weapon.stack>=5
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 309074424
Max Event Queue: 405
Sim Seconds: 2250297
CPU Seconds: 440.8757
Physical Seconds: 221.9695
Speed Up: 5104

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.56sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 163733 546 7.65 3359 6768 38.2 38.2 27.1% 0.0% 0.0% 0.0% 6.91sec 163733 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 138.66sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 768477 2562 38.49 3583 7210 192.4 192.4 27.5% 16.4% 0.0% 0.0% 1.82sec 1097853 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 374733 1249 37.64 1792 3607 188.2 188.2 27.5% 16.7% 0.0% 0.0% 1.82sec 535346 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.83sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 3372331 11241 40.04 13173 26467 200.2 200.2 27.6% 0.0% 0.0% 0.0% 1.41sec 3372331 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 213288 711 0.56 59757 120007 2.9 2.8 28.2% 0.0% 0.0% 0.0% 119.64sec 213288 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 6036 20 2.33 406 819 1.1 11.6 27.2% 0.0% 0.0% 0.0% 116.33sec 6036 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 294764 983 1.38 33424 67184 6.9 6.9 27.5% 0.0% 0.0% 0.0% 47.18sec 421102 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 85.68sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 562135 1874 19.75 4457 8948 67.0 98.7 27.5% 0.0% 0.0% 0.0% 4.46sec 562135 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 241549 805 4.75 7964 15984 23.8 23.8 27.4% 0.0% 0.0% 0.0% 7.19sec 241549 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 120701 402 4.75 3983 7988 23.8 23.8 27.4% 0.0% 0.0% 0.0% 7.19sec 120701 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 62.05sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 1972305 6574 13.40 23032 46284 67.0 67.0 27.5% 0.0% 0.0% 0.0% 4.46sec 1972305 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 413266 1378 13.37 4836 9722 66.9 66.9 27.5% 0.0% 0.0% 0.0% 4.47sec 413266 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 458349 1528 12.78 5611 11290 63.9 63.9 27.5% 0.0% 0.0% 0.0% 4.64sec 654801 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 229065 764 12.78 2805 5648 63.9 63.9 27.4% 0.0% 0.0% 0.0% 4.64sec 327245 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1211379 4038 8.72 0 27796 43.6 43.6 100.0% 0.0% 0.0% 0.0% 6.79sec 1211379 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 605690 2019 8.72 0 13898 43.6 43.6 100.0% 0.0% 0.0% 0.0% 6.79sec 605690 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 7.9 0.0 0.0% 0.0% 0.0% 0.0% 39.76sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 306.79sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.70sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 20.61sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1583228 5277 48.95 5054 10179 244.8 244.8 27.6% 0.0% 0.0% 0.0% 1.22sec 1583228 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 59969 200 4.06 2314 4650 20.3 20.3 27.5% 0.0% 0.0% 0.0% 14.34sec 85672 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 60175 201 4.07 2314 4651 20.3 20.3 27.6% 0.0% 0.0% 0.0% 14.35sec 85967 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.3 0.0 0.0% 0.0% 0.0% 0.0% 14.31sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 98070 599 19.22 1466 2934 52.5 52.5 27.4% 0.0% 0.0% 0.0% 5.36sec 140104 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 200 1 1.07 54 108 2.9 2.9 27.0% 0.0% 0.0% 0.0% 120.70sec 286 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul main_hand 0 199968 1221 34.92 1643 3286 95.3 95.3 27.7% 0.0% 0.0% 0.0% 2.90sec 285675 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.70sec 0 163.79sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 63515 212 1.39 7859 15785 6.9 6.9 16.4% 0.0% 0.0% 0.0% 45.71sec 63515 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 833060 2777 30.71 4663 9373 153.5 153.5 16.2% 0.0% 0.0% 0.0% 2.35sec 1190116 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.66sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 57422 191 1.40 7064 14200 7.0 7.0 16.3% 0.0% 0.0% 0.0% 45.86sec 57422 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1378197 4594 19.89 11905 23920 99.5 99.5 16.2% 0.0% 0.0% 0.0% 2.99sec 1378197 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 406616 1355 27.08 3003 0 0.0 135.4 0.0% 0.0% 0.0% 0.0% 0.00sec 406616 