SimulationCraft has not been built with PTR data.  The 'ptr=' option is ignored.

SimulationCraft 1002-01

for World of Warcraft 10.0.2.46924 Live (hotfix 2022-12-07/46924, git build 7e667d84ef)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 45440 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45440.0 45440.0 52.4 / 0.115% 9008.6 / 19.8% 3548.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.5 12.8 Runic Power 7.20% 49.8 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 45440
Abomination Limb 0 (582) 0.0% (1.3%) 3.0 120.53sec 57778 46556

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2412 0.0000 0.00 0.00 0.00% 46556.26 46556.26

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [Z]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [a]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 582 1.3% 38.2 6.91sec 4521 0 Direct 38.2 3577 7186 4521 26.1% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.25 38.25 0.00 0.00 0.00 0.0000 0.0000 172909.96 172909.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.86% 28.25 14 38 3577.34 2324 6779 3577.61 2913 4318 101054 101054 0.00%
crit 26.14% 10.00 1 21 7186.31 4647 13558 7186.37 4958 10428 71856 71856 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2703 5.9% 189.3 1.85sec 4281 2330 Direct 189.3 3885 7781 4281 26.5% 16.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.27 189.27 0.00 0.00 0.00 1.8370 0.0000 810251.32 1157531.39 30.00% 2330.38 2330.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.09% 108.06 67 150 3885.01 2482 7514 3885.58 3612 4226 419819 599756 30.00%
crit 26.51% 50.18 24 81 7781.41 4964 15028 7781.41 6892 9025 390433 557775 30.00%
miss 16.40% 31.03 9 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1317 2.9% 185.1 1.85sec 2134 1162 Direct 185.1 1942 3888 2134 26.5% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 185.06 185.06 0.00 0.00 0.00 1.8370 0.0000 394884.07 564134.48 30.00% 1161.62 1161.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.76% 105.05 64 151 1941.73 1241 3757 1942.11 1794 2101 203970 291394 30.00%
crit 26.53% 49.10 23 80 3888.47 2482 7514 3888.78 3430 4445 190914 272741 30.00%
miss 16.70% 30.91 12 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Breath of Sindragosa 0 (11702) 0.0% (25.8%) 2.9 120.65sec 1191957 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [d]:2.94
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 11702 25.8% 196.3 1.43sec 17872 0 Direct 196.3 14100 28201 17872 26.8% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 196.25 196.25 0.00 0.00 0.00 0.0000 0.0000 3507524.25 3507524.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.25% 143.75 68 223 14100.16 8053 28373 14115.35 13081 15415 2026937 2026937 0.00%
crit 26.75% 52.50 16 94 28200.69 16105 58394 28232.38 24886 32066 1480587 1480587 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 685 1.5% 2.9 119.58sec 69763 0 Direct 2.8 58396 116483 73948 26.8% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.78 0.00 0.00 0.00 0.0000 0.0000 205503.02 205503.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.22% 2.03 0 3 58395.56 22015 66044 56583.39 0 66044 118824 118824 0.00%
crit 26.78% 0.74 0 3 116483.00 44029 132088 67252.37 0 132088 86679 86679 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 22 0.0% 1.1 117.63sec 6091 4577 Direct 11.7 445 891 564 26.7% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.08 11.69 0.00 0.00 0.00 1.3309 0.0000 6590.18 6590.18 0.00% 4576.51 4576.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.30% 8.57 0 30 444.80 317 749 335.16 0 621 3810 3810 0.00%
crit 26.70% 3.12 0 20 891.16 635 1499 656.66 0 1307 2780 2780 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [R]:1.08
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 1164 2.6% 8.3 29.30sec 42037 0 Direct 8.3 33171 66341 42070 26.8% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.31 8.30 0.00 0.00 0.00 0.0000 0.0000 349223.47 498903.39 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.17% 6.07 1 9 33170.70 33171 33171 33170.70 33171 33171 201475 287828 30.00%
crit 26.83% 2.23 0 8 66341.40 66341 66341 61113.00 0 66341 147749 211075 27.64%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 1984 4.4% 66.2 4.51sec 8988 0 Periodic 98.7 4765 9532 6029 26.5% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.24 0.00 98.73 98.73 65.23 0.0000 2.9999 595294.26 595294.26 0.00% 2009.84 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 73.49% 72.56 47 103 4765.42 31 10287 4765.53 4393 5114 345762 345762 0.00%
crit 26.51% 26.18 10 48 9532.28 252 20108 9532.58 8057 11128 249532 249532 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 887 (1331) 2.0% (2.9%) 24.7 7.13sec 16232 12083 Direct 24.7 (49.4) 8560 17124 10819 26.4% (26.4%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.71 24.71 0.00 0.00 0.00 1.3434 0.0000 267288.02 267288.02 0.00% 12083.45 12083.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.62% 18.19 1 46 8560.22 5441 14198 8532.65 6965 10671 155695 155695 0.00%
crit 26.38% 6.52 0 20 17123.73 11066 28472 16978.89 0 25353 111593 111593 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:25.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [C]:14.34
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [i]:3.28
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [m]:7.08
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 444 1.0% 24.7 7.13sec 5413 0 Direct 24.7 4280 8561 5413 26.5% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.71 24.71 0.00 0.00 0.00 0.0000 0.0000 133737.53 133737.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.53% 18.17 1 45 4280.18 2721 7118 4266.61 3319 6017 77754 77754 0.00%
crit 26.47% 6.54 0 20 8561.47 5441 14198 8501.81 0 11491 55983 55983 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 6878 (8321) 15.1% (18.3%) 66.2 4.51sec 37627 30600 Direct 66.2 (132.3) 24574 49186 31101 26.5% (26.6%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.24 66.24 0.00 0.00 0.00 1.2296 0.0000 2059975.10 2059975.10 0.00% 30600.16 30600.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.48% 48.67 25 73 24574.28 4294 52344 24576.73 22104 27192 1196043 1196043 0.00%
crit 26.52% 17.56 5 35 49186.00 8588 101057 49189.16 38554 60697 863932 863932 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [N]:49.30
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [S]:0.56
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [U]:0.70
  • if_expr:buff.rime.react
    single_target
    [h]:15.68
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1443 3.2% 66.1 4.52sec 6541 0 Direct 66.1 5164 10318 6541 26.7% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.08 66.08 0.00 0.00 0.00 0.0000 0.0000 432254.76 432254.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.28% 48.43 26 72 5163.51 2773 11000 5164.74 4686 5855 250045 250045 0.00%
crit 26.72% 17.66 3 35 10318.34 5547 20755 10318.93 8376 12729 182209 182209 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1653 (8663) 3.6% (19.1%) 64.4 4.60sec 40310 19845 Direct 64.4 (212.3) 6077 12164 7691 26.5% (55.4%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.41 64.41 0.00 0.00 0.00 2.0312 0.0000 495321.99 707620.89 30.00% 19845.20 19845.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.50% 47.34 20 73 6077.46 3943 12103 6081.05 5443 6719 287689 410995 30.00%
crit 26.50% 17.07 3 37 12164.40 7886 24206 12166.49 9249 15633 207633 296625 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [P]:23.78
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Q]:46.99
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [T]:9.26
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [g]:11.44
  • if_expr:!variable.pooling_runes&buff.killing_machine.react
    single_target
    [j]:14.67
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 827 1.8% 64.4 4.60sec 3846 0 Direct 64.4 3038 6084 3846 26.5% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.41 64.41 0.00 0.00 0.00 0.0000 0.0000 247724.65 353901.39 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.47% 47.32 21 74 3038.35 1971 6051 3040.12 2750 3402 143781 205407 30.00%
crit 26.53% 17.08 3 34 6084.28 3943 12103 6085.87 4573 7845 103944 148495 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 4122 9.1% 41.7 7.08sec 29602 0 Direct 41.7 0 29602 29602 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.73 41.73 0.00 0.00 0.00 0.0000 0.0000 1235441.00 1235441.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 41.73 22 63 29602.31 16073 61523 29592.85 26460 33479 1235441 1235441 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2061 4.5% 41.7 7.08sec 14801 0 Direct 41.7 0 14801 14801 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.73 41.73 0.00 0.00 0.00 0.0000 0.0000 617720.50 617720.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 41.73 22 63 14801.16 8036 30761 14796.43 13230 16740 617720 617720 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (5515) 0.0% (12.1%) 15.0 20.59sec 110114 87314

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.01 0.00 0.00 0.00 0.00 1.2612 0.0000 0.00 0.00 0.00% 87313.83 87313.83

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [M]:9.41
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [f]:5.61
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5515 12.1% 243.2 1.23sec 6798 0 Direct 243.2 5370 10762 6798 26.5% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 243.15 243.15 0.00 0.00 0.00 0.0000 0.0000 1653025.36 1653025.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.50% 178.73 121 241 5369.55 1112 14121 5368.37 4638 6053 959675 959675 0.00%
crit 26.50% 64.43 33 102 10762.25 2224 28884 10758.63 8086 13067 693351 693351 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 195 0.4% 20.1 14.46sec 2907 0 Direct 20.1 2296 4593 2907 26.6% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.14 20.14 0.00 0.00 0.00 0.0000 0.0000 58534.70 83623.13 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.42% 14.78 4 31 2296.31 2296 2296 2296.31 2296 2296 33950 48501 30.00%
crit 26.58% 5.35 0 15 4592.63 4593 4593 4574.87 0 4593 24585 35122 29.89%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 195 0.4% 20.2 14.44sec 2905 0 Direct 20.2 2296 4593 2905 26.5% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.16 20.16 0.00 0.00 0.00 0.0000 0.0000 58565.32 83666.87 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.50% 14.82 4 30 2296.31 2296 2296 2296.31 2296 2296 34029 48615 30.00%
crit 26.50% 5.34 0 16 4592.63 4593 4593 4570.58 0 4593 24536 35052 29.86%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 1944 / 1061
Claw 641 0.8% 52.3 5.39sec 2004 2004 Direct 52.3 1582 3168 2004 26.6% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.27 52.27 0.00 0.00 0.00 1.0000 0.0000 104753.95 149652.32 30.00% 2004.13 2004.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.38% 38.36 19 52 1582.01 999 3011 1583.93 1429 1792 60683 86692 30.00%
crit 26.62% 13.91 3 28 3167.92 1998 6023 3171.25 2464 3968 44071 62961 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.27
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.68sec 72 72 Direct 2.9 57 115 72 25.5% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.00 1.0000 0.0000 210.34 300.49 30.00% 71.89 71.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.48% 2.18 0 3 57.22 37 80 56.07 0 75 125 178 29.39%
crit 25.52% 0.75 0 3 114.59 71 155 66.33 0 155 86 122 17.36%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.93
main_hand 1302 1.6% 94.6 2.93sec 2250 1444 Direct 94.6 1776 3554 2250 26.7% 0.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.59 94.59 0.00 0.00 0.00 1.5584 0.0000 212852.71 304083.05 30.00% 1444.01 1444.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.33% 69.36 40 90 1776.09 1110 3308 1778.59 1606 1982 123191 175992 30.00%
crit 26.67% 25.23 7 44 3554.31 2220 6541 3559.50 2939 4318 89662 128092 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 2.1 138.50sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.00 1.2953 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [V]:1.45
  • if_expr:runic_power<60
    single_target
    [l]:0.62
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 85.54sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [X]:0.37
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [Y]:3.58
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.8 62.46sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.83 0.00 0.00 0.00 0.00 1.2307 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [O]:4.43
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [k]:0.40
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 7.9 40.10sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.85 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [b]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [c]:7.53
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.4 307.15sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [W]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.68sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [e]:2.98
Unholy Strength 20.1 14.48sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.13 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5sec 120.5sec 11.8sec 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 124.5s
  • trigger_min/max:120.0s / 124.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 12.2 29.6 25.0sec 7.1sec 19.2sec 77.75% 0.00% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 73.7s
  • trigger_min/max:0.9s / 50.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.7s

Stack Uptimes

  • bonegrinder_crit_1:25.48%
  • bonegrinder_crit_2:18.98%
  • bonegrinder_crit_3:14.07%
  • bonegrinder_crit_4:10.78%
  • bonegrinder_crit_5:8.45%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 3.6 0.0 70.7sec 70.7sec 9.8sec 11.73% 37.35% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.4s / 317.3s
  • trigger_min/max:11.4s / 317.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • bonegrinder_frost_1:11.73%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.9 13.7 120.5sec 15.9sec 19.4sec 19.17% 0.00% 1.3 (1.3) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 132.2s
  • trigger_min/max:0.0s / 115.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:1.47%
  • bound_by_fire_and_blaze_2:4.41%
  • bound_by_fire_and_blaze_3:4.27%
  • bound_by_fire_and_blaze_4:3.72%
  • bound_by_fire_and_blaze_5:2.69%
  • bound_by_fire_and_blaze_6:2.60%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.7sec 120.7sec 66.6sec 65.35% 0.00% 195.7 (195.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 186.8s
  • trigger_min/max:120.0s / 186.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 184.0s

Stack Uptimes

  • breath_of_sindragosa_1:65.35%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.7sec 120.7sec 0.8sec 0.75% 0.00% 8.3 (8.3) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.88
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 131.9s
  • trigger_min/max:120.0s / 131.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s

Stack Uptimes

  • dragon_games_equipment_1:0.75%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 307.2sec 307.2sec 26.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 332.4s
  • trigger_min/max:300.0s / 332.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.72%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 85.5sec 85.5sec 19.5sec 25.89% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 234.7s
  • trigger_min/max:5.3s / 234.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.3s

Stack Uptimes

  • empower_rune_weapon_1:25.89%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 7.5 0.0 40.1sec 40.1sec 12.0sec 30.16% 0.00% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.1s / 59.9s
  • trigger_min/max:28.1s / 59.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • enduring_strength_1:30.16%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 7.7 16.3 40.5sec 12.1sec 9.6sec 24.63% 98.43% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:22.9s / 141.1s
  • trigger_min/max:0.9s / 131.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:9.95%
  • enduring_strength_builder_2:7.75%
  • enduring_strength_builder_3:4.40%
  • enduring_strength_builder_4:1.81%
  • enduring_strength_builder_5:0.55%
  • enduring_strength_builder_6:0.13%
  • enduring_strength_builder_7:0.03%
  • enduring_strength_builder_8:0.00%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gathering Storm 13.4 127.1 23.1sec 2.1sec 15.2sec 68.20% 86.91% 67.1 (104.7) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.7s / 84.9s
  • trigger_min/max:0.9s / 36.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.9s

Stack Uptimes

  • gathering_storm_1:2.31%
  • gathering_storm_2:5.00%
  • gathering_storm_3:5.39%
  • gathering_storm_4:3.28%
  • gathering_storm_5:5.49%
  • gathering_storm_6:3.93%
  • gathering_storm_7:3.54%
  • gathering_storm_8:3.74%
  • gathering_storm_9:3.04%
  • gathering_storm_10:32.47%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 7.2 213.2 41.6sec 1.3sec 39.5sec 94.32% 76.74% 199.4 (199.4) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 244.2s
  • trigger_min/max:1.0s / 20.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 243.5s

Stack Uptimes

  • icy_talons_1:4.02%
  • icy_talons_2:3.43%
  • icy_talons_3:86.88%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 42.0 7.3 7.1sec 6.0sec 1.7sec 24.07% 27.47% 7.3 (7.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 49.0s
  • trigger_min/max:0.0s / 49.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.4s

Stack Uptimes

  • killing_machine_1:24.07%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 7.9 0.0 40.1sec 40.1sec 11.8sec 30.82% 30.43% 0.0 (0.0) 7.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.1s / 59.9s
  • trigger_min/max:28.1s / 59.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:30.82%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 7.8 57.0 40.1sec 4.4sec 11.6sec 30.33% 51.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:27.7s / 59.9s
  • trigger_min/max:0.9s / 50.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:2.06%
  • pillar_of_frost_bonus_2:2.38%
  • pillar_of_frost_bonus_3:2.87%
  • pillar_of_frost_bonus_4:2.42%
  • pillar_of_frost_bonus_5:2.53%
  • pillar_of_frost_bonus_6:2.90%
  • pillar_of_frost_bonus_7:2.38%
  • pillar_of_frost_bonus_8:2.33%
  • pillar_of_frost_bonus_9:2.13%
  • pillar_of_frost_bonus_10:1.81%
  • pillar_of_frost_bonus_11:1.66%
  • pillar_of_frost_bonus_12:1.45%
  • pillar_of_frost_bonus_13:1.12%
  • pillar_of_frost_bonus_14:0.81%
  • pillar_of_frost_bonus_15:0.45%
  • pillar_of_frost_bonus_16:0.30%
  • pillar_of_frost_bonus_17:0.23%
  • pillar_of_frost_bonus_18:0.19%
  • pillar_of_frost_bonus_19:0.17%
  • pillar_of_frost_bonus_20:0.11%
  • pillar_of_frost_bonus_21:0.04%
  • pillar_of_frost_bonus_22:0.01%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.5 1.5 23.0sec 20.6sec 16.8sec 75.83% 0.00% 222.1 (222.1) 12.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 84.5s
  • trigger_min/max:20.0s / 29.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.9s

Stack Uptimes

  • remorseless_winter_1:75.83%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 66.4 6.1 4.5sec 4.2sec 1.5sec 33.31% 99.77% 6.1 (6.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.5s
  • trigger_min/max:0.0s / 58.5s
  • trigger_pct:63.09%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rime_1:33.31%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.8 14.5 21.7sec 10.3sec 11.7sec 53.97% 0.00% 14.5 (14.5) 13.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 144.9s
  • trigger_min/max:0.9s / 117.2s
  • trigger_pct:15.04%
  • duration_min/max:0.0s / 72.4s

Stack Uptimes

  • rune_mastery_1:53.97%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.4 23.3sec 14.5sec 10.2sec 43.33% 42.46% 7.4 (7.4) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 90.1s
  • trigger_min/max:0.0s / 61.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.8s

Stack Uptimes

  • rune_of_hysteria_1:43.33%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Strength 8.4 11.7 35.9sec 14.5sec 23.6sec 66.29% 0.00% 11.7 (11.7) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 167.1s
  • trigger_min/max:0.0s / 62.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.4s

Stack Uptimes

  • unholy_strength_1:66.29%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 7.2 213.2 41.6sec 1.3sec 39.5sec 94.32% 89.50% 199.4 (199.4) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 244.2s
  • trigger_min/max:1.0s / 20.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 243.5s

Stack Uptimes

  • unleashed_frenzy_1:4.02%
  • unleashed_frenzy_2:3.43%
  • unleashed_frenzy_3:86.88%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=6 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.4 9.0 50.0 11.1s 1.3s 128.4s
windfury_totem_extra_attack_oh 22.1 8.0 43.0 13.1s 1.3s 187.3s
Killing Machine spent on Obliterate 41.7 22.0 63.0 7.1s 0.9s 50.6s
Killing Machine: Critical auto attacks 42.0 23.0 64.0 7.1s 1.3s 49.0s
Killing Machine wasted: Critical auto attacks 7.3 0.0 22.0 35.7s 1.3s 300.5s
Rune ready 224.5 153.0 292.0 1.5s 0.0s 12.4s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 3.00% 0.00% 14.30% 0.7s 0.0s 6.4s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=354900)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0671.246 / 0.9873.10920.892
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
12.01431.63358.950 / 57.36591.334142.724

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Remorseless Winter0.7340.0019.0958.3201.22724.187
Horn of Winter19.0230.001157.89866.7240.000191.920
Death and Decay87.4521.001238.84828.6770.000238.848
Empower Rune Weapon37.67637.67637.6760.0050.00037.676
Abomination Limb0.7780.0014.5110.9060.0004.779
Pillar of Frost1.8630.00115.78411.1360.27029.453
Breath of Sindragosa0.8590.00166.7731.3390.00066.773
Raise Dead0.7610.0015.1251.3480.3055.693