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 216975 723 1.11 33627 67585 5.5 5.5 16.3% 0.0% 0.0% 0.0% 46.88sec 309972 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 167.98sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 333752 1113 5.26 10898 21919 26.3 26.3 16.3% 0.0% 0.0% 0.0% 11.06sec 476801 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 538835 1796 21.17 4371 8785 105.8 105.8 16.3% 0.0% 0.0% 0.0% 3.46sec 538835 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 23494 78 2.32 1736 3493 11.6 11.6 16.2% 0.0% 0.0% 0.0% 27.04sec 23494 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.66sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike 55090 299050 997 15.82 3246 6527 79.1 79.1 16.3% 0.0% 0.0% 0.0% 3.69sec 427225 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike_shadow 70890 396550 1322 15.82 4307 8652 0.0 79.1 16.2% 0.0% 0.0% 0.0% 0.00sec 396550 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy solved_the_puzzle 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.90sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 144256 481 3.12 7960 15968 15.6 15.6 16.2% 0.0% 0.0% 0.0% 6.91sec 144256 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 691951 2307 3.11 38208 76820 15.6 15.6 16.1% 0.0% 0.0% 0.0% 6.91sec 691951 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.64sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 58954 197 0.73 13929 28021 3.6 3.6 16.0% 0.0% 0.0% 0.0% 91.67sec 58954 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_pact 319236 382678 1276 24.55 2679 5380 122.8 122.8 16.2% 0.0% 0.0% 0.0% 2.65sec 382678 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 21.7 0.0 0.0% 0.0% 0.0% 0.0% 13.45sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 251534 838 19.90 2172 4364 11.6 99.5 16.3% 0.0% 0.0% 0.0% 27.04sec 251534 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 89157 297 7.58 2026 4047 37.9 37.9 16.2% 0.0% 0.0% 0.0% 7.84sec 127371 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 29 0 0.07 69 139 0.4 0.4 16.0% 0.0% 0.0% 0.0% 90.09sec 41 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul main_hand 0 1231799 4106 38.66 5481 10966 193.3 193.3 16.3% 0.0% 0.0% 0.0% 1.54sec 1759757 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul monstrous_blow 91797 9016 30 0.66 2334 4673 3.3 3.3 16.4% 0.0% 0.0% 0.0% 91.13sec 12880 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul spawn_travel 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 395197 1317 13.79 4932 9849 69.0 69.0 16.3% 0.0% 0.0% 0.0% 4.24sec 395197 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1571779 31436 48.54 33423 66784 40.4 40.4 16.3% 0.0% 0.0% 0.0% 5.16sec 1571779 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.64sec 0 50.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_risen_skulker skulker_shot 212423 339178 1131 31.02 1881 3757 155.2 155.1 16.3% 0.0% 0.0% 0.0% 1.93sec 484552 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 262129 4467 220.16 1048 2093 215.3 215.3 16.2% 0.0% 0.0% 0.0% 1.00sec 374479 58.68sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1338134 22805 361.90 3254 6505 353.9 353.9 16.2% 0.0% 0.0% 0.0% 0.60sec 1911669 58.68sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.64sec 0 58.68sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.90sec 0 59.01sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.77sec 0 59.45sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.77sec 0 59.86sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 351178 3640 25.89 7265 14508 41.6 41.6 16.2% 0.0% 0.0% 0.0% 7.11sec 351178 96.47sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 830254 8606 61.40 7238 14448 98.8 98.7 16.2% 0.0% 0.0% 0.0% 2.94sec 830254 96.47sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.77sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.77sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.77sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.76sec 0 60.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 217746 1624 88.23 951 1899 197.2 197.2 16.2% 0.0% 0.0% 0.0% 1.43sec 311074 134.08sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 951384 7096 125.28 2925 5842 280.0 280.0 16.2% 0.0% 0.0% 0.0% 1.00sec 1359154 134.08sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.91sec 0 134.08sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 45.79sec 0 134.44sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.82sec 0 134.24sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 45.99sec 0 133.53sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.42sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow dark_ascension 391109 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.80sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 1243665 4146 9.61 21223 45333 48.0 48.0 19.4% 0.0% 0.0% 0.0% 6.24sec 2908273 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 1664608 5549 25.09 11171 22933 48.0 125.4 17.8% 0.0% 0.0% 0.0% 6.24sec 2908273 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 173.5 0.0 0.0% 0.0% 0.0% 0.0% 1.72sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo 120644 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 80.57sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_heal 390971 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 80.57sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_damage 390964 87580 292 0.71 21137 44443 3.6 3.5 15.5% 0.0% 0.0% 0.0% 80.57sec 87580 300.00sec
PR_Priest_Shadow PR_Priest_Shadow idol_of_cthun 377349 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_void_tendril mind_flay ticks -193473 840914 2803 29.08 4972 10058 19.4 145.4 15.9% 0.0% 0.0% 0.0% 14.04sec 840914 19.54sec
PR_Priest_Shadow PR_Priest_Shadow mental_fortitude 377065 139451 465 67.11 416 0 324.8 335.6 0.0% 0.0% 0.0% 0.0% 0.91sec 6725242 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 1475395 4918 12.39 19143 40590 62.0 62.0 21.7% 0.0% 0.0% 0.0% 4.82sec 1475395 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay ticks -15407 158652 529 6.44 4324 8716 5.4 32.2 13.7% 0.0% 0.0% 0.0% 45.76sec 158652 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay_insanity ticks -391403 1741783 5806 28.62 10411 21213 35.9 143.1 16.3% 0.0% 0.0% 0.0% 8.13sec 1741783 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 199377 665 1.56 22192 46462 7.8 7.8 14.0% 0.0% 0.0% 0.0% 29.61sec 199377 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.88sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames 375901 366941 1223 1.35 43614 96358 6.7 6.7 20.6% 0.0% 0.0% 0.0% 46.63sec 366941 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames_damage_reversal 323706 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 46.63sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 309.01sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow power_infusion 10060 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.61sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 35.48sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_damage 205386 321906 1073 1.78 30205 64068 8.9 8.9 17.4% 0.0% 0.0% 0.0% 35.29sec 321906 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_dots 391286 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 35.48sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 197010 657 25.91 1521 0 130.6 129.5 0.0% 0.0% 0.0% 0.0% 2.24sec 197010 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 345468 1152 2.33 24439 50226 11.7 11.7 20.2% 0.0% 0.0% 0.0% 26.79sec 345468 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 88786 296 2.31 5040 18423 11.7 11.6 19.7% 0.0% 0.0% 0.0% 26.79sec 235575 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain ticks -589 917396 3058 50.79 3050 6242 17.5 253.9 17.6% 0.0% 0.0% 0.0% 17.52sec 917396 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparitions 341491 0 0 0.00 0 0 109.8 0.0 0.0% 0.0% 0.0% 0.0% 2.72sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparition 148859 387764 1293 21.27 3647 0 108.1 106.3 0.0% 0.0% 0.0% 0.0% 2.71sec 387764 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 375247 1251 17.25 4352 0 7.2 86.2 0.0% 0.0% 0.0% 0.0% 37.47sec 375247 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.37sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 1095910 3653 33.34 5553 11361 17.5 166.7 17.6% 0.0% 0.0% 0.0% 17.52sec 1095910 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 166.7 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow void_torrent ticks -263165 801687 2672 5.66 22887 46432 4.7 28.3 23.1% 0.0% 0.0% 0.0% 68.27sec 801687 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment 373427 0 0 0.00 0 0 41.1 0.0 0.0% 0.0% 0.0% 0.0% 7.11sec 0 137.63sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment_damage 373442 850116 6177 17.92 16431 34158 41.1 41.1 24.0% 0.0% 0.0% 0.0% 7.11sec 850116 137.63sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender melee 0 719885 5231 56.94 4478 9096 130.6 130.6 22.4% 0.0% 0.0% 0.0% 2.24sec 719885 137.63sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 309.92sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2409568 8032 4.18 94946 190680 20.9 20.9 21.1% 0.0% 0.0% 0.0% 14.23sec 2409568 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 30.07sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 603011 2010 16.78 6115 12282 83.9 83.9 17.4% 0.0% 0.0% 0.0% 3.57sec 1418686 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 815675 2719 38.44 3611 7254 83.9 192.2 17.4% 0.0% 0.0% 0.0% 3.57sec 1418686 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 277138 924 135.32 348 700 676.6 676.6 17.4% 0.0% 0.0% 0.0% 0.72sec 277138 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 327715 1092 5.68 9805 19714 28.4 28.4 17.4% 0.0% 0.0% 0.0% 7.72sec 327715 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 1574071 5247 7.97 33620 67231 39.8 39.8 17.5% 0.0% 0.0% 0.0% 7.51sec 1574071 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 564216 1881 4.91 19596 39305 24.5 24.5 17.3% 0.0% 0.0% 0.0% 12.35sec 564216 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 2756552 9189 13.57 34550 69362 67.9 67.9 17.4% 0.0% 0.0% 0.0% 4.37sec 2756552 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 996762 3323 3.25 50442 101049 16.3 16.3 21.5% 0.0% 0.0% 0.0% 18.74sec 996762 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 0 519120 1730 38.66 2653 5332 193.3 193.3 17.4% 16.4% 0.0% 0.0% 1.81sec 741619 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 1 259912 866 38.68 1328 2670 193.4 193.4 17.4% 16.4% 0.0% 0.0% 1.80sec 371313 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.65sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement primordial_wave 375982 48628 162 1.41 5884 11871 7.0 7.0 17.3% 0.0% 0.0% 0.0% 45.72sec 48628 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_pw 188196 806176 2687 1.40 94998 190892 7.0 7.0 21.1% 0.0% 0.0% 0.0% 45.90sec 806176 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 51.6 0.0 0.0% 0.0% 0.0% 0.0% 5.75sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 390940 1303 10.32 6443 12936 51.6 51.6 17.4% 0.0% 0.0% 0.0% 5.75sec 558500 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 195491 652 10.32 3220 6479 51.6 51.6 17.4% 0.0% 0.0% 0.0% 5.75sec 279281 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 232968 777 1.15 34481 69229 5.7 5.7 17.6% 0.0% 0.0% 0.0% 53.70sec 232968 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 214324 714 30.36 1201 2414 151.8 151.8 17.4% 0.0% 0.0% 0.0% 4.06sec 306184 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 25738 415 38.77 547 1094 40.1 40.1 17.4% 0.0% 0.0% 0.0% 2.27sec 36769 61.98sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_fiery_wolf melee 0 200461 3898 104.02 1916 3824 89.2 89.2 17.4% 0.0% 0.0% 0.0% 3.41sec 286381 51.43sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_frost_wolf melee 0 200806 3875 103.38 1915 3825 89.3 89.3 17.5% 0.0% 0.0% 0.0% 3.42sec 286873 51.82sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_lightning_wolf melee 0 199832 5267 141.43 1904 3803 89.4 89.4 17.4% 0.0% 0.0% 0.0% 3.42sec 285481 37.94sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_dre 114051 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 30.48sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_damage_dre 344548 302566 1009 1.66 30465 61288 8.3 8.3 19.2% 0.0% 0.0% 0.0% 30.48sec 302566 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba doom_winds 384352 23320 78 0.75 6248 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.41sec 33315 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 308.59sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba elemental_blast 117014 2069565 6899 5.02 68039 136489 25.1 25.1 21.0% 0.0% 0.0% 0.0% 11.75sec 2069565 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba feral_spirit 51533 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 21.11sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock 188389 95541 318 5.99 2711 5447 30.0 30.0 17.4% 0.0% 0.0% 0.0% 9.87sec 449221 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock ticks -188389 353680 1179 37.36 1611 3234 30.0 186.8 17.4% 0.0% 0.0% 0.0% 9.87sec 449221 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_attack 10444 444683 1482 225.70 336 674 1128.5 1128.5 17.3% 0.0% 0.0% 0.0% 0.67sec 444683 