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Breath of SindragosaRune10.6810.604.72%0.990.080.78%
Empower Rune WeaponRunic Power19.1288.272.30%4.627.327.66%
Empower Rune WeaponRune19.1219.068.49%1.000.060.32%
Frost FeverRunic Power32.25153.554.00%4.767.684.76%
Horn of WinterRunic Power4.83120.823.14%25.000.000.00%
Horn of WinterRune9.679.674.31%1.000.000.00%
Murderous EfficiencyRune20.8420.849.28%1.000.000.00%
Rage of the Frozen ChampionRunic Power66.09513.1613.35%7.7715.532.94%
Rune RegenerationRune89.9089.9040.04%1.000.000.00%
Rune of HysteriaRunic Power162.80332.908.66%2.0428.927.99%
Runic AttenuationRunic Power71.10342.708.92%4.8212.783.60%
Runic EmpowermentRune74.7874.4633.16%1.000.310.42%
Arcane TorrentRunic Power2.0641.211.07%20.000.000.00%
Death and DecayRunic Power1.0810.820.28%10.000.000.00%
Howling BlastRunic Power66.241.510.04%0.020.000.00%
ObliterateRunic Power106.142092.1654.43%19.7130.671.44%
Remorseless WinterRunic Power15.01146.403.81%9.753.722.48%
pet - ghoul
energy_regenEnergy1114.701917.05100.00%1.72169.888.14%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 195.723131.4616.0015.961120.09
Death and DecayRune 1.081.081.001.006090.80
Frost StrikeRunic Power 24.70617.5825.0025.00649.35
Howling BlastRune 66.240.150.000.0016514325.28
ObliterateRune 106.14212.282.003.3012229.95
Remorseless WinterRune 15.0115.011.001.00110113.61
pet - ghoul
ClawEnergy 52.272090.8340.0040.0050.10
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 12.81 12.50 106.6 94.5 0.4 144.0
Rune 6.0 0.75 0.76 0.0 2.0 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 45440.03
Minimum 36899.31
Maximum 53940.62
Spread ( max - min ) 17041.31
Range [ ( max - min ) / 2 * 100% ] 18.75%
Standard Deviation 2316.2187
5th Percentile 41584.18
95th Percentile 49233.48
( 95th Percentile - 5th Percentile ) 7649.30
Mean Distribution
Standard Deviation 26.7472
95.00% Confidence Interval ( 45387.61 - 45492.45 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 100
0.1% Error 9982
0.1 Scale Factor Error with Delta=300 45798
0.05 Scale Factor Error with Delta=300 183191
0.01 Scale Factor Error with Delta=300 4579761
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 45440.03
Minimum 36899.31
Maximum 53940.62
Spread ( max - min ) 17041.31
Range [ ( max - min ) / 2 * 100% ] 18.75%
Standard Deviation 2316.2187
5th Percentile 41584.18
95th Percentile 49233.48
( 95th Percentile - 5th Percentile ) 7649.30
Mean Distribution
Standard Deviation 26.7472
95.00% Confidence Interval ( 45387.61 - 45492.45 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 100
0.1% Error 9982
0.1 Scale Factor Error with Delta=300 45798
0.05 Scale Factor Error with Delta=300 183191
0.01 Scale Factor Error with Delta=300 4579761
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 45440.03
Minimum 36899.31
Maximum 53940.62
Spread ( max - min ) 17041.31
Range [ ( max - min ) / 2 * 100% ] 18.75%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 13301769.45
Minimum 8892123.69
Maximum 17517756.75
Spread ( max - min ) 8625633.07
Range [ ( max - min ) / 2 * 100% ] 32.42%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
5 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
6 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
7 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
8 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
9 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
A 0.00 variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
C 14.34 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
D 0.00 call_action_list,name=trinkets
Choose Action list to run
E 0.00 call_action_list,name=cooldowns
F 0.00 call_action_list,name=racials
G 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
H 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
I 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
J 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
L 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
M 9.41 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
N 49.30 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
O 4.43 horn_of_winter,if=rune<2&runic_power.deficit>25
P 23.78 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
Q 46.99 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
R 1.08 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
S 0.56 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
T 9.26 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
U 0.70 howling_blast,if=buff.rime.react
V 1.45 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
W 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
X 0.37 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
Y 3.58 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
Z 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
a 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
b 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
c 7.53 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
d 2.94 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
e 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
f 5.61 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
0.00 frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
g 11.44 obliterate,if=!variable.pooling_runes&buff.killing_machine.react
h 15.68 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
i 3.28 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
j 14.67 obliterate,if=!variable.pooling_runes
k 0.40 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
l 0.62 arcane_torrent,if=runic_power.deficit>20
m 7.08 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
n 2.85 use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
o 2.76 use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
p 0.09 use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
q 0.01 use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABaefhjhjdnYcWPNPOQNQQNQNQQPMPNPToTNPNTNPPTcQMYQVQNPQNPQOPNMQNQPQghjhjCCCcfhggCCCgjmmmjhjmfmmgmjhmmmjhjaehfgdncNQNQNNPNQNQNMOPoQNPQNYQQQQNPNQMNPQNcQQQNPNQQNMQNQQOPNQQQNQVMPNQcNQPNPQghjmfmmjhmjhmjaehjhdnMNQNcQNOQQNQNPNoMPYNPNQNPQNQNQNQMjjbjhmmmjg