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba forgestorm_ignited_damage 381700 332730 1109 5.77 9807 19716 28.9 28.9 17.4% 0.0% 0.0% 0.0% 7.59sec 332730 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba frost_shock 196840 302637 1009 3.31 15552 31255 16.6 16.6 17.3% 0.0% 0.0% 0.0% 16.95sec 302637 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ice_strike 342240 411258 1371 4.04 17346 34781 20.2 20.2 17.4% 0.0% 0.0% 0.0% 14.97sec 411258 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lava_lash 60103 394528 1315 3.71 18076 36259 18.6 18.6 17.5% 0.0% 0.0% 0.0% 15.78sec 394528 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt 188196 833949 2780 3.34 41011 82513 16.7 16.7 21.6% 0.0% 0.0% 0.0% 16.90sec 833949 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba main_hand 0 434414 1448 32.62 2633 5290 163.1 163.1 17.4% 16.4% 0.0% 0.0% 2.15sec 620607 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba offhand 1 222717 742 33.36 1318 2650 166.8 166.8 17.4% 16.3% 0.0% 0.0% 2.09sec 318175 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike 17364 0 0 0.00 0 0 92.0 0.0 0.0% 0.0% 0.0% 0.0% 3.25sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_mh 32175 1212783 4043 24.53 8414 16920 122.7 122.7 17.3% 0.0% 0.0% 0.0% 3.25sec 1732591 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_mh 390287 287172 957 12.22 4702 0 61.1 61.1 0.0% 0.0% 0.0% 0.0% 5.48sec 287172 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_offhand 32176 606736 2022 24.53 4208 8454 122.7 122.7 17.4% 0.0% 0.0% 0.0% 3.25sec 866788 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_offhand 390287 143641 479 12.22 2352 0 61.1 61.1 0.0% 0.0% 0.0% 0.0% 5.48sec 143641 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba sundering 197214 298230 994 1.28 39894 79853 6.4 6.4 17.1% 0.0% 0.0% 0.0% 49.36sec 298230 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_attack 25504 2028833 6763 83.41 4145 8320 417.0 417.0 17.2% 0.0% 0.0% 0.0% 2.40sec 2898407 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash 114089 152782 509 6.70 3760 7552 33.5 33.5 21.1% 0.0% 0.0% 0.0% 8.41sec 152782 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash_offhand 114093 88562 295 7.76 1881 3778 38.8 38.8 21.2% 0.0% 0.0% 0.0% 7.28sec 88562 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike 115356 0 0 0.00 0 0 27.4 0.0 0.0% 0.0% 0.0% 0.0% 8.59sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_mh 115357 548246 1827 7.27 12861 25788 36.4 36.4 17.2% 0.0% 0.0% 0.0% 8.59sec 548246 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_mh 390287 99035 330 2.48 7985 0 12.4 12.4 0.0% 0.0% 0.0% 0.0% 18.43sec 99035 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_offhand 115360 274249 914 7.27 6428 12920 36.4 36.4 17.2% 0.0% 0.0% 0.0% 8.59sec 274249 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_offhand 390287 49523 165 2.48 3993 0 12.4 12.4 0.0% 0.0% 0.0% 0.0% 18.43sec 49523 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt_ti 188196 1062960 3543 5.47 32044 64276 27.4 27.4 21.1% 0.0% 0.0% 0.0% 8.59sec 1062960 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_greater_earth_elemental melee 0 25817 413 39.36 536 1071 41.0 41.0 17.5% 0.0% 0.0% 0.0% 2.45sec 36882 62.52sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_spirit_wolf melee 0 811260 7372 201.82 1869 3735 370.1 370.1 17.3% 0.0% 0.0% 0.0% 1.61sec 1158972 110.04sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.43sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance_damage 344548 95979 320 0.40 40335 80854 2.0 2.0 18.9% 0.0% 0.0% 0.0% 180.43sec 95979 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.70sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys doom_winds 384352 22916 76 0.74 6154 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.47sec 32737 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 306.44sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys elemental_blast 117014 1935050 6450 4.95 64689 130033 24.7 24.7 20.7% 0.0% 0.0% 0.0% 11.69sec 1935050 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys feral_spirit 51533 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 24.02sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock 188389 103858 346 6.58 2687 5395 32.9 32.9 17.3% 0.0% 0.0% 0.0% 8.83sec 450478 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock ticks -188389 346620 1155 36.62 1612 3235 32.9 183.1 17.3% 0.0% 0.0% 0.0% 8.83sec 450478 