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 4 trinket_1_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 5 trinket_2_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 6 trinket_1_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 7 trinket_2_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 8 trinket_priority Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 9 rw_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat A 2h_check Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default B auto_attack Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 cooldowns a abomination_limb Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, static_empowerment
0:01.036 cooldowns e raise_dead Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, rime, static_empowerment(2)
0:01.036 single_target f remorseless_winter Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, rime, static_empowerment(2)
0:02.074 single_target h howling_blast Fluffy_Pillow 15.0/144: 10% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, remorseless_winter, rime, static_empowerment(3)
0:03.109 single_target j obliterate Fluffy_Pillow 23.0/144: 16% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, gathering_storm, remorseless_winter, static_empowerment(4)
0:04.144 single_target h howling_blast Fluffy_Pillow 43.0/144: 30% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, gathering_storm(3), remorseless_winter, rime, static_empowerment(5)
0:05.181 single_target j obliterate Fluffy_Pillow 56.0/144: 39% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, gathering_storm(4), remorseless_winter, static_empowerment(5)
0:06.216 cooldowns d breath_of_sindragosa Fluffy_Pillow 76.0/144: 53% runic_power
1.0/6: 17% rune
bloodlust, abomination_limb, gathering_storm(6), killing_machine, remorseless_winter, rime, static_empowerment(5)
0:06.216 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 76.0/144: 53% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, rime, rune_of_hysteria, static_empowerment(5)
0:06.216 cooldowns Y empower_rune_weapon Fluffy_Pillow 76.0/144: 53% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(6), killing_machine, remorseless_winter, rime, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
0:06.216 cooldowns c pillar_of_frost Fluffy_Pillow 82.2/144: 57% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), killing_machine, remorseless_winter, rime, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
0:06.216 cooldowns W potion Fluffy_Pillow 82.2/144: 57% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), killing_machine, pillar_of_frost, remorseless_winter, rime, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
0:06.216 breath P obliterate Fluffy_Pillow 82.2/144: 57% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), killing_machine, pillar_of_frost, remorseless_winter, rime, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.116 breath N howling_blast Fluffy_Pillow 113.2/144: 79% runic_power
2.0/6: 33% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.016 breath P obliterate Fluffy_Pillow 107.1/144: 74% runic_power
2.0/6: 33% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons, killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy, bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.917 breath O horn_of_winter Fluffy_Pillow 115.9/144: 81% runic_power
0.0/6: 0% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(2), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.817 breath Q obliterate Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.718 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.619 breath Q obliterate Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.520 breath Q obliterate Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.420 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.319 breath Q obliterate Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:15.218 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:16.120 Waiting     0.103 sec 136.0/144: 94% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:16.223 breath Q obliterate Fluffy_Pillow 125.0/144: 87% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:17.124 Waiting     0.110 sec 144.0/144: 100% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:17.234 breath Q obliterate Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:18.134 Waiting     1.087 sec 144.0/144: 100% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(20), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:19.221 breath P obliterate Fluffy_Pillow 112.0/144: 78% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:20.121 Waiting     0.706 sec 137.0/144: 95% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:20.827 breath M remorseless_winter Fluffy_Pillow 121.0/144: 84% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:21.937 breath P obliterate Fluffy_Pillow 125.0/144: 87% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:22.837 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:23.738 breath P obliterate Fluffy_Pillow 125.0/144: 87% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:24.637 Waiting     0.619 sec 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:25.256 breath T obliterate Fluffy_Pillow 112.0/144: 78% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:26.156 Waiting     0.095 sec 132.0/144: 92% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.251 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 122.2/144: 85% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.251 Waiting     1.056 sec 122.2/144: 85% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.307 breath T obliterate Fluffy_Pillow 112.4/144: 78% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.342 breath N howling_blast Fluffy_Pillow 121.2/144: 84% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.379 breath P obliterate Fluffy_Pillow 121.3/144: 84% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.414 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.448 Waiting     0.795 sec 121.9/144: 85% runic_power
5.0/6: 83% rune
bloodlust, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.243 breath T obliterate Fluffy_Pillow 105.9/144: 74% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.278 breath N howling_blast Fluffy_Pillow 114.7/144: 80% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:34.312 breath P obliterate Fluffy_Pillow 108.6/144: 75% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:35.348 breath P obliterate Fluffy_Pillow 112.6/144: 78% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:36.383 Waiting     0.861 sec 121.6/144: 84% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
0:37.244 breath T obliterate Fluffy_Pillow 105.6/144: 73% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
0:38.279 cooldowns c pillar_of_frost Fluffy_Pillow 109.6/144: 76% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
0:38.279 Waiting     0.890 sec 109.6/144: 76% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
0:39.169 breath Q obliterate Fluffy_Pillow 109.6/144: 76% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
0:40.202 Waiting     0.642 sec 118.6/144: 82% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
0:40.844 breath M remorseless_winter Fluffy_Pillow 102.6/144: 71% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
0:42.379 Waiting     0.903 sec 83.0/144: 58% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:43.282 cooldowns Y empower_rune_weapon Fluffy_Pillow 67.0/144: 47% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:43.282 breath Q obliterate Fluffy_Pillow 73.2/144: 51% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:44.453 Waiting     1.857 sec 82.0/144: 57% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:46.310 breath V arcane_torrent Fluffy_Pillow 50.0/144: 35% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:47.479 breath Q obliterate Fluffy_Pillow 58.8/144: 41% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:48.650 breath N howling_blast Fluffy_Pillow 80.0/144: 56% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:49.822 breath P obliterate Fluffy_Pillow 74.0/144: 51% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
0:50.993 Waiting     2.336 sec 78.0/144: 54% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:53.329 breath Q obliterate Fluffy_Pillow 40.0/144: 28% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:54.501 breath N howling_blast Fluffy_Pillow 44.0/144: 31% runic_power
0.0/6: 0% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:55.671 breath P obliterate Fluffy_Pillow 41.0/144: 28% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:56.842 breath Q obliterate Fluffy_Pillow 50.0/144: 35% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:58.012 breath O horn_of_winter Fluffy_Pillow 54.0/144: 37% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:59.184 breath P obliterate Fluffy_Pillow 68.0/144: 47% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
1:00.353 breath N howling_blast Fluffy_Pillow 61.0/144: 42% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:01.523 breath M remorseless_winter Fluffy_Pillow 53.0/144: 37% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:02.694 breath Q obliterate Fluffy_Pillow 52.0/144: 36% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:03.866 breath N howling_blast Fluffy_Pillow 61.0/144: 42% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:05.210 breath Q obliterate Fluffy_Pillow 53.0/144: 37% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:06.553 breath P obliterate Fluffy_Pillow 46.0/144: 32% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:07.897 breath Q obliterate Fluffy_Pillow 50.0/144: 35% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
1:09.242 Waiting     1.987 sec 43.0/144: 30% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
1:11.229 single_target g obliterate Fluffy_Pillow 16.0/144: 11% runic_power
4.0/6: 67% rune
unholy_strength, gathering_storm(9), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
1:12.573 single_target h howling_blast Fluffy_Pillow 36.0/144: 25% runic_power
3.0/6: 50% rune
unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:13.918 single_target j obliterate Fluffy_Pillow 52.1/144: 36% runic_power
3.0/6: 50% rune
unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:15.262 single_target h howling_blast Fluffy_Pillow 76.9/144: 53% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:16.608 single_target j obliterate Fluffy_Pillow 93.0/144: 65% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:17.954 default C frost_strike Fluffy_Pillow 117.8/144: 82% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(10), remorseless_winter, rime, bonegrinder_crit(5), rune_of_hysteria, static_empowerment(5)
1:19.299 default C frost_strike Fluffy_Pillow 92.8/144: 64% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons, rime, bonegrinder_crit(5), unleashed_frenzy, static_empowerment(5)
1:20.646 default C frost_strike Fluffy_Pillow 72.8/144: 51% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), rime, bonegrinder_crit(5), unleashed_frenzy(2), static_empowerment(5)
1:21.991 cooldowns c pillar_of_frost Fluffy_Pillow 47.8/144: 33% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), rime, unleashed_frenzy(3), static_empowerment(5)
1:21.991 single_target f remorseless_winter Fluffy_Pillow 47.8/144: 33% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), pillar_of_frost, rime, unleashed_frenzy(3), static_empowerment(5)
1:23.336 single_target h howling_blast Fluffy_Pillow 57.8/144: 40% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, unleashed_frenzy(3), static_empowerment(5)
1:24.681 single_target g obliterate Fluffy_Pillow 70.8/144: 49% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
1:26.024 single_target g obliterate Fluffy_Pillow 90.8/144: 63% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
1:27.369 default C frost_strike Fluffy_Pillow 110.8/144: 77% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(5), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), static_empowerment(5)
1:28.713 default C frost_strike Fluffy_Pillow 92.0/144: 64% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
1:30.057 default C frost_strike Fluffy_Pillow 73.2/144: 51% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(2), rune_of_hysteria, static_empowerment(5)
1:31.404 single_target g obliterate Fluffy_Pillow 48.2/144: 33% runic_power
4.0/6: 67% rune
unholy_strength, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:32.750 single_target j obliterate Fluffy_Pillow 73.0/144: 51% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:34.096 single_target m frost_strike Fluffy_Pillow 97.8/144: 68% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(9), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:35.441 single_target m frost_strike Fluffy_Pillow 79.0/144: 55% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:36.785 single_target m frost_strike Fluffy_Pillow 54.0/144: 38% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:38.131 single_target j obliterate Fluffy_Pillow 29.0/144: 20% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:39.474 single_target h howling_blast Fluffy_Pillow 53.8/144: 37% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:40.819 single_target j obliterate Fluffy_Pillow 69.9/144: 49% runic_power
2.0/6: 33% rune
icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:42.163 single_target m frost_strike Fluffy_Pillow 94.7/144: 66% runic_power
0.0/6: 0% rune
icy_talons(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:43.505 single_target f remorseless_winter Fluffy_Pillow 69.7/144: 48% runic_power
1.0/6: 17% rune
icy_talons(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:44.850 single_target m frost_strike Fluffy_Pillow 88.3/144: 61% runic_power
0.0/6: 0% rune
icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:46.193 single_target m frost_strike Fluffy_Pillow 69.5/144: 48% runic_power
0.0/6: 0% rune
icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:47.538 single_target g obliterate Fluffy_Pillow 50.7/144: 35% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:48.883 single_target m frost_strike Fluffy_Pillow 75.5/144: 52% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:50.229 single_target j obliterate Fluffy_Pillow 55.5/144: 39% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:51.575 single_target h howling_blast Fluffy_Pillow 80.5/144: 56% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:52.920 single_target m frost_strike Fluffy_Pillow 88.5/144: 61% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:54.266 single_target m frost_strike Fluffy_Pillow 63.5/144: 44% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:55.610 single_target m frost_strike Fluffy_Pillow 44.7/144: 31% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:56.955 single_target j obliterate Fluffy_Pillow 19.7/144: 14% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:58.300 single_target h howling_blast Fluffy_Pillow 50.7/144: 35% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), rime, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:59.643 single_target j obliterate Fluffy_Pillow 60.6/144: 42% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), killing_machine, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:00.988 cooldowns a abomination_limb Fluffy_Pillow 85.4/144: 59% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:02.334 cooldowns e raise_dead Fluffy_Pillow 97.8/144: 68% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, rime, bonegrinder_crit, static_empowerment(5)
2:02.334 single_target h howling_blast Fluffy_Pillow 97.8/144: 68% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, rime, bonegrinder_crit, static_empowerment(5)
2:03.678 single_target f remorseless_winter Fluffy_Pillow 105.8/144: 74% runic_power
1.0/6: 17% rune
abomination_limb, killing_machine, bonegrinder_crit, static_empowerment(5)
2:05.022 Waiting     0.926 sec 115.8/144: 80% runic_power
1.0/6: 17% rune
abomination_limb, killing_machine, remorseless_winter, bonegrinder_crit, static_empowerment(5)
2:05.948 single_target g obliterate Fluffy_Pillow 115.8/144: 80% runic_power
2.0/6: 33% rune
abomination_limb, killing_machine, remorseless_winter, bonegrinder_crit, static_empowerment(5)
2:07.293 cooldowns d breath_of_sindragosa Fluffy_Pillow 135.8/144: 94% runic_power
2.0/6: 33% rune
abomination_limb, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(2), static_empowerment(5)
2:07.293 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 135.8/144: 94% runic_power
4.0/6: 67% rune
abomination_limb, breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(2), rune_of_hysteria, static_empowerment(5)
2:07.293 cooldowns c pillar_of_frost Fluffy_Pillow 135.8/144: 94% runic_power
4.0/6: 67% rune
abomination_limb, breath_of_sindragosa, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit(2), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
2:07.293 breath N howling_blast Fluffy_Pillow 135.8/144: 94% runic_power
4.0/6: 67% rune
abomination_limb, breath_of_sindragosa, gathering_storm(2), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
2:08.639 breath Q obliterate Fluffy_Pillow 128.0/144: 89% runic_power
5.0/6: 83% rune
abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
2:09.984 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune
abomination_limb, breath_of_sindragosa, gathering_storm(5), icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(2), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
2:11.329 breath Q obliterate Fluffy_Pillow 112.0/144: 78% runic_power
3.0/6: 50% rune
abomination_limb, breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
2:12.674 breath N howling_blast Fluffy_Pillow 120.8/144: 84% runic_power
1.0/6: 17% rune
abomination_limb, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
2:14.019 breath N howling_blast Fluffy_Pillow 114.7/144: 80% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
2:15.363 breath P obliterate Fluffy_Pillow 98.8/144: 69% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:16.709 breath N howling_blast Fluffy_Pillow 102.8/144: 71% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
2:18.054 breath Q obliterate Fluffy_Pillow 96.8/144: 67% runic_power
4.0/6: 67% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
2:19.400 breath N howling_blast Fluffy_Pillow 95.8/144: 66% runic_power
3.0/6: 50% rune
breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
2:20.744 breath Q obliterate Fluffy_Pillow 95.9/144: 67% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
2:22.089 breath N howling_blast Fluffy_Pillow 104.7/144: 73% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
2:23.432 breath M remorseless_winter Fluffy_Pillow 88.8/144: 62% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
2:25.021 breath O horn_of_winter Fluffy_Pillow 85.2/144: 59% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:26.366 breath P obliterate Fluffy_Pillow 83.2/144: 58% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:27.709 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 87.2/144: 61% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:27.709 breath Q obliterate Fluffy_Pillow 87.2/144: 61% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5)
2:29.053 breath N howling_blast Fluffy_Pillow 96.2/144: 67% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:30.397 breath P obliterate Fluffy_Pillow 72.2/144: 50% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:31.740 breath Q obliterate Fluffy_Pillow 76.2/144: 53% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:33.086 breath N howling_blast Fluffy_Pillow 85.2/144: 59% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:34.365 cooldowns Y empower_rune_weapon Fluffy_Pillow 61.2/144: 42% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:34.429 breath Q obliterate Fluffy_Pillow 66.2/144: 46% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:35.599 breath Q obliterate Fluffy_Pillow 70.2/144: 49% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:36.770 breath Q obliterate Fluffy_Pillow 79.2/144: 55% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:37.941 Waiting     0.383 sec 83.2/144: 58% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:38.324 breath Q obliterate Fluffy_Pillow 67.2/144: 47% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:39.495 breath N howling_blast Fluffy_Pillow 77.4/144: 54% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:40.666 breath P obliterate Fluffy_Pillow 71.3/144: 50% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:41.836 breath N howling_blast Fluffy_Pillow 86.3/144: 60% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:43.007 breath Q obliterate Fluffy_Pillow 80.2/144: 56% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:44.176 breath M remorseless_winter Fluffy_Pillow 95.2/144: 66% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:45.346 breath N howling_blast Fluffy_Pillow 88.0/144: 61% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:46.517 breath P obliterate Fluffy_Pillow 88.2/144: 61% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:47.689 breath Q obliterate Fluffy_Pillow 103.2/144: 72% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:48.859 breath N howling_blast Fluffy_Pillow 112.0/144: 78% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:50.030 cooldowns c pillar_of_frost Fluffy_Pillow 112.1/144: 78% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:50.030 breath Q obliterate Fluffy_Pillow 112.1/144: 78% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:51.201 Waiting     0.729 sec 120.9/144: 84% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
2:51.930 breath Q obliterate Fluffy_Pillow 104.9/144: 73% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
2:53.101 breath Q obliterate Fluffy_Pillow 118.9/144: 83% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
2:54.272 breath N howling_blast Fluffy_Pillow 122.9/144: 85% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
2:55.443 breath P obliterate Fluffy_Pillow 103.9/144: 72% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
2:56.788 breath N howling_blast Fluffy_Pillow 114.1/144: 79% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:58.132 Waiting     2.193 sec 108.0/144: 75% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:00.325 breath Q obliterate Fluffy_Pillow 60.0/144: 42% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:01.668 breath Q obliterate Fluffy_Pillow 68.8/144: 48% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:03.012 breath N howling_blast Fluffy_Pillow 83.8/144: 58% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:04.358 breath M remorseless_winter Fluffy_Pillow 61.7/144: 43% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:05.703 breath Q obliterate Fluffy_Pillow 55.7/144: 39% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:07.046 breath N howling_blast Fluffy_Pillow 70.7/144: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:08.390 breath Q obliterate Fluffy_Pillow 54.8/144: 38% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:09.735 breath Q obliterate Fluffy_Pillow 63.6/144: 44% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:11.081 breath O horn_of_winter Fluffy_Pillow 78.6/144: 55% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:12.425 breath P obliterate Fluffy_Pillow 77.6/144: 54% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:13.768 breath N howling_blast Fluffy_Pillow 81.6/144: 57% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:15.111 breath Q obliterate Fluffy_Pillow 78.6/144: 55% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:16.456 breath Q obliterate Fluffy_Pillow 71.4/144: 50% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:17.800 breath Q obliterate Fluffy_Pillow 86.4/144: 60% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:19.144 breath N howling_blast Fluffy_Pillow 95.2/144: 66% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:20.491 breath Q obliterate Fluffy_Pillow 73.2/144: 51% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:21.836 Waiting     1.521 sec 82.0/144: 57% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:23.357 breath V arcane_torrent Fluffy_Pillow 50.0/144: 35% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
3:24.702 breath M remorseless_winter Fluffy_Pillow 59.0/144: 41% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
3:26.048 breath P obliterate Fluffy_Pillow 58.0/144: 40% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
3:27.392 breath N howling_blast Fluffy_Pillow 51.0/144: 35% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
3:28.738 breath Q obliterate Fluffy_Pillow 43.0/144: 30% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
3:30.084 cooldowns c pillar_of_frost Fluffy_Pillow 47.0/144: 33% runic_power
4.0/6: 67% rune
rune_mastery, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:30.084 breath N howling_blast Fluffy_Pillow 47.0/144: 33% runic_power
4.0/6: 67% rune
rune_mastery, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:31.428 breath Q obliterate Fluffy_Pillow 24.9/144: 17% runic_power
5.0/6: 83% rune
rune_mastery, breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:32.772 breath P obliterate Fluffy_Pillow 33.7/144: 23% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, gathering_storm(8), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:34.117 breath N howling_blast Fluffy_Pillow 42.5/144: 30% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:35.461 Waiting     0.804 sec 20.4/144: 14% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:36.265 breath P obliterate Fluffy_Pillow 26.6/144: 18% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:37.610 breath Q obliterate Fluffy_Pillow 19.4/144: 13% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
3:38.955 Waiting     1.365 sec 33.4/144: 23% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
3:40.320 single_target g obliterate Fluffy_Pillow 1.4/144: 1% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
3:41.664 single_target h howling_blast Fluffy_Pillow 21.4/144: 15% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
3:43.009 single_target j obliterate Fluffy_Pillow 29.4/144: 20% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:44.353 single_target m frost_strike Fluffy_Pillow 66.6/144: 46% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:45.698 single_target f remorseless_winter Fluffy_Pillow 41.6/144: 29% runic_power
2.0/6: 33% rune
icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:47.043 single_target m frost_strike Fluffy_Pillow 60.2/144: 42% runic_power
1.0/6: 17% rune
icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:48.387 single_target m frost_strike Fluffy_Pillow 35.2/144: 24% runic_power
1.0/6: 17% rune
icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:49.730 single_target j obliterate Fluffy_Pillow 10.2/144: 7% runic_power
3.0/6: 50% rune
icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:51.074 single_target h howling_blast Fluffy_Pillow 35.0/144: 24% runic_power
1.0/6: 17% rune
gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:52.419 single_target m frost_strike Fluffy_Pillow 43.0/144: 30% runic_power
1.0/6: 17% rune
gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:53.763 single_target j obliterate Fluffy_Pillow 24.2/144: 17% runic_power
2.0/6: 33% rune
gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:55.107 single_target h howling_blast Fluffy_Pillow 49.0/144: 34% runic_power
1.0/6: 17% rune
gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:56.450 single_target m frost_strike Fluffy_Pillow 71.3/144: 50% runic_power
1.0/6: 17% rune
gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:57.794 Waiting     0.485 sec 46.3/144: 32% runic_power
1.0/6: 17% rune
icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:58.279 single_target j obliterate Fluffy_Pillow 46.3/144: 32% runic_power
3.0/6: 50% rune
icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:59.624 Waiting     1.127 sec 83.5/144: 58% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:00.751 cooldowns a abomination_limb Fluffy_Pillow 83.5/144: 58% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:02.334 cooldowns e raise_dead Fluffy_Pillow 83.5/144: 58% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, icy_talons(3), rime, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:02.334 single_target h howling_blast Fluffy_Pillow 83.5/144: 58% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, icy_talons(3), rime, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:03.678 single_target j obliterate Fluffy_Pillow 98.4/144: 68% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, killing_machine, static_empowerment(5)
4:05.023 single_target h howling_blast Fluffy_Pillow 118.4/144: 82% runic_power
0.0/6: 0% rune
unholy_strength, abomination_limb, rime, bonegrinder_crit, static_empowerment(5)
4:06.367 Waiting     0.740 sec 126.4/144: 88% runic_power
0.0/6: 0% rune
unholy_strength, abomination_limb, bonegrinder_crit, static_empowerment(5)
4:07.107 cooldowns d breath_of_sindragosa Fluffy_Pillow 126.4/144: 88% runic_power
0.0/6: 0% rune
unholy_strength, abomination_limb, rime, bonegrinder_crit, static_empowerment(5)
4:07.293 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 126.4/144: 88% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, rime, bonegrinder_crit, static_empowerment(5)
4:07.293 breath M remorseless_winter Fluffy_Pillow 126.4/144: 88% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, rime, bonegrinder_crit, bound_by_fire_and_blaze, static_empowerment(5)
4:08.637 breath N howling_blast Fluffy_Pillow 125.4/144: 87% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy, bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
4:09.981 Waiting     0.398 sec 119.4/144: 83% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons(2), remorseless_winter, bonegrinder_crit, unleashed_frenzy(2), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
4:10.379 breath Q obliterate Fluffy_Pillow 103.4/144: 72% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
4:11.724 breath N howling_blast Fluffy_Pillow 118.4/144: 82% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, static_empowerment(5)
4:13.069 cooldowns c pillar_of_frost Fluffy_Pillow 112.3/144: 78% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, static_empowerment(5)
4:13.069 breath Q obliterate Fluffy_Pillow 112.3/144: 78% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, static_empowerment(5)
4:14.414 breath N howling_blast Fluffy_Pillow 111.3/144: 77% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, static_empowerment(5)
4:15.758 breath O horn_of_winter Fluffy_Pillow 105.2/144: 73% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, static_empowerment(5)
4:17.103 breath Q obliterate Fluffy_Pillow 125.2/144: 87% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:18.447 breath Q obliterate Fluffy_Pillow 112.0/144: 78% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:19.790 breath N howling_blast Fluffy_Pillow 120.8/144: 84% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:21.134 breath Q obliterate Fluffy_Pillow 120.9/144: 84% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:22.481 breath N howling_blast Fluffy_Pillow 118.2/144: 82% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), rime, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:23.827 Waiting     1.312 sec 112.1/144: 78% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:25.139 breath P obliterate Fluffy_Pillow 96.1/144: 67% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:26.483 breath N howling_blast Fluffy_Pillow 84.1/144: 58% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:27.828 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 76.1/144: 53% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:27.828 breath M remorseless_winter Fluffy_Pillow 76.1/144: 53% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5)
4:29.171 breath P obliterate Fluffy_Pillow 75.1/144: 52% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:30.339 cooldowns Y empower_rune_weapon Fluffy_Pillow 63.1/144: 44% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:30.517 breath N howling_blast Fluffy_Pillow 68.1/144: 47% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:31.690 Waiting     1.876 sec 60.1/144: 42% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:33.566 breath P obliterate Fluffy_Pillow 33.1/144: 23% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:34.736 breath N howling_blast Fluffy_Pillow 37.1/144: 26% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:35.908 breath Q obliterate Fluffy_Pillow 39.1/144: 27% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
4:37.079 breath N howling_blast Fluffy_Pillow 43.1/144: 30% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
4:38.249 breath P obliterate Fluffy_Pillow 35.1/144: 24% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
4:39.418 breath Q obliterate Fluffy_Pillow 23.1/144: 16% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:40.588 breath N howling_blast Fluffy_Pillow 37.1/144: 26% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:41.759 breath Q obliterate Fluffy_Pillow 34.1/144: 24% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:42.929 breath N howling_blast Fluffy_Pillow 43.1/144: 30% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:44.099 breath Q obliterate Fluffy_Pillow 40.1/144: 28% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:45.270 breath N howling_blast Fluffy_Pillow 44.1/144: 31% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:46.441 breath Q obliterate Fluffy_Pillow 25.1/144: 17% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:47.611 breath M remorseless_winter Fluffy_Pillow 34.1/144: 24% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:48.999 Waiting     0.315 sec 28.1/144: 20% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:49.314 single_target j obliterate Fluffy_Pillow 12.1/144: 8% runic_power
4.0/6: 67% rune
rune_mastery, empower_rune_weapon, icy_talons(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:50.485 single_target j obliterate Fluffy_Pillow 43.1/144: 30% runic_power
4.0/6: 67% rune
rune_mastery, gathering_storm(2), icy_talons(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:51.831 cooldowns b pillar_of_frost Fluffy_Pillow 67.9/144: 47% runic_power
3.0/6: 50% rune
rune_mastery, gathering_storm(4), icy_talons(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:51.831 single_target j obliterate Fluffy_Pillow 67.9/144: 47% runic_power
3.0/6: 50% rune
rune_mastery, gathering_storm(4), icy_talons(3), pillar_of_frost, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:53.177 single_target h howling_blast Fluffy_Pillow 92.7/144: 64% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:54.521 single_target m frost_strike Fluffy_Pillow 102.6/144: 71% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:55.866 single_target m frost_strike Fluffy_Pillow 83.8/144: 58% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
4:57.210 single_target m frost_strike Fluffy_Pillow 58.8/144: 41% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
4:58.555 single_target j obliterate Fluffy_Pillow 33.8/144: 23% runic_power
2.0/6: 33% rune
gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
4:59.900 single_target g obliterate Fluffy_Pillow 58.8/144: 41% runic_power
2.0/6: 33% rune
gathering_storm(9), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5903 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3463 0 13076 12453 6915
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 261520 249060 0
Runic Power 144 144 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 24.64% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 6198 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +687 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +89 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +386 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets=use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=6915
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 44047 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
44047.5 44047.5 43.8 / 0.100% 7379.4 / 16.8% 2644.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.5 7.7 Runic Power 2.54% 52.0 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 44047
Apocalypse 224 0.5% 7.0 45.49sec 9609 7522 Direct 7.0 8337 16672 9608 15.3%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 1.2775 0.0000 67061.85 67061.85 0.00% 7522.36 7522.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.75% 5.91 0 8 8337.47 6617 12150 8331.47 0 9338 49316 49316 0.00%
crit 15.25% 1.06 0 6 16672.14 13235 22683 11368.63 0 21209 17746 17746 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=15 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [O]:5.98
  • if_expr:active_enemies<=3&cooldown.dark_transformation.remains
  • target_if_expr:debuff.festering_wound.stack
    opener
    [Z]:1.00
  • if_expr:buff.commander_of_the_dead_window.up
auto_attack_mh 2858 6.5% 148.1 2.44sec 5789 2403 Direct 148.1 5021 10038 5789 15.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.07 148.07 0.00 0.00 0.00 2.4090 0.0000 857245.15 1224667.16 30.00% 2403.21 2403.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.68% 125.39 88 164 5020.75 3791 7013 5019.68 4795 5247 629538 899363 30.00%
crit 15.32% 22.69 7 46 10037.56 7582 13835 10035.07 9101 11015 227707 325304 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Dark Transformation 199 0.5% 7.0 45.61sec 8522 6670 Direct 7.0 7381 14774 8522 15.4%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.00 1.2777 0.0000 59663.56 59663.56 0.00% 6670.05 6670.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.57% 5.92 1 8 7380.90 5823 10869 7374.35 6167 8902 43701 43701 0.00%
crit 15.43% 1.08 0 6 14774.42 11646 19967 10218.66 0 19967 15962 15962 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [M]:5.82
  • if_expr:variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
    cooldowns
    [N]:0.18
  • if_expr:variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
    opener
    [a]:1.00
  • if_expr:debuff.festering_wound.stack>=4
Death Coil 4200 (5442) 9.6% (12.4%) 95.8 3.09sec 17007 14612 Direct 95.8 (227.9) 11375 22748 13128 15.4% (15.4%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.80 95.76 0.00 0.00 0.00 1.1639 0.0000 1257158.57 1257158.57 0.00% 14612.27 14612.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.59% 81.00 55 109 11374.90 7356 18286 11384.06 10661 12161 921371 921371 0.00%
crit 15.41% 14.76 3 31 22748.14 14712 36571 22764.90 18866 28093 335787 335787 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    generic
    [T]:93.67
  • if_expr:!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
    opener
    [Y]:2.13
  • if_expr:pet.gargoyle.active&!prev_gcd.1.death_coil
    Coil of Devastation 1243 2.8% 0.0 0.00sec 0 0 Periodic 132.1 2816 0 2816 0.0% 88.1%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 132.15 132.15 81.12 0.0000 2.0000 372094.65 372094.65 0.00% 1407.89 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 132.15 99 167 2815.82 1103 12523 2822.86 2424 3403 372095 372095 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 872 2.0% 6.8 46.86sec 38456 0 Direct 6.8 33373 66746 38489 15.3%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.82 6.81 0.00 0.00 0.00 0.0000 0.0000 262102.60 374441.83 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.67% 5.77 1 9 33373.08 33373 33373 33373.08 33373 33373 192437 274917 30.00%
crit 15.33% 1.04 0 6 66746.15 66746 66746 44271.95 0 66746 69666 99525 19.90%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1169 2.7% 26.2 11.53sec 13410 10914 Direct 26.2 11607 23248 13410 15.5%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.17 26.17 0.00 0.00 0.00 1.2287 0.0000 350902.11 501301.51 30.00% 10913.85 10913.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.52% 22.12 11 33 11607.37 8646 18322 11595.75 10488 12650 256706 366733 30.00%
crit 15.48% 4.05 0 12 23248.42 17293 35571 22849.09 0 33301 94196 134569 29.52%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    generic
    [V]:24.34
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
    opener
    [b]:1.83
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1868 4.3% 103.9 3.51sec 5390 0 Direct 103.9 4675 9344 5390 15.3%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.93 103.93 0.00 0.00 0.00 0.0000 0.0000 560200.59 560200.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.68% 88.01 61 116 4674.85 3287 7982 4675.73 4390 4963 411450 411450 0.00%
crit 15.32% 15.92 4 34 9344.43 6575 15743 9345.74 7979 11483 148750 148750 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 84 0.2% 11.9 26.31sec 2121 1761 Direct 11.9 1837 3668 2121 15.5%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.86 11.86 0.00 0.00 0.00 1.2046 0.0000 25160.14 25160.14 0.00% 1760.68 1760.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.51% 10.03 4 14 1837.14 1259 3080 1837.04 1561 2080 18418 18418 0.00%
crit 15.49% 1.84 0 7 3668.42 2517 6161 3159.13 0 6161 6742 6742 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    default
    [E]:11.86
  • target_if_expr:(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
Scourge Strike 970 (2245) 2.2% (5.1%) 77.1 3.74sec 8735 7606 Direct 77.1 (154.3) 3272 6547 3776 15.4% (15.4%)

Stats Details: Scourge Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.13 77.13 0.00 0.00 0.00 1.1484 0.0000 291248.28 416079.57 30.00% 7605.96 7605.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.61% 65.26 41 90 3271.93 2446 5013 3271.15 3075 3472 213532 305053 30.00%
crit 15.39% 11.87 1 24 6546.81 4892 9880 6546.53 5391 7696 77717 111027 30.00%

Action Details: Scourge Strike

  • id:55090
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:
  • description:An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.

Action Priority List

    generic
    [U]:77.13
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    Scourge Strike (_shadow) 1275 2.9% 0.0 0.00sec 0 0 Direct 77.1 4300 8602 4959 15.3%

Stats Details: Scourge Strike Shadow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 77.13 0.00 0.00 0.00 0.0000 0.0000 382503.28 382503.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.68% 65.32 43 90 4300.22 2777 6804 4302.39 4034 4606 280885 280885 0.00%
crit 15.32% 11.81 1 27 8601.53 5553 13608 8603.57 6714 11512 101618 101618 0.00%

Action Details: Scourge Strike Shadow

  • id:70890
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:70890
  • name:Scourge Strike
  • school:shadow
  • tooltip:
  • description:{$@spelldesc55090=An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.}
Soul Reaper 443 (2575) 1.0% (5.9%) 15.7 6.86sec 49249 39729 Direct 15.7 (31.4) 7356 14719 8463 15.0% (15.3%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.69 15.69 0.00 0.00 0.00 1.2396 0.0000 132811.19 132811.19 0.00% 39729.30 39729.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.96% 13.33 6 20 7355.51 4723 11186 7363.23 6538 8306 98065 98065 0.00%
crit 15.04% 2.36 0 9 14719.08 9594 22054 13532.52 0 22054 34746 34746 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [S]:15.69
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
    Soul Reaper (_execute) 2133 4.9% 15.7 6.86sec 40813 0 Direct 15.7 35338 70670 40813 15.5%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.68 15.68 0.00 0.00 0.00 0.0000 0.0000 640042.96 640042.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.50% 13.25 6 20 35337.87 26079 50965 35369.83 31755 38998 468312 468312 0.00%
crit 15.50% 2.43 0 10 70669.69 52680 101931 65161.47 0 97584 171731 171731 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 212 0.5% 3.7 90.73sec 17307 14921 Direct 3.7 14994 29925 17308 15.5%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.66 3.66 0.00 0.00 0.00 1.1601 0.0000 63414.91 63414.91 0.00% 14921.16 14921.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.51% 3.10 0 4 14993.72 12322 17822 14983.58 0 17822 46427 46427 0.00%
crit 15.49% 0.57 0 4 29924.85 24644 35644 13778.40 0 35644 16988 16988 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [R]:3.66
  • if_expr:variable.st_planning
Unholy Pact 1337 3.0% 123.1 2.63sec 3254 0 Direct 123.1 2822 5647 3254 15.3%

Stats Details: Unholy Pact

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 123.14 123.14 0.00 0.00 0.00 0.0000 0.0000 400718.61 400718.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.70% 104.30 74 134 2821.98 1948 4542 2821.90 2568 3030 294337 294337 0.00%
crit 15.30% 18.84 4 36 5647.19 3896 9085 5647.46 4852 6543 106382 106382 0.00%

Action Details: Unholy Pact

  • id:319236
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:319236
  • name:Unholy Pact
  • school:shadow
  • tooltip:Deals {$s1=0} Shadow damage.
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
Virulent Plague 881 2.0% 11.9 26.31sec 22274 0 Periodic 99.2 2311 4622 2665 15.3% 99.2%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.86 0.00 99.16 99.16 10.86 0.0000 3.0000 264242.65 264242.65 0.00% 888.27 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 84.70% 83.99 56 111 2311.40 1654 4017 2311.63 2191 2429 194142 194142 0.00%
crit 15.30% 15.17 2 34 4621.89 3309 8144 4622.48 4037 5730 70100 70100 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 6010 / 6010
Claw 312 0.7% 37.9 7.86sec 2476 2465 Direct 37.9 2146 4290 2476 15.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.90 37.90 0.00 0.00 0.00 1.0045 0.0000 93849.49 134074.12 30.00% 2465.18 2465.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.59% 32.06 17 47 2145.89 1713 5403 2144.09 1958 2301 68800 98288 30.00%
crit 15.41% 5.84 0 16 4290.05 3425 5990 4272.69 0 5432 25050 35787 29.91%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:37.90
  • if_expr:energy>70
Gnaw 1 0.0% 2.6 90.04sec 84 84 Direct 2.6 73 147 84 15.1%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.59 2.59 0.00 0.00 0.00 1.0046 0.0000 218.27 311.83 30.00% 83.76 83.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.90% 2.20 0 4 73.03 63 91 50.97 0 87 161 230 20.96%
crit 15.10% 0.39 0 4 146.52 125 182 46.94 0 182 57 82 9.61%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.60
main_hand 4311 9.8% 191.9 1.55sec 6725 4334 Direct 191.9 5827 11656 6725 15.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 191.85 191.85 0.00 0.00 0.00 1.5516 0.0000 1290227.82 1843229.59 30.00% 4334.13 4334.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.59% 162.28 117 206 5826.58 1936 13250 5836.99 5262 6559 945564 1350840 30.00%
crit 15.41% 29.57 8 54 11655.82 3871 26501 11676.82 7887 17383 344664 492389 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Monstrous Blow 10 0.0% 1.1 91.08sec 2833 2822 Direct 1.1 2453 4916 2832 15.4%

Stats Details: Monstrous Blow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.11 1.11 0.00 0.00 0.00 1.0045 0.0000 3141.30 4487.68 30.00% 2822.37 2822.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.60% 0.94 0 4 2453.33 2006 3075 746.42 0 2922 2302 3288 9.12%
crit 15.40% 0.17 0 4 4915.75 4012 6151 682.25 0 6151 840 1200 4.16%

Action Details: Monstrous Blow

  • id:91797
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91797
  • name:Monstrous Blow
  • school:physical
  • tooltip:Stunned.
  • description:Strike an enemy with a smashing attack, dealing {$s2=0} Physical damage and stunning for {$d=2 seconds}.

Action Priority List

    default
    [ ]:1.11
Sweeping Claws 1376 3.1% 68.0 4.29sec 6049 6021 Direct 68.0 5243 10493 6049 15.3%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.04 68.04 0.00 0.00 0.00 1.0045 0.0000 411516.96 411516.96 0.00% 6021.44 6021.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.65% 57.59 38 75 5242.63 3796 8518 5244.76 4913 5689 301939 301939 0.00%
crit 15.35% 10.44 0 23 10492.70 7592 17037 10492.49 0 13595 109578 109578 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:68.04
pet - gargoyle 31140 / 5253
Gargoyle Strike 31140 11.8% 39.8 5.31sec 39149 36104 Direct 39.8 33958 67815 39149 15.3%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.76 39.76 0.00 0.00 0.00 1.0844 0.0000 1556544.80 1556544.80 0.00% 36103.84 36103.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.67% 33.66 21 40 33958.16 6177 71873 33956.75 27696 40183 1143182 1143182 0.00%
crit 15.33% 6.10 0 15 67815.45 12557 141674 67757.21 0 128065 413363 413363 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.

Action Priority List

    default
    [ ]:41.76
pet - risen_skulker 1182 / 1182
Skulker Shot 1182 2.7% 153.8 1.94sec 2304 1185 Direct 153.7 1998 3996 2305 15.4%

Stats Details: Skulker Shot

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.80 153.74 0.00 0.00 0.00 1.9440 0.0000 354330.35 506199.13 30.00% 1185.15 1185.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.64% 130.13 94 165 1997.90 1469 3351 1998.56 1892 2105 259988 371421 30.00%
crit 15.36% 23.61 6 44 3995.97 2937 6610 3997.56 3540 4806 94342 134778 30.00%

Action Details: Skulker Shot

  • id:212423
  • school:physical
  • range:35.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:212423
  • name:Skulker Shot
  • school:physical
  • tooltip:
  • description:A ranged shot that causes Physical damage.

Action Priority List

    default
    [ ]:154.80
pet - magus_of_the_dead 7626 / 3386
Frostbolt 2267 2.3% 34.5 8.54sec 8710 6182 Direct 34.4 7558 15069 8712 15.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.45 34.45 0.00 0.00 0.00 1.4088 0.0000 300092.94 300092.94 0.00% 6182.38 6182.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.64% 29.16 19 38 7558.36 3824 11982 7559.29 6658 8265 220380 220380 0.00%
crit 15.36% 5.29 0 15 15068.80 7648 23633 15041.06 0 22641 79713 79713 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:19.31
    default
    [ ]:18.99
Shadow Bolt 5359 5.4% 82.3 3.51sec 8610 6640 Direct 82.3 7467 14945 8612 15.3%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.30 82.28 0.00 0.00 0.00 1.2966 0.0000 708606.43 708606.43 0.00% 6640.18 6640.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.69% 69.68 50 87 7466.82 3658 11269 7467.03 6625 8162 520320 520320 0.00%
crit 15.31% 12.60 3 26 14944.53 7316 22537 14945.79 11069 18825 188286 188286 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:44.06
    default
    [ ]:43.38
pet - army_ghoul 24506 / 5537
Claw 4013 2.0% 212.2 1.02sec 1266 1266 Direct 212.2 1097 2195 1266 15.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 212.20 212.20 0.00 0.00 0.00 1.0000 0.0000 268555.85 383660.99 30.00% 1265.56 1265.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.66% 179.66 145 203 1097.21 525 1564 1096.70 931 1193 197127 281617 30.00%
crit 15.34% 32.54 13 53 2194.93 1050 3129 2194.09 1669 2535 71429 102044 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:26.46
    default
    [ ]:26.51
    default
    [ ]:26.49
    default
    [ ]:26.54
    default
    [ ]:26.56
    default
    [ ]:26.53
    default
    [ ]:26.58
    default
    [ ]:26.54
main_hand 20494 10.4% 347.8 0.62sec 3944 3489 Direct 347.8 3418 6833 3944 15.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 347.82 347.82 0.00 0.00 0.00 1.1302 0.0000 1371647.53 1959546.43 30.00% 3489.38 3489.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.60% 294.26 235 321 3417.58 1571 4746 3415.75 2844 3691 1005666 1436702 30.00%
crit 15.40% 53.56 30 82 6833.39 3142 9364 6829.56 5154 7596 365982 522844 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - apoc_ghoul 7935 / 2713
Claw 1696 1.3% 153.1 1.83sec 1134 1134 Direct 153.1 983 1966 1134 15.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.08 153.08 0.00 0.00 0.00 1.0000 0.0000 173608.94 248019.09 30.00% 1134.11 1134.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.61% 129.52 78 170 982.83 542 1521 983.28 878 1072 127300 181862 30.00%
crit 15.39% 23.56 7 43 1965.90 1102 2999 1966.73 1662 2288 46309 66157 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:38.04
    default
    [ ]:38.56
    default
    [ ]:38.53
    default
    [ ]:37.95
main_hand 6240 4.9% 182.0 1.53sec 3509 2542 Direct 182.0 3043 6087 3509 15.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 182.05 182.05 0.00 0.00 0.00 1.3804 0.0000 638889.52 912722.58 30.00% 2542.40 2542.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.68% 154.15 95 201 3043.04 1623 4552 3045.27 2694 3332 469092 670148 30.00%
crit 15.32% 27.90 7 52 6086.72 3298 8976 6091.53 5101 7165 169798 242574 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Army of the Dead 2.0 0.00sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 1.1677 0.5000 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    default
    [D]:2.00
  • if_expr:talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 182.80sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [c]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 166.10sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.42 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [P]:2.42
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 306.35sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [L]:0.46
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
    opener
    [X]:1.00
  • if_expr:pet.gargoyle.active|!talent.summon_gargoyle&pet.army_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Algeth'ar Puzzle (solved_the_puzzle) 2.0 182.81sec

Stats Details: Solved The Puzzle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Solved The Puzzle

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
Summon Gargoyle 2.0 185.83sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [Q]:1.00
  • if_expr:buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
    opener
    [W]:1.00
  • if_expr:buff.commander_of_the_dead_window.up
Unholy Strength 21.4 13.63sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.43 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 2.0 182.8sec 60.9sec 20.0sec 13.51% 0.00% 2.0 (2.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3273.11
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3273.11

Trigger Details

  • interval_min/max:181.2s / 231.7s
  • trigger_min/max:0.0s / 231.7s
  • trigger_pct:100.00%
  • duration_min/max:16.7s / 20.0s

Stack Uptimes

  • algethar_puzzle_1:13.51%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.8sec 182.8sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 231.8s
  • trigger_min/max:180.0s / 231.8s
  • trigger_pct:100.00%
  • duration_min/max:7.3s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
commander_of_the_dead_window 7.0 0.0 45.6sec 45.6sec 4.0sec 9.30% 44.47% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead_window
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 54.0s
  • trigger_min/max:45.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s

Stack Uptimes

  • commander_of_the_dead_window_1:9.30%
Dark Transformation 7.0 0.0 45.6sec 45.6sec 22.1sec 51.71% 58.15% 0.0 (0.0) 6.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 54.0s
  • trigger_min/max:45.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.0s

Stack Uptimes

  • dark_transformation_1:51.71%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.5sec 120.5sec 0.7sec 0.62% 0.00% 6.8 (6.8) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.59
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 124.9s
  • trigger_min/max:120.0s / 124.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s

Stack Uptimes

  • dragon_games_equipment_1:0.62%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.3sec 306.3sec 27.3sec 13.03% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 327.0s
  • trigger_min/max:300.0s / 327.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.03%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 166.1sec 166.1sec 19.3sec 15.48% 0.00% 7.0 (7.0) 2.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 231.0s
  • trigger_min/max:120.0s / 231.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.48%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Festermight 13.3 70.8 23.1sec 3.5sec 19.3sec 85.29% 0.00% 0.0 (0.0) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 45.7s
  • trigger_min/max:0.8s / 26.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:8.80%
  • festermight_2:9.42%
  • festermight_3:10.46%
  • festermight_4:15.56%
  • festermight_5:9.96%
  • festermight_6:8.30%
  • festermight_7:6.85%
  • festermight_8:5.73%
  • festermight_9:4.06%
  • festermight_10:2.92%
  • festermight_11:1.73%
  • festermight_12:0.97%
  • festermight_13:0.41%
  • festermight_14:0.11%
  • festermight_15:0.01%
  • festermight_16:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 8.2 87.6 38.7sec 3.1sec 34.3sec 93.12% 75.44% 72.8 (72.8) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 233.8s
  • trigger_min/max:0.8s / 17.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 230.6s

Stack Uptimes

  • icy_talons_1:6.57%
  • icy_talons_2:7.03%
  • icy_talons_3:79.52%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 11.9 8.0 25.0sec 14.6sec 10.6sec 42.12% 0.00% 8.0 (8.0) 11.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 167.1s
  • trigger_min/max:0.8s / 154.3s
  • trigger_pct:14.95%
  • duration_min/max:0.0s / 70.8s

Stack Uptimes

  • rune_mastery_1:42.12%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 40.8 5.2 7.2sec 6.4sec 2.6sec 35.21% 0.00% 5.2 (5.2) 40.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 77.2s
  • trigger_min/max:0.8s / 77.2s
  • trigger_pct:48.02%
  • duration_min/max:0.0s / 17.8s

Stack Uptimes

  • runic_corruption_1:35.21%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 20.4 0.2 14.3sec 14.1sec 1.1sec 7.17% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.4s / 58.5s
  • trigger_min/max:1.4s / 58.5s
  • trigger_pct:14.37%
  • duration_min/max:0.0s / 11.3s

Stack Uptimes

  • sudden_doom_1:7.17%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.7 0.0 90.7sec 90.7sec 19.5sec 23.86% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 94.1s
  • trigger_min/max:90.0s / 94.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • unholy_assault_1:23.86%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Pact 7.0 0.0 45.6sec 45.6sec 14.7sec 34.34% 37.66% 96.1 (96.1) 6.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_pact
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:45.0s / 54.0s
  • trigger_min/max:45.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • unholy_pact_1:34.34%

Spelldata

  • id:319233
  • name:Unholy Pact
  • tooltip:
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 13.0 36.3sec 13.7sec 24.5sec 68.80% 0.00% 13.0 (13.0) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 167.3s
  • trigger_min/max:0.0s / 57.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 160.8s

Stack Uptimes

  • unholy_strength_1:68.80%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.6 0.0 47.7sec 47.7sec 14.7sec 99.95% 99.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 183.7s
  • trigger_min/max:45.0s / 183.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.95%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.7 0.0 47.0sec 47.0sec 14.7sec 99.95% 99.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 226.2s
  • trigger_min/max:45.0s / 226.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.95%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.8 0.0 46.9sec 46.9sec 14.7sec 99.94% 99.94% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 184.3s
  • trigger_min/max:45.0s / 184.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.94%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.7 0.0 47.5sec 47.5sec 14.7sec 99.95% 99.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 182.8s
  • trigger_min/max:45.0s / 182.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.95%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.3sec 186.3sec 28.6sec 92.71% 97.54% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 231.6s
  • trigger_min/max:180.8s / 231.6s
  • trigger_pct:100.00%
  • duration_min/max:6.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.71%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.2sec 186.2sec 28.4sec 92.39% 97.63% 0.0 (0.0) 0.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 231.4s
  • trigger_min/max:180.0s / 231.4s
  • trigger_pct:100.00%
  • duration_min/max:6.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.39%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.2sec 186.2sec 28.5sec 92.65% 97.63% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 231.4s
  • trigger_min/max:180.5s / 231.4s
  • trigger_pct:100.00%
  • duration_min/max:6.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.65%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.3sec 186.3sec 28.6sec 92.26% 97.13% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 231.6s
  • trigger_min/max:180.8s / 231.6s
  • trigger_pct:100.00%
  • duration_min/max:6.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.26%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.4sec 186.4sec 28.6sec 92.60% 97.51% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 231.6s
  • trigger_min/max:180.8s / 231.6s
  • trigger_pct:100.00%
  • duration_min/max:6.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.60%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.4sec 186.4sec 28.5sec 91.68% 96.83% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 231.6s
  • trigger_min/max:180.8s / 231.6s
  • trigger_pct:100.00%
  • duration_min/max:6.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.68%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.4sec 186.4sec 28.5sec 91.83% 97.15% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 231.6s
  • trigger_min/max:180.5s / 231.6s
  • trigger_pct:100.00%
  • duration_min/max:6.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.83%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.5sec 186.5sec 28.4sec 91.56% 97.16% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 231.9s
  • trigger_min/max:180.0s / 231.9s
  • trigger_pct:100.00%
  • duration_min/max:6.9s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.56%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Commander of the Dead 2.0 0.0 185.8sec 185.8sec 25.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:182.3s / 235.0s
  • trigger_min/max:182.3s / 235.0s
  • trigger_pct:100.00%
  • duration_min/max:7.2s / 25.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 187.3sec 187.3sec 23.2sec 92.92% 99.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.6s / 236.7s
  • trigger_min/max:181.6s / 236.7s
  • trigger_pct:100.00%
  • duration_min/max:6.2s / 25.0s

Stack Uptimes

  • dark_empowerment_1:92.92%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.5 0.0 65.3sec 65.3sec 17.3sec 97.24% 97.61% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:41.0s / 231.4s
  • trigger_min/max:41.0s / 231.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.24%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.4 0.0 66.3sec 66.3sec 17.3sec 97.24% 97.60% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:42.4s / 232.2s
  • trigger_min/max:42.4s / 232.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.24%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 24.7 9.0 44.0 11.9s 1.4s 118.5s
delayed_aa_cast 2.0 2.0 2.0 182.5s 181.0s 231.1s
Rune ready 155.3 117.0 199.0 2.0s 0.0s 11.5s
Runic Corruption from Runic Power Spent 46.0 23.0 73.0 6.4s 0.8s 77.2s
Festering Wound from Festering Strike 65.4 43.0 91.0 11.5s 1.0s 68.5s
Festering Wound from Infected Claws 31.8 14.0 54.0 9.3s 1.0s 98.9s
Festering Wound from Unholy Assault 14.7 12.0 16.0 90.7s 90.0s 94.1s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 4.17% 0.00% 16.68% 2.4s 0.0s 18.6s
ghoul - Energy Cap 0.40% 0.16% 1.35% 0.2s 0.0s 1.0s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=301444)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1002.080 / 1.1548.09027.549
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
41.60363.29783.597 / 82.900106.201137.433

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Army of the Dead5.5430.00240.9855.3090.00040.985
Dark Transformation0.6200.0019.0483.6480.92013.206
Apocalypse0.5030.0019.0112.9460.20412.489
Empower Rune Weapon46.7450.005110.96265.41157.484110.962
Summon Gargoyle5.7762.28655.0445.7762.28655.044
Unholy Assault0.7890.0014.0591.9280.0007.395
Soul Reaper0.9180.00111.04712.5424.80725.671