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_attack 10444 434410 1448 216.78 342 685 1083.9 1083.9 17.2% 0.0% 0.0% 0.0% 0.69sec 434410 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys forgestorm_ignited_damage 381700 330634 1102 5.74 9806 19713 28.7 28.7 17.3% 0.0% 0.0% 0.0% 7.61sec 330634 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys frost_shock 196840 356971 1190 4.00 15168 30468 20.0 20.0 17.4% 0.0% 0.0% 0.0% 13.79sec 356971 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ice_strike 342240 430030 1433 4.24 17250 34663 21.2 21.2 17.4% 0.0% 0.0% 0.0% 14.13sec 430030 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lava_lash 60103 401566 1339 3.82 17904 35967 19.1 19.1 17.4% 0.0% 0.0% 0.0% 14.97sec 401566 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt 188196 884280 2948 3.63 40049 80263 18.1 18.1 21.7% 0.0% 0.0% 0.0% 15.37sec 884280 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys main_hand 0 449483 1498 34.42 2582 5189 172.1 172.1 17.4% 16.4% 0.0% 0.0% 1.93sec 642134 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys offhand 1 227542 758 34.76 1295 2604 173.8 173.8 17.3% 16.4% 0.0% 0.0% 2.01sec 325069 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike 17364 0 0 0.00 0 0 88.6 0.0 0.0% 0.0% 0.0% 0.0% 3.21sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_mh 32175 1116590 3722 23.61 8046 16174 118.0 118.0 17.4% 0.0% 0.0% 0.0% 3.21sec 1595169 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_mh 390287 259202 864 11.59 4471 0 58.0 58.0 0.0% 0.0% 0.0% 0.0% 5.47sec 259202 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_offhand 32176 558440 1861 23.61 4022 8094 118.0 118.0 17.4% 0.0% 0.0% 0.0% 3.21sec 797791 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_offhand 390287 129587 432 11.59 2235 0 58.0 58.0 0.0% 0.0% 0.0% 0.0% 5.47sec 129587 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys sundering 197214 296558 989 1.31 38503 77704 6.5 6.5 17.3% 0.0% 0.0% 0.0% 46.68sec 296558 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_attack 25504 2048779 6829 81.72 4283 8552 408.6 408.6 17.1% 0.0% 0.0% 0.0% 2.45sec 2926901 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash 114089 132550 442 4.80 4569 9195 24.0 24.0 20.6% 0.0% 0.0% 0.0% 10.20sec 132550 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash_offhand 114093 69821 233 5.04 2289 4603 25.2 25.2 20.8% 0.0% 0.0% 0.0% 9.69sec 69821 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike 115356 0 0 0.00 0 0 20.3 0.0 0.0% 0.0% 0.0% 0.0% 10.01sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_mh 115357 533734 1779 5.40 16904 34146 27.0 27.0 16.6% 0.0% 0.0% 0.0% 10.01sec 533734 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_mh 390287 119494 398 2.32 10287 0 11.6 11.6 0.0% 0.0% 0.0% 0.0% 17.84sec 119494 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_offhand 115360 267180 891 5.40 8460 16988 27.0 27.0 16.8% 0.0% 0.0% 0.0% 10.01sec 267180 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_offhand 390287 59891 200 2.32 5156 0 11.6 11.6 0.0% 0.0% 0.0% 0.0% 17.84sec 59891 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt_ti 188196 961873 3206 4.05 39295 78928 20.3 20.3 20.7% 0.0% 0.0% 0.0% 10.01sec 961873 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_greater_earth_elemental melee 0 24839 402 38.23 537 1074 39.4 39.4 17.4% 0.0% 0.0% 0.0% 2.39sec 35485 61.84sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_spirit_wolf melee 0 770739 7988 212.87 1921 3834 342.3 342.3 17.3% 0.0% 0.0% 0.0% 1.73sec 1101083 96.48sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
268052.1 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.4sec 18.8sec 5.5sec 22.94% 23.10% 2.2 (2.2) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.1s / 210.0s
  • trigger_min/max:0.9s / 210.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:22.94%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3sec 18.8sec 5.5sec 23.16% 23.37% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 189.0s
  • trigger_min/max:3.0s / 189.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.16%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_death_check) 9.3 2.3 34.0sec 26.8sec 7.2sec 22.59% 0.00% 2.3 (2.3) 9.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_death_check
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.4s / 70.1s
  • trigger_min/max:0.9s / 70.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s