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
ApocalypseRune13.9613.938.97%1.000.030.23%
Empower Rune WeaponRunic Power11.5953.852.32%4.654.117.09%
Empower Rune WeaponRune11.5910.977.06%0.950.625.37%
Festering WoundRunic Power103.93298.9712.88%2.8812.834.11%
Rune RegenerationRune130.41130.4183.97%1.000.000.00%
Runic AttenuationRunic Power73.86353.4515.23%4.7915.874.30%
Army of the DeadRunic Power2.0019.750.85%9.870.251.25%
Festering StrikeRunic Power26.17502.7321.67%19.2120.613.94%
OutbreakRunic Power11.86114.364.93%9.644.283.60%
Scourge StrikeRunic Power77.13749.6632.31%9.7221.672.81%
Soul ReaperRunic Power15.69145.186.26%9.2511.757.48%
Summon GargoyleRunic Power2.0082.473.55%41.2317.5317.53%
pet - ghoul
Dark TransformationEnergy7.00362.158.68%51.73337.9748.27%
energy_regenEnergy1333.503809.5591.32%2.8654.631.41%
pet - army_ghoul
energy_regenEnergy893.697004.90100.00%7.841079.4613.35%
pet - apoc_ghoul
energy_regenEnergy466.813790.62100.00%8.121694.9830.90%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.001.000.00
Death CoilRunic Power 95.802263.6323.6323.63719.75
Festering StrikeRune 26.1752.332.002.006705.07
OutbreakRune 11.8611.861.001.002120.85
Scourge StrikeRune 77.1377.131.001.008734.97
Soul ReaperRune 15.6915.691.001.0049248.42
pet - ghoul
ClawEnergy 37.901515.9840.0040.0061.91
Sweeping ClawsEnergy 68.042721.4640.0040.00151.21
pet - army_ghoul
ClawEnergy 212.208488.2040.0040.0031.64
pet - apoc_ghoul
ClawEnergy 153.086123.2340.0040.0028.35
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 7.73 7.55 108.9 56.8 0.0 100.0
Rune 6.0 0.52 0.53 0.0 2.3 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 44047.48
Minimum 38482.04
Maximum 50448.76
Spread ( max - min ) 11966.72
Range [ ( max - min ) / 2 * 100% ] 13.58%
Standard Deviation 1936.4468
5th Percentile 41168.59
95th Percentile 47606.27
( 95th Percentile - 5th Percentile ) 6437.67
Mean Distribution
Standard Deviation 22.3617
95.00% Confidence Interval ( 44003.65 - 44091.31 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7425
0.1 Scale Factor Error with Delta=300 32011
0.05 Scale Factor Error with Delta=300 128043
0.01 Scale Factor Error with Delta=300 3201068
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 44047.48
Minimum 38482.04
Maximum 50448.76
Spread ( max - min ) 11966.72
Range [ ( max - min ) / 2 * 100% ] 13.58%
Standard Deviation 1936.4468
5th Percentile 41168.59
95th Percentile 47606.27
( 95th Percentile - 5th Percentile ) 6437.67
Mean Distribution
Standard Deviation 22.3617
95.00% Confidence Interval ( 44003.65 - 44091.31 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7425
0.1 Scale Factor Error with Delta=300 32011
0.05 Scale Factor Error with Delta=300 128043
0.01 Scale Factor Error with Delta=300 3201068
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 44047.48
Minimum 38482.04
Maximum 50448.76
Spread ( max - min ) 11966.72
Range [ ( max - min ) / 2 * 100% ] 13.58%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 5986571.12
Minimum 4462368.02
Maximum 7461582.39
Spread ( max - min ) 2999214.37
Range [ ( max - min ) / 2 * 100% ] 25.05%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 fleshcraft
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%45=0)
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%45=0)
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
B 0.00 variable,name=opener_done,op=setif,value=1,value_else=0,condition=active_enemies>=3
Default action list Executed every time the actor is available.
# count action,conditions
C 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
0.00 variable,name=apoc_timing,op=setif,value=8,value_else=4,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<4
Variables
0.00 variable,name=garg_pooling,op=setif,value=(((cooldown.summon_gargoyle.remains+1)%gcd)%((rune+1)*(runic_power+20)))*100,value_else=gcd,condition=cooldown.summon_gargoyle.remains<gcd*2
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(2-talent.infected_claws),condition=talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
0.00 variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4|fight_remains<debuff.festering_wound.stack*gcd)
0.00 variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=pooling_runes,value=talent.soul_reaper&rune<2&target.time_to_pct_35<5&fight_remains>5
0.00 variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion.
D 2.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
Prioritize Army, Outbreak and Maintaining Plaguebringer
E 11.86 outbreak,target_if=(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
0.00 wound_spender,if=cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
F 0.00 call_action_list,name=opener,if=variable.opener_done=0
Call Action Lists
G 0.00 call_action_list,name=cooldowns
H 0.00 call_action_list,name=trinkets
I 0.00 call_action_list,name=racials
J 0.00 run_action_list,name=aoe,if=active_enemies>=4
K 0.00 run_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
L 0.46 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Potion
0.00 vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
Cooldowns
0.00 abomination_limb,if=rune<2&variable.adds_remain
0.00 raise_dead,if=!pet.ghoul.active
M 5.82 dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
N 0.18 dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
O 5.98 apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&cooldown.dark_transformation.remains
0.00 apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
P 2.42 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
Q 1.00 summon_gargoyle,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
0.00 unholy_blight,if=variable.adds_remain|fight_remains<21
0.00 abomination_limb,if=rune<3&variable.st_planning
R 3.66 unholy_assault,if=variable.st_planning
S 15.69 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
0.00 sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd
actions.generic
# count action,conditions
T 93.67 death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
Generic
0.00 any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
U 77.13 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
V 24.34 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.opener
# count action,conditions
W 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up
Opener
X 1.00 potion,if=pet.gargoyle.active|!talent.summon_gargoyle&pet.army_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up
Y 2.13 death_coil,if=pet.gargoyle.active&!prev_gcd.1.death_coil
Z 1.00 apocalypse,if=buff.commander_of_the_dead_window.up
a 1.00 dark_transformation,if=debuff.festering_wound.stack>=4
b 1.83 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 variable,name=opener_done,op=setif,value=1,value_else=0,condition=cooldown.apocalypse.remains|!talent.apocalypse&(cooldown.dark_transformation.remains|cooldown.summon_gargoyle.remains)
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.blood_fury.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
c 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&15>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.fireblood.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
d 2.00 use_item,slot=trinket1,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets
0.00 use_item,slot=trinket2,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
e 2.74 use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

Sample Sequence

01246789ABCDEbaWXYZYPRdcTUTUUTUTUUTUTTVETTTUTUUTVTUeUTVTUUVTTUUTVTUTEMOUVUTTTUUUTVTUTUUVETTUTTTUUTVTTVTMORUUUETTUUUTTVUTTUVTUTUUTVUTETTVTUTVMOTUUTUVeTTTUEUUTUVTTUUTUVTUTUVTDETMOQPRTdScTTTUTUSTUUTUUSTTTTUESTTVUSTTUUSTTVTMOSUUETSTUTTSTVTUSTUTUSTETSTVeVTSMORTSUUTUTSTUETUSVTTUU

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 6 trinket_1_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 7 trinket_2_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 8 trinket_1_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 9 trinket_2_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat A trinket_priority Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat B opener_done Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default C auto_attack Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default D army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
bloodlust, static_empowerment
0:01.020 default E outbreak Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune
bloodlust, static_empowerment(2)
0:02.040 opener b festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
bloodlust, static_empowerment(3)
0:03.060 opener a dark_transformation Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, static_empowerment(4)
0:03.060 opener W summon_gargoyle Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(4)
0:04.082 opener X potion Fluffy_Pillow 90.0/100: 90% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:04.082 opener Y death_coil Fluffy_Pillow 90.0/100: 90% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.102 opener Z apocalypse Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons, dark_transformation, runic_corruption, unholy_pact, commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.124 opener Y death_coil Fluffy_Pillow 77.0/100: 77% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.144 cooldowns P empower_rune_weapon Fluffy_Pillow 47.0/100: 47% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:07.144 cooldowns R unholy_assault Fluffy_Pillow 52.0/100: 52% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_pact, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:08.032 trinkets d use_item_algethar_puzzle_box Fluffy_Pillow 52.0/100: 52% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:09.014 racials c berserking Fluffy_Pillow 52.0/100: 52% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.014 generic T death_coil Fluffy_Pillow 52.0/100: 52% runic_power
6.0/6: 100% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.770 generic U scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
6.0/6: 100% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.522 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
5.0/6: 83% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.279 generic U scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.035 generic U scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.788 generic T death_coil Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.544 generic U scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.298 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.052 generic U scourge_strike Fluffy_Pillow 9.0/100: 9% runic_power
5.0/6: 83% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.808 generic U scourge_strike Fluffy_Pillow 22.0/100: 22% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.563 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.317 generic U scourge_strike Fluffy_Pillow 15.0/100: 15% runic_power
5.0/6: 83% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.072 generic T death_coil Fluffy_Pillow 33.0/100: 33% runic_power
4.0/6: 67% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.826 generic T death_coil Fluffy_Pillow 33.0/100: 33% runic_power
4.0/6: 67% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.582 generic V festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.338 default E outbreak Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.094 generic T death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.848 generic T death_coil Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.602 generic T death_coil Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.358 generic U scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.113 generic T death_coil Fluffy_Pillow 36.0/100: 36% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.869 generic U scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(12), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.624 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.377 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.132 generic V festering_strike Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.887 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.906 generic U scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.926 trinkets e use_item_dragon_games_equipment Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:29.926 generic U scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), dragon_games_equipment, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.947 generic T death_coil Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:31.967 generic V festering_strike Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:32.989 generic T death_coil Fluffy_Pillow 53.0/100: 53% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:34.010 generic U scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:35.030 generic U scourge_strike Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), static_empowerment(5)
0:36.050 generic V festering_strike Fluffy_Pillow 49.0/100: 49% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
0:37.071 generic T death_coil Fluffy_Pillow 74.0/100: 74% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
0:38.092 generic T death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), runic_corruption, festermight(5), static_empowerment(5)
0:39.112 generic U scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), runic_corruption, festermight(5), static_empowerment(5)
0:40.133 generic U scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(6), static_empowerment(5)
0:41.457 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
0:42.783 generic V festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(7), static_empowerment(5)
0:44.109 generic T death_coil Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
0:45.436 generic U scourge_strike Fluffy_Pillow 5.0/100: 5% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
0:46.761 generic T death_coil Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, static_empowerment(5)
0:48.086 default E outbreak Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
0:49.412 cooldowns M dark_transformation Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
0:50.736 cooldowns O apocalypse Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:52.062 generic U scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
6.0/6: 100% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
0:53.386 generic V festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
5.0/6: 83% rune
unholy_strength, dark_transformation, unholy_pact, festermight(5), commander_of_the_dead_window, static_empowerment(5)
0:54.711 generic U scourge_strike Fluffy_Pillow 83.0/100: 83% runic_power
3.0/6: 50% rune
unholy_strength, dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
0:56.037 generic T death_coil Fluffy_Pillow 96.0/100: 96% runic_power
2.0/6: 33% rune
unholy_strength, dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
0:57.363 generic T death_coil Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
0:58.687 generic T death_coil Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), dark_transformation, runic_corruption, unholy_pact, festermight(6), static_empowerment(5)
1:00.011 generic U scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(6), static_empowerment(5)
1:01.336 generic U scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), static_empowerment(5)
1:02.662 generic U scourge_strike Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), static_empowerment(5)
1:03.986 generic T death_coil Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(9), static_empowerment(5)
1:05.312 generic V festering_strike Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
1:06.636 generic T death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
1:07.963 generic U scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(9), static_empowerment(5)
1:09.289 generic T death_coil Fluffy_Pillow 63.0/100: 63% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, festermight(10), static_empowerment(5)
1:10.615 generic U scourge_strike Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight(10), static_empowerment(5)
1:11.940 generic U scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
icy_talons(3), static_empowerment(5)
1:13.264 generic V festering_strike Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune
icy_talons(3), festermight, static_empowerment(5)
1:14.591 default E outbreak Fluffy_Pillow 84.0/100: 84% runic_power
1.0/6: 17% rune
icy_talons(3), sudden_doom, festermight, static_empowerment(5)
1:15.916 generic T death_coil Fluffy_Pillow 94.0/100: 94% runic_power
0.0/6: 0% rune
sudden_doom, festermight, static_empowerment(5)
1:17.239 generic T death_coil Fluffy_Pillow 99.0/100: 99% runic_power
2.0/6: 33% rune
icy_talons, runic_corruption, festermight, static_empowerment(5)
1:18.564 generic U scourge_strike Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune
icy_talons(2), festermight, static_empowerment(5)
1:19.891 generic T death_coil Fluffy_Pillow 87.0/100: 87% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), festermight(2), static_empowerment(5)
1:21.217 generic T death_coil Fluffy_Pillow 57.0/100: 57% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
1:22.542 generic T death_coil Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(2), static_empowerment(5)
1:23.869 generic U scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
1:25.194 generic U scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
1:26.520 generic T death_coil Fluffy_Pillow 58.0/100: 58% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
1:27.845 generic V festering_strike Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
1:29.172 generic T death_coil Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
1:30.499 generic T death_coil Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(4), static_empowerment(5)
1:31.824 generic V festering_strike Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
1:33.150 generic T death_coil Fluffy_Pillow 43.0/100: 43% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), static_empowerment(5)
1:34.476 cooldowns M dark_transformation Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, static_empowerment(5)
1:35.803 cooldowns O apocalypse Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
1:37.130 cooldowns R unholy_assault Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
1:38.469 generic U scourge_strike Fluffy_Pillow 30.0/100: 30% runic_power
6.0/6: 100% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
1:39.575 generic U scourge_strike Fluffy_Pillow 43.0/100: 43% runic_power
5.0/6: 83% rune
unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(5), static_empowerment(5)
1:40.680 generic U scourge_strike Fluffy_Pillow 61.0/100: 61% runic_power
4.0/6: 67% rune
unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
1:41.785 default E outbreak Fluffy_Pillow 74.0/100: 74% runic_power
3.0/6: 50% rune
unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
1:42.890 generic T death_coil Fluffy_Pillow 84.0/100: 84% runic_power
2.0/6: 33% rune
unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
1:43.997 generic T death_coil Fluffy_Pillow 54.0/100: 54% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
1:45.103 generic U scourge_strike Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
1:46.209 generic U scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(8), static_empowerment(5)
1:47.314 generic U scourge_strike Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(9), static_empowerment(5)
1:48.422 generic T death_coil Fluffy_Pillow 98.0/100: 98% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(10), static_empowerment(5)
1:49.527 generic T death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), static_empowerment(5)
1:50.632 generic V festering_strike Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, unholy_assault, festermight(10), static_empowerment(5)
1:51.736 generic U scourge_strike Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(10), static_empowerment(5)
1:52.842 generic T death_coil Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(11), static_empowerment(5)
1:53.947 generic T death_coil Fluffy_Pillow 46.0/100: 46% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), static_empowerment(5)
1:55.053 generic U scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), static_empowerment(5)
1:56.158 generic V festering_strike Fluffy_Pillow 29.0/100: 29% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, unholy_assault, static_empowerment(5)
1:57.264 generic T death_coil Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
1:58.590 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
1:59.915 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
2:01.240 generic U scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
2:02.564 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
2:03.890 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
2:05.218 generic V festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
2:06.542 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
2:07.868 generic T death_coil Fluffy_Pillow 46.0/100: 46% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(4), static_empowerment(5)
2:09.194 default E outbreak Fluffy_Pillow 46.0/100: 46% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:10.520 generic T death_coil Fluffy_Pillow 56.0/100: 56% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(4), static_empowerment(5)
2:11.844 generic T death_coil Fluffy_Pillow 56.0/100: 56% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:13.170 generic V festering_strike Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4), static_empowerment(5)
2:14.494 generic T death_coil Fluffy_Pillow 46.0/100: 46% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:15.821 generic U scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4), static_empowerment(5)
2:17.146 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
2:18.471 generic V festering_strike Fluffy_Pillow 4.0/100: 4% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
2:19.796 cooldowns M dark_transformation Fluffy_Pillow 24.0/100: 24% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), static_empowerment(5)
2:21.123 cooldowns O apocalypse Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune
icy_talons(3), dark_transformation, sudden_doom, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
2:22.448 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
2:23.775 generic U scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
2:25.099 generic U scourge_strike Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
2:26.424 generic T death_coil Fluffy_Pillow 72.0/100: 72% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
2:27.748 generic U scourge_strike Fluffy_Pillow 42.0/100: 42% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(6), static_empowerment(5)
2:29.074 generic V festering_strike Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
2:30.399 trinkets e use_item_dragon_games_equipment Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
2:30.399 generic T death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), dragon_games_equipment, static_empowerment(5)
2:31.723 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
2:33.047 generic T death_coil Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_pact, festermight(7), static_empowerment(5)
2:34.374 generic U scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), static_empowerment(5)
2:35.701 default E outbreak Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(8), static_empowerment(5)
2:37.026 generic U scourge_strike Fluffy_Pillow 48.0/100: 48% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(8), static_empowerment(5)
2:38.352 generic U scourge_strike Fluffy_Pillow 61.0/100: 61% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
2:39.679 generic T death_coil Fluffy_Pillow 74.0/100: 74% runic_power
2.0/6: 33% rune
dark_transformation, festermight(10), static_empowerment(5)
2:41.004 generic U scourge_strike Fluffy_Pillow 49.0/100: 49% runic_power
3.0/6: 50% rune
icy_talons, runic_corruption, festermight(10), static_empowerment(5)
2:42.328 generic V festering_strike Fluffy_Pillow 62.0/100: 62% runic_power
3.0/6: 50% rune
icy_talons, static_empowerment(5)
2:43.656 generic T death_coil Fluffy_Pillow 87.0/100: 87% runic_power
2.0/6: 33% rune
icy_talons, static_empowerment(5)
2:44.982 generic T death_coil Fluffy_Pillow 57.0/100: 57% runic_power
2.0/6: 33% rune
icy_talons(2), runic_corruption, static_empowerment(5)
2:46.306 generic U scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
icy_talons(3), static_empowerment(5)
2:47.630 generic U scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
icy_talons(3), festermight, static_empowerment(5)
2:48.956 generic T death_coil Fluffy_Pillow 53.0/100: 53% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
2:50.280 generic U scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
2:51.605 generic V festering_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
2:52.929 generic T death_coil Fluffy_Pillow 61.0/100: 61% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
2:54.255 generic U scourge_strike Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(3), static_empowerment(5)
2:55.581 generic T death_coil Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:56.905 generic U scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), static_empowerment(5)
2:58.230 generic V festering_strike Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
2:59.555 generic T death_coil Fluffy_Pillow 57.0/100: 57% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:00.879 default D army_of_the_dead Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(5), static_empowerment(5)
3:02.203 default E outbreak Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:03.528 generic T death_coil Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:04.851 cooldowns M dark_transformation Fluffy_Pillow 22.0/100: 22% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:06.176 cooldowns O apocalypse Fluffy_Pillow 22.0/100: 22% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), commander_of_the_dead_window, static_empowerment(5)
3:07.500 cooldowns Q summon_gargoyle Fluffy_Pillow 34.0/100: 34% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:07.500 cooldowns P empower_rune_weapon Fluffy_Pillow 84.0/100: 84% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:07.500 cooldowns R unholy_assault Fluffy_Pillow 89.0/100: 89% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:08.654 generic T death_coil Fluffy_Pillow 89.0/100: 89% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:09.614 trinkets d use_item_algethar_puzzle_box Fluffy_Pillow 59.0/100: 59% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, unholy_pact, static_empowerment(5)
3:10.891 cooldowns S soul_reaper Fluffy_Pillow 59.0/100: 59% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, algethar_puzzle, static_empowerment(5)
3:11.853 racials c berserking Fluffy_Pillow 69.0/100: 69% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, algethar_puzzle, static_empowerment(5)
3:11.853 generic T death_coil Fluffy_Pillow 69.0/100: 69% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, algethar_puzzle, static_empowerment(5)
3:12.727 generic T death_coil Fluffy_Pillow 79.0/100: 79% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, algethar_puzzle, static_empowerment(5)
3:13.602 generic T death_coil Fluffy_Pillow 49.0/100: 49% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, static_empowerment(5)
3:14.477 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, algethar_puzzle, static_empowerment(5)
3:15.352 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight, algethar_puzzle, static_empowerment(5)
3:16.226 generic U scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
5.0/6: 83% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight, algethar_puzzle, static_empowerment(5)
3:17.102 cooldowns S soul_reaper Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(2), algethar_puzzle, static_empowerment(5)
3:17.975 generic T death_coil Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(2), algethar_puzzle, static_empowerment(5)
3:18.849 generic U scourge_strike Fluffy_Pillow 5.0/100: 5% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(2), algethar_puzzle, static_empowerment(5)
3:19.724 generic U scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(3), algethar_puzzle, static_empowerment(5)
3:20.598 generic T death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), algethar_puzzle, static_empowerment(5)
3:21.474 generic U scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
4.0/6: 67% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(4), algethar_puzzle, static_empowerment(5)
3:22.346 generic U scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(5), algethar_puzzle, static_empowerment(5)
3:23.221 cooldowns S soul_reaper Fluffy_Pillow 47.0/100: 47% runic_power
3.0/6: 50% rune
berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(6), algethar_puzzle, static_empowerment(5)
3:24.095 generic T death_coil Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(6), algethar_puzzle, static_empowerment(5)
3:25.056 generic T death_coil Fluffy_Pillow 62.0/100: 62% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), algethar_puzzle, static_empowerment(5)
3:26.015 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), algethar_puzzle, static_empowerment(5)
3:26.978 generic T death_coil Fluffy_Pillow 2.0/100: 2% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(6), algethar_puzzle, static_empowerment(5)
3:27.939 generic U scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(6), algethar_puzzle, static_empowerment(5)
3:29.265 default E outbreak Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune
rune_mastery, icy_talons(3), dark_transformation, runic_corruption, festermight(7), algethar_puzzle, static_empowerment(5)
3:30.590 cooldowns S soul_reaper Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, festermight(7), algethar_puzzle, static_empowerment(5)
3:31.915 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(7), static_empowerment(5)
3:33.241 generic T death_coil Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
icy_talons(3), sudden_doom, festermight(7), static_empowerment(5)
3:34.565 generic V festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
icy_talons(3), runic_corruption, static_empowerment(5)
3:35.889 generic U scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
icy_talons(3), static_empowerment(5)
3:37.214 cooldowns S soul_reaper Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight, static_empowerment(5)
3:38.540 generic T death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, static_empowerment(5)
3:39.867 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight, static_empowerment(5)
3:41.193 generic U scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
3:42.518 generic U scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(2), static_empowerment(5)
3:43.843 cooldowns S soul_reaper Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), sudden_doom, festermight(3), static_empowerment(5)
3:45.168 generic T death_coil Fluffy_Pillow 54.0/100: 54% runic_power
2.0/6: 33% rune
icy_talons(3), sudden_doom, festermight(3), static_empowerment(5)
3:46.494 generic T death_coil Fluffy_Pillow 59.0/100: 59% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(3), static_empowerment(5)
3:47.820 generic V festering_strike Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(3), static_empowerment(5)
3:49.144 generic T death_coil Fluffy_Pillow 49.0/100: 49% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(3), static_empowerment(5)
3:50.472 cooldowns M dark_transformation Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(3), static_empowerment(5)
3:51.798 cooldowns O apocalypse Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(3), commander_of_the_dead_window, static_empowerment(5)
3:53.125 cooldowns S soul_reaper Fluffy_Pillow 31.0/100: 31% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), commander_of_the_dead_window, static_empowerment(5)
3:54.449 generic U scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), commander_of_the_dead_window, static_empowerment(5)
3:55.775 generic U scourge_strike Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune
unholy_strength, dark_transformation, unholy_pact, festermight(8), static_empowerment(5)
3:57.100 default E outbreak Fluffy_Pillow 77.0/100: 77% runic_power
2.0/6: 33% rune
unholy_strength, dark_transformation, sudden_doom, unholy_pact, static_empowerment(5)
3:58.425 generic T death_coil Fluffy_Pillow 87.0/100: 87% runic_power
1.0/6: 17% rune
unholy_strength, dark_transformation, sudden_doom, unholy_pact, static_empowerment(5)
3:59.751 cooldowns S soul_reaper Fluffy_Pillow 87.0/100: 87% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, static_empowerment(5)
4:01.075 generic T death_coil Fluffy_Pillow 97.0/100: 97% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, static_empowerment(5)
4:02.401 generic U scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), dark_transformation, runic_corruption, unholy_pact, static_empowerment(5)
4:03.727 generic T death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight, static_empowerment(5)
4:05.053 generic T death_coil Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight, static_empowerment(5)
4:06.378 cooldowns S soul_reaper Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight, static_empowerment(5)
4:07.704 generic T death_coil Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, static_empowerment(5)
4:09.032 generic V festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, static_empowerment(5)
4:10.358 generic T death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, static_empowerment(5)
4:11.684 generic U scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, static_empowerment(5)
4:13.008 cooldowns S soul_reaper Fluffy_Pillow 13.0/100: 13% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
4:14.333 generic T death_coil Fluffy_Pillow 28.0/100: 28% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(2), static_empowerment(5)
4:15.658 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(2), static_empowerment(5)
4:16.985 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(3), static_empowerment(5)
4:18.311 generic U scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(3), static_empowerment(5)
4:19.637 cooldowns S soul_reaper Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(4), static_empowerment(5)
4:20.963 generic T death_coil Fluffy_Pillow 39.0/100: 39% runic_power
0.0/6: 0% rune
icy_talons(3), festermight(4), static_empowerment(5)
4:22.288 Waiting     0.682 sec 14.0/100: 14% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(4), static_empowerment(5)
4:22.970 default E outbreak Fluffy_Pillow 14.0/100: 14% runic_power
1.0/6: 17% rune
icy_talons(3), static_empowerment(5)
4:24.295 generic T death_coil Fluffy_Pillow 24.0/100: 24% runic_power
1.0/6: 17% rune
icy_talons(3), sudden_doom, static_empowerment(5)
4:25.621 cooldowns S soul_reaper Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
icy_talons(3), static_empowerment(5)
4:26.962 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
4:28.288 Waiting     0.506 sec 4.0/100: 4% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
4:28.794 generic V festering_strike Fluffy_Pillow 4.0/100: 4% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
4:30.119 Waiting     0.092 sec 29.0/100: 29% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
4:30.211 trinkets e use_item_dragon_games_equipment Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
4:30.399 Waiting     0.182 sec 29.0/100: 29% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dragon_games_equipment, static_empowerment(5)
4:30.581 generic V festering_strike Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dragon_games_equipment, static_empowerment(5)
4:31.906 generic T death_coil Fluffy_Pillow 49.0/100: 49% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
4:33.233 Waiting     1.068 sec 19.0/100: 19% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
4:34.301 cooldowns S soul_reaper Fluffy_Pillow 19.0/100: 19% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
4:35.626 cooldowns M dark_transformation Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, static_empowerment(5)
4:36.952 cooldowns O apocalypse Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
4:38.279 cooldowns R unholy_assault Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, dark_transformation, sudden_doom, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
4:39.604 generic T death_coil Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
4:40.711 cooldowns S soul_reaper Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(4), static_empowerment(5)
4:41.816 generic U scourge_strike Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(4), static_empowerment(5)
4:42.923 generic U scourge_strike Fluffy_Pillow 74.0/100: 74% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(5), static_empowerment(5)
4:44.027 generic T death_coil Fluffy_Pillow 87.0/100: 87% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
4:45.134 generic U scourge_strike Fluffy_Pillow 62.0/100: 62% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
4:46.242 generic T death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
4:47.347 cooldowns S soul_reaper Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
4:48.454 generic T death_coil Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
4:49.557 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
4:50.662 default E outbreak Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), static_empowerment(5)
4:51.767 generic T death_coil Fluffy_Pillow 48.0/100: 48% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), static_empowerment(5)
4:52.874 generic U scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), static_empowerment(5)
4:53.980 cooldowns S soul_reaper Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(9), static_empowerment(5)
4:55.086 generic V festering_strike Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(9), static_empowerment(5)
4:56.191 generic T death_coil Fluffy_Pillow 66.0/100: 66% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), unholy_assault, festermight(9), static_empowerment(5)
4:57.297 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, unholy_assault, static_empowerment(5)
4:58.400 generic U scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
4:59.725 generic U scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6227 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3463 0 12965 12348 6827
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 259300 246960 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 15.36% 15.36% 1504
Haste 13.49% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6538 5922 0
Mastery 44.26% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +687 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +687 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/fleshcraft
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=opener_done,op=setif,value=1,value_else=0,condition=active_enemies>=3

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
# Variables
actions+=/variable,name=apoc_timing,op=setif,value=8,value_else=4,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<4
actions+=/variable,name=garg_pooling,op=setif,value=(((cooldown.summon_gargoyle.remains+1)%gcd)%((rune+1)*(runic_power+20)))*100,value_else=gcd,condition=cooldown.summon_gargoyle.remains<gcd*2
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(2-talent.infected_claws),condition=talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
actions+=/variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4|fight_remains<debuff.festering_wound.stack*gcd)
actions+=/variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=pooling_runes,value=talent.soul_reaper&rune<2&target.time_to_pct_35<5&fight_remains>5
actions+=/variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
# Prioritize Army, Outbreak and Maintaining Plaguebringer
actions+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
actions+=/outbreak,target_if=(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
actions+=/wound_spender,if=cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
# Call Action Lists
actions+=/call_action_list,name=opener,if=variable.opener_done=0
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=aoe,if=active_enemies>=4
actions+=/run_action_list,name=generic,if=active_enemies<=3

# AoE Action List
actions.aoe=any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(talent.festermight&buff.festermight.remains<3|!talent.festermight)&(death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets=8|!talent.bursting_sores&!talent.vile_contagion|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5|(cooldown.vile_contagion.remains|!talent.vile_contagion)&buff.dark_transformation.up&talent.infected_claws&(buff.empower_rune_weapon.up|buff.unholy_assault.up))|fight_remains<10
actions.aoe+=/scourge_strike,if=talent.superstrain&talent.ebon_fever&talent.plaguebringer&buff.plaguebringer.remains<gcd
actions.aoe+=/epidemic,if=!talent.bursting_sores&!variable.pooling_runic_power&active_enemies>=6
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!death_and_decay.ticking&debuff.festering_wound.stack<4&(cooldown.vile_contagion.remains<5|cooldown.apocalypse.ready&cooldown.any_dnd.remains)
actions.aoe+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!death_and_decay.ticking&(cooldown.vile_contagion.remains>5|!talent.vile_contagion)
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=death_and_decay.ticking
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe+=/epidemic,if=!variable.pooling_runic_power
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=cooldown.death_and_decay.remains>10

# Potion
actions.cooldowns=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
# Cooldowns
actions.cooldowns+=/vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.cooldowns+=/abomination_limb,if=rune<2&variable.adds_remain
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
actions.cooldowns+=/dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&cooldown.dark_transformation.remains
actions.cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
actions.cooldowns+=/summon_gargoyle,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
actions.cooldowns+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
actions.cooldowns+=/unholy_blight,if=variable.adds_remain|fight_remains<21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.cooldowns+=/sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# Generic
actions.generic=death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
actions.generic+=/any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Opener
actions.opener=summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up
actions.opener+=/potion,if=pet.gargoyle.active|!talent.summon_gargoyle&pet.army_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up
actions.opener+=/death_coil,if=pet.gargoyle.active&!prev_gcd.1.death_coil
actions.opener+=/apocalypse,if=buff.commander_of_the_dead_window.up
actions.opener+=/dark_transformation,if=debuff.festering_wound.stack>=4
actions.opener+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.opener+=/variable,name=opener_done,op=setif,value=1,value_else=0,condition=cooldown.apocalypse.remains|!talent.apocalypse&(cooldown.dark_transformation.remains|cooldown.summon_gargoyle.remains)

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.blood_fury.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&15>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.fireblood.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,slot=trinket1,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=6827
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 42114 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
42114.0 42114.0 32.4 / 0.077% 5545.8 / 13.2% 150.8
APS APS Error APS Range APR
513.7 2.0 / 0.394% 254.6 / 49.6% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
223.2 221.8 Mana 0.00% 45.3 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIk04ABAAAAAAAAAAAAQikkSESRLJRSJhEBpRSSiECSQIFpFSCA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 42114
Devouring Plague 9229 21.9% 50.7 5.90sec 54537 49216 Direct 50.7 19170 40982 23356 19.2%
Periodic 128.6 10371 21134 12303 17.9% 85.3%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.74 50.74 128.61 128.61 29.77 1.1081 1.9906 2767399.00 2767399.00 0.00% 8863.33 49215.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 41.00 25 62 19169.91 15379 30235 19159.56 17726 20977 786055 786055 0.00%
crit 19.19% 9.74 1 23 40982.20 30759 60469 41007.47 32809 51885 399135 399135 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.05% 105.52 73 139 10371.16 65 32891 10369.31 8534 12363 1094406 1094406 0.00%
crit 17.95% 23.08 8 41 21133.60 144 65647 21141.12 14683 29898 487803 487803 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.701215
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.75

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.582811
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 70.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [N]:50.74
  • if_expr:(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
Halo 0 (438) 0.0% (1.0%) 4.9 62.59sec 26591 24421

Stats Details: Halo

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.93 0.00 0.00 0.00 0.00 1.0890 0.0000 0.00 0.00 0.00% 24420.91 24420.91

Action Details: Halo

  • id:120644
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Shadow damage to enemies. Healing reduced beyond {$s1=6} targets.

Action Priority List

    main
    [V]:4.94
  • if_expr:raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
    Halo (_damage) 438 1.0% 4.9 62.59sec 26591 0 Direct 4.9 21993 47793 26723 18.3%

Stats Details: Halo Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.93 4.90 0.00 0.00 0.00 0.0000 0.0000 131042.59 131042.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.66% 4.00 0 8 21993.23 16818 35529 22005.76 0 35529 88067 88067 0.00%
crit 18.34% 0.90 0 5 47793.33 33636 71058 30234.63 0 71058 42975 42975 0.00%

Action Details: Halo Damage

  • id:390964
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.442000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390964
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Idol of C'Thun 0 (3215) 0.0% (7.6%) 0.0 0.00sec 0 0

Stats Details: Idol Of Cthun

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Idol Of Cthun

  • id:377349
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377349
  • name:Idol of C'Thun
  • school:physical
  • tooltip:
  • description:Mind Flay and Mind Sear have a chance to spawn a Void Tendril or Void Lasher that channels at your target for {$377355d=15 seconds}, generating {$s1=3} insanity every {$193473t1=1} sec.
    Mind Flay (void_tendril) 7306  / 3215 7.6% 22.0 12.68sec 43881 5859 Periodic 164.7 5011 10161 5859 16.5% 54.9%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.99 0.00 164.72 164.72 0.00 7.4895 1.0000 965072.82 965072.82 0.00% 5858.98 5858.98
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.54% 137.60 41 322 5011.37 4352 6701 5009.18 4713 5450 689586 689586 0.00%
crit 16.46% 27.11 5 67 10160.76 8705 13402 10148.20 9256 11975 275487 275487 0.00%

Action Details: Mind Flay

  • id:193473
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:1667.76
  • base_td_mult:1.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:{$?=}{$=}w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=30}%.

Action Priority List

    default
    [ ]:3.53
Mind Blast 4039 9.6% 62.9 4.77sec 19265 17433 Direct 62.9 15802 34578 19265 18.4%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.87 62.87 0.00 0.00 0.00 1.1051 0.0000 1211245.32 1211245.32 0.00% 17432.76 17432.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.56% 51.28 32 74 15802.37 10050 27600 15799.41 14034 17790 810322 810322 0.00%
crit 18.44% 11.59 2 27 34577.70 20100 55200 34629.47 23559 48496 400924 400924 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.{$?s137033=true}[ |cFFFFFFFFGenerates {$/100;s2=0} Insanity|r][]{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [M]:5.07
  • if_expr:(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
    main
    [Q]:56.74
  • if_expr:variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
    main
    [T]:1.24
  • if_expr:raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
Mind Flay 590 1.4% 6.8 39.20sec 25979 7726 Periodic 40.6 3753 7698 4355 15.3% 7.5%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.80 0.00 40.58 40.58 0.00 3.3628 0.5561 176698.96 176698.96 0.00% 7725.56 7725.56
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 84.74% 34.39 1 75 3752.91 3020 5614 3755.39 3058 5128 129050 129050 0.00%
crit 15.26% 6.19 0 21 7697.73 6040 11229 7611.91 0 10691 47649 47649 0.00%

Action Details: Mind Flay

  • id:15407
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:2.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.235400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.50
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=4.500 seconds} and slowing their movement speed by {$s2=50}%. |cFFFFFFFFGenerates {$=}{{$s4=6}*{$s3=200}/100} Insanity over the duration.|r

Action Priority List

    main
    [U]:40.57
  • if_expr:buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
    main
    [X]:6.80
  • interrupt_if_expr:ticks>=2
Mind Flay: Insanity 5543 13.2% 40.6 7.28sec 40982 18680 Periodic 161.6 8693 17760 10289 17.6% 29.7%

Stats Details: Mind Flay Insanity

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.57 0.00 161.58 161.58 0.00 2.1939 0.5508 1662490.88 1662490.88 0.00% 18680.09 18680.09
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.40% 133.15 87 186 8693.28 6644 12351 8691.19 8278 9246 1157508 1157508 0.00%
crit 17.60% 28.43 7 55 17759.89 13288 24703 17760.57 16344 19457 504983 504983 0.00%

Action Details: Mind Flay Insanity

  • id:391403
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.517880
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:391403
  • name:Mind Flay: Insanity
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=70}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r
Mind Spike 849 2.0% 10.1 25.28sec 25106 22973 Direct 10.1 21185 45874 25107 15.9%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.13 10.13 0.00 0.00 0.00 1.0930 0.0000 254217.18 254217.18 0.00% 22972.82 22972.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.12% 8.52 0 22 21184.79 15395 42280 21244.47 0 33829 180439 180439 0.00%
crit 15.88% 1.61 0 8 45873.59 30791 84559 36456.90 0 84559 73779 73779 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.440000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage.{$?s391090=false}[ Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times.][] |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity|r{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [W]:10.12
  • if_expr:buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
Mindgames 1389 3.3% 7.7 40.44sec 53769 48498 Direct 7.7 (7.7) 43562 95289 53766 19.7% (19.7%)

Stats Details: Mindgames

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.74 7.74 0.00 0.00 0.00 1.1087 0.0000 416110.43 416110.43 0.00% 48497.72 48497.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.27% 6.21 0 10 43561.89 32802 69296 43486.02 0 55361 270606 270606 0.00%
crit 19.73% 1.53 0 7 95288.69 65605 138592 78658.11 0 138592 145504 145504 0.00%

Action Details: Mindgames

  • id:375901
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:375901
  • name:Mindgames
  • school:shadow
  • tooltip:The next {$=}w2 damage and {$=}w5 healing dealt will be reversed.
  • description:Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target.

Action Priority List

    main
    [R]:7.77
  • if_expr:spell_targets.mind_sear<5&variable.all_dots_up
Shadow Crash 0 (1189) 0.0% (2.8%) 8.6 32.93sec 41383 36500

Stats Details: Shadow Crash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.62 0.00 0.00 0.00 0.00 1.1339 0.0000 0.00 0.00 0.00% 36500.41 36500.41

Action Details: Shadow Crash

  • id:205385
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:15.0

Spelldata

  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r

Action Priority List

    main
    [S]:8.62
  • if_expr:raid_event.adds.in>10
    Shadow Crash (_damage) 1189 2.8% 9.6 32.85sec 37251 0 Direct 9.6 30816 65825 37252 18.4%

Stats Details: Shadow Crash Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 9.58 0.00 0.00 0.00 0.0000 0.0000 356864.49 356864.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.62% 7.82 2 12 30815.71 20814 49353 30719.96 23590 36641 240947 240947 0.00%
crit 18.38% 1.76 0 8 65825.16 41627 98706 56423.38 0 98706 115918 115918 0.00%

Action Details: Shadow Crash Damage

  • id:205386
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.103750
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadow Weaving 659 1.6% 131.3 2.22sec 1502 0 Direct 130.3 1513 0 1513 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.30 130.30 0.00 0.00 0.00 0.0000 0.0000 197175.74 197175.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 130.30 92 159 1513.22 353 4883 1514.19 1234 2049 197176 197176 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1308.38
  • base_dd_max:1308.38
  • base_dd_mult:1.00

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}
Shadow Word: Death 1242 2.9% 12.7 24.34sec 29158 25888 Direct 12.7 24282 50063 29157 18.9%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 0.00 0.00 0.00 1.1264 0.0000 371622.43 371622.43 0.00% 25888.01 25888.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 10.34 3 17 24282.19 10905 54837 24247.73 14476 37789 250959 250959 0.00%
crit 18.91% 2.41 0 8 50062.89 21810 109674 46268.41 0 109674 120663 120663 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target. {$?=}A364675[Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]

Action Priority List

    main
    [L]:3.74
  • if_expr:pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
    main
    [O]:9.01
  • target_if_expr:(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
Shadow Word: Pain 2785 6.6% 9.6 32.85sec 87161 0 Periodic 254.1 2774 5675 3286 17.7% 99.3%

Stats Details: Shadow Word Pain

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 0.00 254.08 254.08 210.74 0.0000 1.1721 835044.58 835044.58 0.00% 2803.90 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.33% 209.19 151 268 2773.80 879 3962 2773.28 2659 2926 580256 580256 0.00%
crit 17.67% 44.89 18 72 5675.36 1158 7924 5675.90 5248 6286 254789 254789 0.00%

Action Details: Shadow Word Pain

  • id:589
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:3.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.095880
  • base_td:0.00
  • base_td_mult:1.73
  • dot_duration:21.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=2} sec.
  • description:A word of darkness that causes {$?a390707=false}[{$=}{{$s1=0}*(1+{$390707s1=15}/100)}][{$s1=0}] Shadow damage instantly, and an additional {$?a390707=false}[{$=}{{$=}o2*(1+{$390707s1=15}/100)}][{$=}o2] Shadow damage over {$d=16 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m3=300}/100} Insanity.|r][]
Shadowy Apparitions 0 (1214) 0.0% (2.9%) 113.6 2.63sec 3208 0