Stack Uptimes

  • death_and_madness_death_check_1:22.59%

Spelldata

  • id:322098
  • name:Death and Madness
  • tooltip:If the target dies within {$d=7 seconds}, the Priest gains {$321291m2=20} Insanity.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.0 119.4 141.7sec 2.5sec 284.0sec 98.65% 0.00% 110.0 (110.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.1s / 327.1s
  • trigger_min/max:0.0s / 17.7s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 356.9s

Stack Uptimes

  • death_rot_1:0.32%
  • death_rot_2:0.82%
  • death_rot_3:0.43%
  • death_rot_4:0.50%
  • death_rot_5:0.42%
  • death_rot_6:0.58%
  • death_rot_7:0.48%
  • death_rot_8:0.54%
  • death_rot_9:0.46%
  • death_rot_10:94.10%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 4.5 240.3 73.3sec 1.2sec 65.7sec 97.98% 98.15% 200.9 (200.9) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 347.8s
  • trigger_min/max:0.0s / 16.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.1s

Stack Uptimes

  • everfrost_1:1.49%
  • everfrost_2:1.49%
  • everfrost_3:1.48%
  • everfrost_4:1.47%
  • everfrost_5:1.47%
  • everfrost_6:1.46%
  • everfrost_7:1.45%
  • everfrost_8:1.45%
  • everfrost_9:1.44%
  • everfrost_10:84.79%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 18.0 44.0 16.4sec 4.8sec 14.4sec 86.71% 99.05% 5.2 (5.6) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 146.2s
  • trigger_min/max:0.0s / 27.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 144.5s

Stack Uptimes

  • festering_wound_1:17.86%
  • festering_wound_2:22.40%
  • festering_wound_3:18.38%
  • festering_wound_4:11.67%
  • festering_wound_5:8.24%
  • festering_wound_6:8.16%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 66.9 5.9sec 4.4sec 295.4sec 98.44% 98.18% 66.9 (66.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 5.9s
  • trigger_min/max:0.8s / 15.7s
  • trigger_pct:100.00%
  • duration_min/max:232.5s / 359.0s

Stack Uptimes

  • lashing_flames_1:98.44%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 65.8 189.0sec 4.5sec 289.1sec 99.20% 0.00% 61.7 (61.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 352.7s
  • trigger_min/max:0.9s / 43.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 357.9s

Stack Uptimes

  • razorice_1:0.99%
  • razorice_2:0.79%
  • razorice_3:0.90%
  • razorice_4:0.84%
  • razorice_5:95.67%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 271712.54
Minimum 250945.91
Maximum 301289.79
Spread ( max - min ) 50343.87
Range [ ( max - min ) / 2 * 100% ] 9.26%
Standard Deviation 6868.2074
5th Percentile 260699.93
95th Percentile 283149.79
( 95th Percentile - 5th Percentile ) 22449.86
Mean Distribution
Standard Deviation 79.3125
95.00% Confidence Interval ( 271557.09 - 271867.99 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2455
0.1 Scale Factor Error with Delta=300 402690
0.05 Scale Factor Error with Delta=300 1610759
0.01 Scale Factor Error with Delta=300 40268966
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3787
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 96755569 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.