Stats Details: Shadowy Apparitions

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowy Apparitions

  • id:341491
  • school:physical
  • range:0.0
  • travel_speed:6.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:341491
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:Mind Blast, Devouring Plague, and Void Bolt have a {$s4=100}% chance to conjure Shadowy Apparitions and Mind Sear has a {$s3=50}% chance to conjure Shadowy Apparitions. Shadowy Apparitions float towards all targets afflicted by your Vampiric Touch for {$148859s1=0} Shadow damage. Critical strikes with Mind Blast, Devouring Plague, and Void Bolt increase the damage of the Shadowy Apparitions they conjure by {$s2=100}%.
    Shadowy Apparition 1214 2.9% 111.8 2.63sec 3259 0 Direct 110.1 3311 0 3311 0.0%

Stats Details: Shadowy Apparition

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 111.84 110.06 0.00 0.00 0.00 0.0000 0.0000 364427.36 364427.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 110.06 80 143 3311.24 2508 5299 3309.88 3128 3579 364427 364427 0.00%

Action Details: Shadowy Apparition

  • id:148859
  • school:shadow
  • range:100.0
  • travel_speed:6.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Spelldata

  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals $148859sw1 Shadow damage.}
Soulseeker Arrow 1153 2.7% 7.3 37.02sec 47108 0 Periodic 87.4 3959 0 3959 0.0% 39.3%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.34 0.00 87.36 87.36 2.53 0.0000 1.3479 345839.00 345839.00 0.00% 2936.94 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 87.36 21 179 3958.61 28 4452 3956.28 3826 4245 345839 345839 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3665.83
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1747}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 3342 7.9% 9.6 32.85sec 104608 0 Periodic 167.1 5061 10356 5999 17.7% 99.2%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 0.00 167.05 167.05 210.74 0.0001 1.7808 1002196.97 1002196.97 0.00% 3368.89 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.29% 137.46 95 178 5061.38 318 7225 5060.48 4847 5363 695740 695740 0.00%
crit 17.71% 29.59 10 52 10356.22 2303 14450 10357.95 9578 11684 306457 306457 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.201960
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [P]:0.00
  • target_if_expr:(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
pet - mindbender 11307 / 5240
Inescapable Torment 0 (2825) 0.0% (6.7%) 41.8 6.99sec 20205 0

Stats Details: Inescapable Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.85 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Inescapable Torment

  • id:373427
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:373427
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.
    Inescapable Torment (_damage) 6092 6.7% 41.8 6.99sec 20205 0 Direct 41.8 16157 33960 20205 22.7%

Stats Details: Inescapable Torment Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.85 41.85 0.00 0.00 0.00 0.0000 0.0000 845505.12 845505.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.27% 32.33 14 50 16157.37 10882 24138 16151.87 14347 18256 522436 522436 0.00%
crit 22.73% 9.51 0 22 33960.19 21764 48275 33978.87 0 45233 323069 323069 0.00%

Action Details: Inescapable Torment Damage

  • id:373442
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.923780
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:373442
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:{$@spelldesc373427=Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.}
melee 5215 5.7% 131.3 2.22sec 5504 5320 Direct 131.3 4470 9089 5504 22.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.30 131.30 0.00 0.00 0.00 1.0346 0.0000 722660.93 722660.93 0.00% 5319.82 5319.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.61% 101.91 63 134 4469.83 3944 6103 4468.56 4224 4815 455513 455513 0.00%
crit 22.39% 29.39 11 50 9088.89 7887 12205 9090.76 8409 10091 267148 267148 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 0
Mental Fortitude 514 100.0% 336.0 0.88sec 457 0 Direct 347.8 442 0 442 0.0%

Stats Details: Mental Fortitude

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 335.99 347.76 0.00 0.00 0.00 0.0000 0.0000 153596.13 7077958.61 97.83% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 347.76 257 429 441.69 0 25049 442.63 281 654 153596 7077959 97.82%

Action Details: Mental Fortitude

  • id:377065
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21610.00
  • base_dd_max:21610.00
  • base_dd_mult:1.00

Spelldata

  • id:377065
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 2.9 123.47sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    default
    [D]:2.94
  • if_expr:buff.power_infusion.up|fight_remains<=15
Dark Ascension 5.3 61.87sec

Stats Details: Dark Ascension

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 0.00 102.75 0.00 0.00 1.1676 1.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Dark Ascension

  • id:391109
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:30.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:391109
  • name:Dark Ascension
  • school:shadow
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r

Action Priority List

    cds
    [G]:5.33
  • if_expr:pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
Desperate Prayer 0.3 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.28 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [J]:0.28
  • if_expr:health.pct<=75
Devouring Plague (_heal) 179.4 1.66sec

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 179.35 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 70.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Halo (_heal) 4.9 62.59sec

Stats Details: Halo Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 4.93 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Halo Heal

  • id:390971
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.610000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390971
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Mindbender 5.4 60.64sec

Stats Details: Mindbender

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.45 0.00 0.00 0.00 0.00 1.1689 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindbender

  • id:200174
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$=}{{$200010s1=300}/100} Insanity each time the Mindbender attacks.|r

Action Priority List

    cds
    [I]:5.45
  • if_expr:(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
Mindgames (_damage_reversal) 7.7 40.44sec

Stats Details: Mindgames Damage Reversal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 7.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindgames Damage Reversal

  • id:323706
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:323706
  • name:Mindgames
  • school:shadow
  • tooltip:
  • description:{$@spelldesc323673=Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. {$?=}c3[For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing generate up to {$=}{{$323706s2=10}*2} Insanity.|r] ][For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing restore up to {$=}{{$323706s3=2}*2}% mana.|r]}
Elemental Potion of Ultimate Power 1.4 309.39sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.40 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.40
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
Power Infusion 2.9 123.68sec

Stats Details: Power Infusion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Power Infusion

  • id:10060
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.

Action Priority List

    cds
    [F]:2.91
  • if_expr:(buff.voidform.up|buff.dark_ascension.up)
Shadow Crash (_dots) 8.6 32.93sec

Stats Details: Shadow Crash Dots

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadow Crash Dots

  • id:391286
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:391286
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 2.9 123.68sec

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 167.1 1.78sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 167.05 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2563.10
  • base_dd_max:2563.10
  • base_dd_mult:1.00

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ancient Madness 5.3 0.0 61.9sec 61.9sec 19.4sec 34.30% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_ancient_madness
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.2s / 71.4s
  • trigger_min/max:61.2s / 71.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • ancient_madness_1:1.66%
  • ancient_madness_2:1.67%
  • ancient_madness_3:1.67%
  • ancient_madness_4:1.68%
  • ancient_madness_5:1.68%
  • ancient_madness_6:1.69%
  • ancient_madness_7:1.69%
  • ancient_madness_8:1.70%
  • ancient_madness_9:1.71%
  • ancient_madness_10:1.71%
  • ancient_madness_11:1.72%
  • ancient_madness_12:1.72%
  • ancient_madness_13:1.73%
  • ancient_madness_14:1.73%
  • ancient_madness_15:1.74%
  • ancient_madness_16:1.75%
  • ancient_madness_17:1.75%
  • ancient_madness_18:1.76%
  • ancient_madness_19:1.76%
  • ancient_madness_20:1.77%

Spelldata

  • id:341240
  • name:Ancient Madness
  • tooltip:
  • description:Voidform and Dark Ascension increase your critical strike chance by {$s1=10}% for {$194249d=20 seconds}, reducing by {$=}{{$s3=5}/10}.1% every sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.9 0.0 123.5sec 123.5sec 14.7sec 14.46% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:120.0s / 132.6s
  • trigger_min/max:120.0s / 132.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.46%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Coalescing Shadows 56.3 149.6 5.3sec 1.4sec 3.4sec 64.22% 76.44% 72.8 (72.8) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 39.4s
  • trigger_min/max:0.0s / 37.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.6s

Stack Uptimes

  • coalescing_shadows_1:22.18%
  • coalescing_shadows_2:14.50%
  • coalescing_shadows_3:27.54%

Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Coalescing Shadows (_dot) 2.1 53.6 127.0sec 5.4sec 143.4sec 98.10% 98.81% 53.6 (53.6) 1.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows_dot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.1s / 357.8s
  • trigger_min/max:0.0s / 42.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.1s

Stack Uptimes

  • coalescing_shadows_dot_1:98.10%

Spelldata

  • id:391244
  • name:Coalescing Shadows
  • tooltip:Your periodic damage is increased by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Ascension 5.3 0.0 61.9sec 61.9sec 19.4sec 34.30% 42.12% 97.8 (97.8) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_ascension
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.2s / 71.4s
  • trigger_min/max:61.2s / 71.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • dark_ascension_1:34.30%

Spelldata

  • id:391109
  • name:Dark Ascension
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Dark Evangelism 1.0 201.2 151.5sec 1.4sec 292.8sec 97.70% 98.24% 197.2 (197.2) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_evangelism
  • max_stacks:5
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:74.7s / 205.4s
  • trigger_min/max:0.3s / 32.6s
  • trigger_pct:100.00%
  • duration_min/max:30.5s / 353.8s

Stack Uptimes

  • dark_evangelism_1:0.12%
  • dark_evangelism_2:0.12%
  • dark_evangelism_3:0.12%
  • dark_evangelism_4:0.80%
  • dark_evangelism_5:96.52%

Spelldata

  • id:391099
  • name:Dark Evangelism
  • tooltip:Periodic Shadow damage increased by {$=}w1%.
  • description:{$@spelldesc391095=Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391095
  • name:Dark Evangelism
  • tooltip:
  • description:Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Death and Madness (_insanity_gain) 0.4 0.0 0.0sec 0.0sec 0.0sec 0.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_insanity_gain
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s

Stack Uptimes

Spelldata

  • id:321973
  • name:Death and Madness
  • tooltip:{$=}{{$m1=750}/100} Insanity generated every {$t1=1} sec.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_reset) 2.8 0.0 22.5sec 22.5sec 16.9sec 15.50% 0.00% 0.0 (0.0) 1.9

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_reset
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.9s / 38.0s
  • trigger_min/max:20.9s / 38.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • death_and_madness_reset_1:15.50%

Spelldata

  • id:390628
  • name:Death and Madness
  • tooltip:
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:321291
  • name:Death and Madness
  • tooltip:
  • description:If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Desperate Prayer 0.3 0.0 0.0sec 0.0sec 9.1sec 0.84% 0.00% 2.3 (2.3) 0.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • desperate_prayer_1:0.84%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Devoured Pride 1.5 0.0 60.9sec 0.0sec 22.8sec 10.91% 12.96% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 63.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.0s / 33.0s

Stack Uptimes

  • devoured_pride_1:10.91%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=15}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=15}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 309.4sec 309.4sec 27.3sec 12.53% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:306.1s / 318.0s
  • trigger_min/max:306.1s / 318.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.53%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mental Fortitude 4.5 331.5 82.6sec 0.9sec 64.1sec 95.17% 100.00% 331.5 (331.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.1s / 333.4s
  • trigger_min/max:0.0s / 27.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 329.1s

Stack Uptimes

  • mental_fortitude_1:95.17%

Spelldata

  • id:377065
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Mind Devourer 6.2 0.2 41.6sec 40.4sec 2.1sec 4.26% 11.97% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_devourer
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 298.6s
  • trigger_min/max:0.8s / 298.6s
  • trigger_pct:10.09%
  • duration_min/max:0.0s / 11.0s

Stack Uptimes

  • mind_devourer_1:4.26%

Spelldata

  • id:373204
  • name:Mind Devourer
  • tooltip:Your next Devouring Plague or Mind Sear costs 0 insanity.
  • description:{$@spelldesc373202=Mind Blast has a {$s1=15}% chance to make your next Devouring Plague or Mind Sear cost no insanity.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373202
  • name:Mind Devourer
  • tooltip:
  • description:Mind Blast has a {$s1=15}% chance to make your next Devouring Plague or Mind Sear cost no insanity.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Mind Flay: Insanity 41.1 9.7 7.3sec 5.9sec 3.2sec 44.16% 0.00% 9.7 (9.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_flay_insanity
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 29.5s
  • trigger_min/max:0.8s / 22.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.8s

Stack Uptimes

  • mind_flay_insanity_1:44.16%

Spelldata

  • id:391401
  • name:Mind Flay: Insanity
  • tooltip:Mind Flay is temporarily empowered.
  • description:{$@spelldesc391399=Devouring Plague transforms your next Mind Flay into Mind Flay: Insanity. Lasts {$391401d=10 seconds}. {$@=}spellicon391403 {$@=}spellname391403 {$@spelldesc391403=Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Infusion 2.9 0.0 123.7sec 123.7sec 19.4sec 18.93% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:122.4s / 132.6s
  • trigger_min/max:122.4s / 132.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • power_infusion_1:18.93%

Spelldata

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 17.3 0.7 16.9sec 16.1sec 1.4sec 7.81% 27.13% 0.7 (0.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:2.40
  • modifier:1.00

Trigger Details

  • interval_min/max:0.5s / 69.0s
  • trigger_min/max:0.5s / 69.0s
  • trigger_pct:7.09%
  • duration_min/max:0.0s / 8.6s

Stack Uptimes

  • shadowy_insight_1:7.81%

Spelldata

  • id:375981
  • name:Shadowy Insight
  • tooltip:Your next Mind Blast is instant cast.
  • description:{$@spelldesc375888=Mind Blast gains an additional charge. Shadow Word: Pain periodic damage has a chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.9sec 45.5sec 16.5sec 23.75% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 213.0s
  • trigger_min/max:0.0s / 213.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 63.9s

Stack Uptimes

  • sophic_devotion_1:23.75%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.7 0.0 156.6sec 156.6sec 19.5sec 4.75% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 253.6s
  • trigger_min/max:122.4s / 253.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:4.75%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.7 0.0 156.4sec 156.4sec 19.5sec 4.76% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 254.6s
  • trigger_min/max:122.4s / 254.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:4.76%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.7 0.0 158.0sec 158.0sec 19.4sec 4.65% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 254.1s
  • trigger_min/max:122.4s / 254.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:4.65%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.7 0.0 157.1sec 157.1sec 19.4sec 4.77% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 253.1s
  • trigger_min/max:122.4s / 253.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:4.77%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Surge of Darkness 12.9 14.8 23.1sec 10.5sec 12.4sec 53.12% 100.00% 3.6 (3.6) 7.5

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_surge_of_darkness
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 129.6s
  • trigger_min/max:0.0s / 115.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 110.2s

Stack Uptimes

  • surge_of_darkness_1:25.52%
  • surge_of_darkness_2:14.44%
  • surge_of_darkness_3:13.15%

Spelldata

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike is instant cast, and deals {$s2=200}% additional damage.
  • description:{$@spelldesc162448=Your Vampiric Touch and Devouring Plague damage has a chance to cause your next Mind Spike to be instant cast and deal {$87160s2=200}% additional damage. Stacks up to {$87160u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Twist of Fate 1.0 205.1 0.0sec 0.5sec 104.4sec 34.79% 32.64% 205.1 (205.1) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 4.8s
  • trigger_pct:100.00%
  • duration_min/max:80.9s / 125.9s

Stack Uptimes

  • twist_of_fate_1:34.79%

Spelldata

  • id:390978
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$=}w1%.
  • description:{$@spelldesc390972=After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390972
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Shadowy Apparition from Devouring Plague 50.7 35.0 70.0 5.9s 0.8s 22.0s
Shadowy Apparition from Mind Blast 62.9 44.0 85.0 4.8s 0.0s 15.4s
Mind Devourer free Devouring Plague proc 6.3 0.0 18.0 40.4s 0.8s 298.6s
Void Tendril proc from Idol of C'Thun 11.2 4.0 26.0 25.1s 0.3s 116.1s
Shadowy Insight procs 17.3 7.0 34.0 16.9s 0.5s 69.0s
Shadowy Insight procs lost to overflow 0.7 0.0 6.0 87.1s 0.6s 318.6s
Coalescing Shadows from Mind Fay 50.5 25.0 82.0 5.7s 0.3s 72.6s
Coalescing Shadows from Shadow Word: Pain 15.3 3.0 34.0 18.5s 0.5s 204.0s
Coalescing Shadows from Shadowy Apparition 8.9 0.0 22.0 29.2s 0.0s 281.3s
Surge of Darkness from Vampiric Touch 13.3 2.0 29.0 21.0s 0.8s 235.5s
Surge of Darkness from Devouring Plague 14.4 3.0 33.0 19.6s 0.0s 206.7s
Mind Flay: Insanity casts that did not channel for full ticks 0.3 0.0 1.0 0.0s 0.0s 0.0s
Idol of Y'Shaarj Devoured Violence procs 4.0 3.0 5.0 60.7s 60.0s 63.4s
Mindgames casts without full Mastery value 0.5 0.0 4.0 101.7s 35.4s 301.4s
Inescapable Torment expired when Mind Blast was ready 3.1 0.0 8.0 96.0s 0.0s 337.0s
Inescapable Torment expired when Shadow Word: Death was ready 0.7 0.0 5.0 163.7s 0.0s 335.8s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 81.13% 72.51% 85.70% 10.4s 0.0s 45.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Auspicious SpiritsInsanity110.06109.774.82%1.000.290.26%
Insanity Gained from Idol of C'thun Mind Flay'sInsanity164.72327.5414.39%1.991.900.58%
MindbenderInsanity131.30391.9317.22%2.981.970.50%
Throes of PainInsanity1.004.960.22%4.960.040.82%
Dark AscensionInsanity5.31154.486.79%29.074.973.11%
mana_regenMana834.3766551.48100.00%79.76412790.2186.12%
Mind BlastInsanity62.87375.7716.51%5.981.480.39%
Mind FlayInsanity40.5780.843.55%1.990.310.38%
Mind Flay: InsanityInsanity161.58645.6728.37%4.000.660.10%
Mind SpikeInsanity10.1240.501.78%4.000.000.00%
Shadow CrashInsanity9.62144.356.34%15.000.000.00%
Vampiric TouchInsanity0.000.000.00%4.000.000.00%
Usage Type Count Total Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 50.742230.0243.9543.951240.97
HaloMana 4.9312319.692500.002499.8710.64
MindgamesMana 7.7438694.845000.005000.0410.75
Shadow Word: DeathMana 12.7515931.881250.001250.0323.33
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 216100.0 305.04 297.08 2160265.2 212838.9 74059.1 216100.0
Mana 49999.0 221.84 223.15 412790.3 49604.0 43757.0 49999.0
Insanity 15.0 7.59 7.43 11.6 45.8 5.0 100.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 42114.02
Minimum 37145.27
Maximum 48108.88
Spread ( max - min ) 10963.61
Range [ ( max - min ) / 2 * 100% ] 13.02%
Standard Deviation 1430.0290
5th Percentile 39847.29
95th Percentile 44591.98
( 95th Percentile - 5th Percentile ) 4744.69
Mean Distribution
Standard Deviation 16.5137
95.00% Confidence Interval ( 42081.66 - 42146.39 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4430
0.1 Scale Factor Error with Delta=300 17458
0.05 Scale Factor Error with Delta=300 69829
0.01 Scale Factor Error with Delta=300 1745716
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 42114.02
Minimum 37145.27
Maximum 48108.88
Spread ( max - min ) 10963.61
Range [ ( max - min ) / 2 * 100% ] 13.02%
Standard Deviation 1430.0290
5th Percentile 39847.29
95th Percentile 44591.98
( 95th Percentile - 5th Percentile ) 4744.69
Mean Distribution
Standard Deviation 16.5137
95.00% Confidence Interval ( 42081.66 - 42146.39 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4430
0.1 Scale Factor Error with Delta=300 17458
0.05 Scale Factor Error with Delta=300 69829
0.01 Scale Factor Error with Delta=300 1745716
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 42114.02
Minimum 37145.27
Maximum 48108.88
Spread ( max - min ) 10963.61
Range [ ( max - min ) / 2 * 100% ] 13.02%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 10092374.95
Minimum 7539315.32
Maximum 12615250.58
Spread ( max - min ) 5075935.26
Range [ ( max - min ) / 2 * 100% ] 25.15%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 297.58
Minimum 0.00
Maximum 1241.48
Spread ( max - min ) 1241.48
Range [ ( max - min ) / 2 * 100% ] 208.60%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 305.23
Minimum 0.00
Maximum 1005.62
Spread ( max - min ) 1005.62
Range [ ( max - min ) / 2 * 100% ] 164.73%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 arcane_torrent
7 0.00 use_item,name=shadowed_orb_of_torment
8 0.00 variable,name=mind_sear_cutoff,op=set,value=2
9 0.00 shadow_crash,if=talent.shadow_crash.enabled
A 0.00 mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
B 0.00 vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled
Default action list Executed every time the actor is available.
# count action,conditions
C 1.40 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
0.00 variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
0.00 variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
0.00 variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
0.00 variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
0.00 variable,name=is_vt_possible,op=set,value=0,default=1
0.00 variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
0.00 variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
0.00 variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
D 2.94 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 variable,name=pool_amount,op=set,value=60
E 0.00 run_action_list,name=main
actions.cds
# count action,conditions
F 2.91 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
G 5.33 dark_ascension,if=pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
H 0.00 call_action_list,name=trinkets
I 5.45 mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
J 0.28 desperate_prayer,if=health.pct<=75
actions.main
# count action,conditions
K 0.00 call_action_list,name=cds
0.00 mind_blast,if=cooldown.mind_blast.charges>=2&talent.mind_devourer&spell_targets.mind_sear>=3&spell_targets.mind_sear<=7&!buff.mind_devourer.up
Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
L 3.74 shadow_word_death,if=pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
M 5.07 mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
0.00 damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
0.00 void_bolt,if=variable.dots_up&insanity<=85
0.00 mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
0.00 mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
N 50.74 devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
O 9.01 shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
P 0.00 vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
0.00 shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
Q 56.74 mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
R 7.77 mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
S 8.62 shadow_crash,if=raid_event.adds.in>10
0.00 dark_void,if=raid_event.adds.in>20
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
0.00 void_torrent,if=insanity<=35,target_if=variable.dots_up
T 1.24 mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
0.00 vampiric_touch,if=buff.unfurling_darkness.up
U 40.57 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
V 4.94 halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
0.00 divine_star,if=spell_targets.divine_star>1
Use when it will hit at least 2 targets.
0.00 lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75
W 10.12 mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
X 6.80 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>30
Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain
Use Shadow Word: Pain while moving as a low-priority action
actions.trinkets
# count action,conditions
0.00 use_item,name=scars_of_fraternal_strife,if=(!buff.scars_of_fraternal_strife_4.up&time>1)|(buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10)
0.00 use_item,name=macabre_sheet_music,if=cooldown.void_eruption.remains>10|cooldown.dark_ascension.remains>10
0.00 use_item,name=soulletting_ruby,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10,target_if=min:target.health.pct
0.00 use_item,name=architects_ingenuity_core
Use this on CD for max CDR
Y 2.91 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10
Default fallback for usable items: Use on cooldown in order by trinket slot.

Sample Sequence

012589IMGCFDYNOQRUQVNUQXWNQUXMNUXNQQUQNSUXNQQRQUWXNQQUQNUIGNOQSNUQNUNQRNUVQNUQNQUWNSQQNQUNQUWXQNRIOGFDYQNQUQSNUQQVNUNQOUNQUNUNQURNQSUWNQUQWXNQUIOGNQUNQQQNQRSUNOQUNUQNUVNQQUXNQSUNQUNQILLGFDYNQRQUNQUWNQUSNULLQNUQNQUQNUVXOOQNQQQRS

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 5 shadowform Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 8 mind_sear_cutoff Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 9 shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
0:00.000 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
bloodlust, static_empowerment
0:00.939 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
bloodlust, coalescing_shadows, static_empowerment
0:01.878 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
bloodlust, coalescing_shadows_dot, static_empowerment(2)
0:02.817 default C potion Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3)
0:02.817 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.817 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.817 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.817 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(3), elemental_potion_of_ultimate_power
0:03.570 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(4), elemental_potion_of_ultimate_power
0:04.324 main Q mind_blast Fluffy_Pillow 49955.4/49999: 100% mana
13.0/100: 13% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(19), mental_fortitude, coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.081 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
22.0/100: 22% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(18), mental_fortitude, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.836 main U mind_flay Fluffy_Pillow 45010.2/49999: 90% mana
25.0/100: 25% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(17), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.335 main Q mind_blast Fluffy_Pillow 47408.6/49999: 95% mana
47.0/100: 47% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(16), mental_fortitude, dark_evangelism(4), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.089 main V halo Fluffy_Pillow 48615.0/49999: 97% mana
56.0/100: 56% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(15), mental_fortitude, dark_evangelism(4), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.844 main N devouring_plague Fluffy_Pillow 47323.0/49999: 95% mana
59.0/100: 59% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(14), mental_fortitude, dark_evangelism(4), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.600 main U mind_flay Fluffy_Pillow 48532.6/49999: 97% mana
12.0/100: 12% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(14), mental_fortitude, dark_evangelism(4), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.099 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.854 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.102 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(9), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.857 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.612 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.365 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(7), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.864 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
bloodlust, power_infusion, ancient_madness(5), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.111 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
bloodlust, power_infusion, ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.865 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
bloodlust, power_infusion, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.619 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
bloodlust, power_infusion, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.118 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.923 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.862 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
bloodlust, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.801 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.740 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.611 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.552 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.491 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
13.0/100: 13% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.430 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:35.303 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
0:38.109 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
bloodlust, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
0:39.048 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity
bloodlust, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:39.985 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
0:40.925 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
0:42.146 main Q mind_blast Fluffy_Pillow 45007.0/49999: 90% mana
23.0/100: 23% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
0:43.529 main U mind_flay Fluffy_Pillow 47219.8/49999: 94% mana
29.0/100: 29% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
0:45.964 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:47.185 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:50.837 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:52.057 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
0:53.276 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
0:54.497 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:56.935 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
0:58.157 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:59.378 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
7.0/100: 7% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:01.816 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
1:03.036 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:04.256 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:05.476 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
ancient_madness(19), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:06.696 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
ancient_madness(18), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:07.916 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
ancient_madness(17), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:09.136 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
ancient_madness(16), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:10.356 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
22.0/100: 22% insanity
ancient_madness(14), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:12.793 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:14.014 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
ancient_madness(11), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
1:15.236 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
65.0/100: 65% insanity
ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:17.675 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
93.0/100: 93% insanity
ancient_madness(7), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
1:18.897 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
ancient_madness(6), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:20.117 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
ancient_madness(5), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:21.339 main N devouring_plague Fluffy_Pillow 45008.6/49999: 90% mana
76.0/100: 76% insanity
ancient_madness(3), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:22.559 main U mind_flay Fluffy_Pillow 46960.6/49999: 94% mana
33.0/100: 33% insanity
ancient_madness(2), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:24.995 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:26.215 main Q mind_blast Fluffy_Pillow 47505.4/49999: 95% mana
75.0/100: 75% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:27.435 main N devouring_plague Fluffy_Pillow 49457.4/49999: 99% mana
85.0/100: 85% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:28.657 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:31.094 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:32.313 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:33.534 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:34.755 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:37.191 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:38.410 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
86.0/100: 86% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:39.630 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:40.852 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:42.074 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:43.294 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
79.0/100: 79% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:44.515 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:45.737 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:48.173 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:49.395 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
5.0/100: 5% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:50.616 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
11.0/100: 11% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:53.053 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:54.274 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:57.928 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:59.148 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:00.370 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:01.589 cds I mindbender Fluffy_Pillow 45003.8/49999: 90% mana
5.0/100: 5% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:03.036 main O shadow_word_death Fluffy_Pillow 47319.0/49999: 95% mana
8.0/100: 8% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:04.256 cds G dark_ascension Fluffy_Pillow 48021.0/49999: 96% mana
11.0/100: 11% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:05.474 cds F power_infusion Fluffy_Pillow 49969.8/49999: 100% mana
44.0/100: 44% insanity
ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
2:05.474 default D blood_fury Fluffy_Pillow 49969.8/49999: 100% mana
44.0/100: 44% insanity
power_infusion, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
2:05.474 trinkets Y use_items Fluffy_Pillow 49969.8/49999: 100% mana
44.0/100: 44% insanity
blood_fury, power_infusion, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
2:05.474 main Q mind_blast Fluffy_Pillow 49969.8/49999: 100% mana
44.0/100: 44% insanity
blood_fury, power_infusion, ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:06.452 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
blood_fury, power_infusion, ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:07.429 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
3.0/100: 3% insanity
blood_fury, power_infusion, ancient_madness(19), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:08.407 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity
blood_fury, power_infusion, ancient_madness(18), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:10.355 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
blood_fury, power_infusion, ancient_madness(16), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:11.333 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
blood_fury, power_infusion, ancient_madness(15), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:12.310 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
blood_fury, power_infusion, ancient_madness(14), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:13.288 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
16.0/100: 16% insanity
blood_fury, power_infusion, ancient_madness(13), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:15.235 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
blood_fury, power_infusion, ancient_madness(11), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:16.211 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity
blood_fury, power_infusion, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:17.189 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
blood_fury, power_infusion, ancient_madness(9), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:18.165 main N devouring_plague Fluffy_Pillow 47503.8/49999: 95% mana
61.0/100: 61% insanity
blood_fury, power_infusion, ancient_madness(8), surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:19.142 main U mind_flay Fluffy_Pillow 49067.0/49999: 98% mana
65.0/100: 65% insanity
blood_fury, power_infusion, ancient_madness(7), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:21.091 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
power_infusion, ancient_madness(5), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
2:22.069 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
power_infusion, ancient_madness(4), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:23.046 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
power_infusion, ancient_madness(3), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:24.025 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
power_infusion, ancient_madness(2), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:25.973 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
99.0/100: 99% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:27.193 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:28.414 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:30.851 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:32.071 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:34.508 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
82.0/100: 82% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:35.729 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:36.950 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:39.386 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:40.608 main N devouring_plague Fluffy_Pillow 45008.6/49999: 90% mana
60.0/100: 60% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:41.828 main Q mind_blast Fluffy_Pillow 46960.6/49999: 94% mana
11.0/100: 11% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:43.048 main S shadow_crash Fluffy_Pillow 48912.6/49999: 98% mana
17.0/100: 17% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:44.269 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:46.707 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:47.928 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:49.148 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:50.369 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:52.805 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), static_empowerment(5)
2:54.026 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:55.246 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:58.900 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:00.120 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
1.0/100: 1% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:01.341 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:03.778 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:04.999 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:06.219 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:07.442 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
3:08.663 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
ancient_madness(19), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), mind_flay_insanity, dark_ascension, static_empowerment(5)
3:09.882 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
ancient_madness(18), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:12.320 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity
ancient_madness(16), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
3:13.542 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity
ancient_madness(14), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:14.762 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
ancient_madness(13), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:15.982 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
twist_of_fate, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:17.202 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
twist_of_fate, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:18.422 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
twist_of_fate, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:19.642 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity
twist_of_fate, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:20.863 main S shadow_crash Fluffy_Pillow 45007.0/49999: 90% mana
27.0/100: 27% insanity
twist_of_fate, ancient_madness(7), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:22.082 main U mind_flay Fluffy_Pillow 46957.4/49999: 94% mana
45.0/100: 45% insanity
twist_of_fate, ancient_madness(6), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:24.519 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
twist_of_fate, ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
3:25.740 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity
twist_of_fate, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:26.961 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
twist_of_fate, ancient_madness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:28.181 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:30.618 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:31.839 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
13.0/100: 13% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:34.274 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:35.495 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
twist_of_fate, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:36.714 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:39.151 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:40.371 main N devouring_plague Fluffy_Pillow 47505.4/49999: 95% mana
55.0/100: 55% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:41.591 main Q mind_blast Fluffy_Pillow 49457.4/49999: 99% mana
10.0/100: 10% insanity
twist_of_fate, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:42.812 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:44.031 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:46.467 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:50.121 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
3:51.341 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:52.563 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
twist_of_fate, surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:53.783 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
twist_of_fate, surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:56.220 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
twist_of_fate, surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:57.442 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:58.662 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:01.099 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:02.319 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:03.540 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:04.998 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:06.221 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:07.441 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:08.661 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness(3), dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:08.661 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness(3), dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:08.661 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness(3), dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:08.661 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness(3), dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:09.638 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:10.614 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(19), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:11.591 main Q mind_blast Fluffy_Pillow 45005.4/49999: 90% mana
53.0/100: 53% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(18), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:12.570 main U mind_flay Fluffy_Pillow 46571.8/49999: 93% mana
62.0/100: 62% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(17), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:14.518 main N devouring_plague Fluffy_Pillow 49688.6/49999: 99% mana
85.0/100: 85% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(15), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:15.495 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(14), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:16.473 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(13), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:18.423 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(11), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:19.401 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
77.0/100: 77% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(10), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:20.377 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(9), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:21.528 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(8), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:23.478 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(6), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5)
4:24.456 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(5), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:25.433 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
power_infusion, twist_of_fate, ancient_madness(4), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:27.381 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
power_infusion, twist_of_fate, ancient_madness(2), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:28.360 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
4:29.338 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:30.559 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
77.0/100: 77% insanity
twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:31.780 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:34.216 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
twist_of_fate, death_and_madness_reset, shadowy_insight, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
4:35.439 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:36.658 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:37.879 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:40.315 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:41.637 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:42.857 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
2.0/100: 2% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:45.293 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:46.515 main X mind_flay Fluffy_Pillow 47508.6/49999: 95% mana
26.0/100: 26% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:50.166 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:51.387 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:52.608 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:53.829 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:55.049 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
3.0/100: 3% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:56.270 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:57.491 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:58.711 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:59.930 main S shadow_crash Fluffy_Pillow 45003.8/49999: 90% mana
21.0/100: 21% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3463 1 10805 10291 6827
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 216100 205820 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +687 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +515 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +687 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +687 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +89 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +515 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +386 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +386 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +687 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIk04ABAAAAAAAAAAAAQikkSESRLJRSJhEBpRSSiECSQIFpFSCA
class_talents=dispel_magic:1/improved_flash_heal:1/protective_light:1/angelic_feather:1/phantasm:1/death_and_madness:1/leap_of_faith:1/dominate_mind:1/mass_dispel:1/power_infusion:1/vampiric_embrace:1/tithe_evasion:1/improved_mass_dispel:1/body_and_soul:1/twins_of_the_sun_priestess:1/sanlayn:1/twist_of_fate:2/throes_of_pain:2/halo:1/translucent_image:1/mindgames:1/lights_inspiration:2/improved_fade:2/manipulation:2/angelic_bulwark:1/shattered_perceptions:1
spec_talents=devouring_plague:1/dispersion:1/shadowy_apparitions:1/silence:1/mental_fortitude:1/misery:1/coalescing_shadows:1/mind_spike:1/puppet_master:1/mental_decay:1/dark_ascension:1/surge_of_darkness:1/harnessed_shadows:1/shadowy_insight:1/ancient_madness:2/shadow_crash:1/dark_evangelism:2/auspicious_spirits:1/mindbender:1/mind_flay_insanity:1/encroaching_shadows:1/inescapable_torment:2/screams_of_the_void:2/mind_devourer:1/idol_of_yshaarj:1/idol_of_cthun:1

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/use_item,name=shadowed_orb_of_torment
actions.precombat+=/variable,name=mind_sear_cutoff,op=set,value=2
actions.precombat+=/shadow_crash,if=talent.shadow_crash.enabled
actions.precombat+=/mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
actions.precombat+=/vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled

# Executed every time the actor is available.
actions=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
actions+=/variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions+=/variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
actions+=/variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
actions+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
actions+=/variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
actions+=/variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
actions+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
actions+=/variable,name=pool_amount,op=set,value=60
actions+=/run_action_list,name=main

actions.cds=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
actions.cds+=/call_action_list,name=trinkets
actions.cds+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.main=call_action_list,name=cds
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
actions.main+=/mind_blast,if=cooldown.mind_blast.charges>=2&talent.mind_devourer&spell_targets.mind_sear>=3&spell_targets.mind_sear<=7&!buff.mind_devourer.up
actions.main+=/shadow_word_death,if=pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
actions.main+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
actions.main+=/damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
actions.main+=/void_bolt,if=variable.dots_up&insanity<=85
# Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
actions.main+=/mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
# Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
actions.main+=/mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.main+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
actions.main+=/shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
actions.main+=/vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
actions.main+=/shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
actions.main+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
actions.main+=/mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
actions.main+=/shadow_crash,if=raid_event.adds.in>10
actions.main+=/dark_void,if=raid_event.adds.in>20
actions.main+=/devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
actions.main+=/void_torrent,if=insanity<=35,target_if=variable.dots_up
actions.main+=/mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
actions.main+=/vampiric_touch,if=buff.unfurling_darkness.up
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
# Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
actions.main+=/halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
# Use when it will hit at least 2 targets.
actions.main+=/divine_star,if=spell_targets.divine_star>1
actions.main+=/lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75
actions.main+=/mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
actions.main+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
actions.main+=/shadow_crash,if=raid_event.adds.in>30
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.main+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.main+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.main+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.main+=/shadow_word_pain

actions.trinkets=use_item,name=scars_of_fraternal_strife,if=(!buff.scars_of_fraternal_strife_4.up&time>1)|(buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10)
actions.trinkets+=/use_item,name=macabre_sheet_music,if=cooldown.void_eruption.remains>10|cooldown.dark_ascension.remains>10
actions.trinkets+=/use_item,name=soulletting_ruby,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10,target_if=min:target.health.pct
# Use this on CD for max CDR
actions.trinkets+=/use_item,name=architects_ingenuity_core
# Default fallback for usable items: Use on cooldown in order by trinket slot.
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=6827
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 47140 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
47139.8 47139.8 45.3 / 0.096% 7869.6 / 16.7% 61.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
733.4 731.3 Mana 0.65% 52.5 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 47140
Elemental Blast 8110 17.2% 22.1 13.50sec 110043 95116 Direct 22.1 90797 182824 110090 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.09 22.08 0.00 0.00 0.00 1.1570 0.0000 2430875.99 2430875.99 0.00% 95115.86 95115.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.04% 17.45 7 27 90796.63 46980 213658 90824.96 73768 111873 1584606 1584606 0.00%
crit 20.96% 4.63 0 13 182823.71 93961 433554 181759.45 0 325004 846270 846270 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [N]:22.09
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 4861 10.3% 82.2 3.65sec 17741 137977 Direct 82.2 6340 12742 7455 17.4% 0.0%
Periodic 192.3 3738 7515 4395 17.4% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.16 82.16 192.25 192.25 81.16 0.1286 1.5505 1457593.46 1457593.46 0.00% 4722.57 137977.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.57% 67.84 33 99 6339.78 3614 14890 6339.01 5494 7469 430112 430112 0.00%
crit 17.43% 14.32 2 34 12742.19 7228 29670 12742.67 10215 16681 182438 182438 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.58% 158.77 110 205 3737.51 1784 8580 3737.30 3237 4319 593398 593398 0.00%
crit 17.42% 33.48 13 63 7515.32 3714 17000 7516.30 6322 8986 251646 251646 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [V]:8.79
Flametongue Weapon 0 (948) 0.0% (2.0%) 1.0 0.00sec 284345 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 948 2.0% 661.9 0.73sec 430 0 Direct 661.9 365 734 430 17.4% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 661.93 661.93 0.00 0.00 0.00 0.0000 0.0000 284345.36 284345.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 546.70 389 716 365.41 303 639 365.41 332 407 199769 199769 0.00%
crit 17.41% 115.23 67 175 733.98 605 1278 734.02 665 820 84576 84576 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1091 2.3% 28.4 7.75sec 11548 0 Direct 28.4 9806 19715 11548 17.6% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.35 28.35 0.00 0.00 0.00 0.0000 0.0000 327432.66 327432.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.42% 23.37 2 69 9805.82 9732 10030 9805.89 9732 10030 229166 229166 0.00%
crit 17.58% 4.98 0 21 19714.79 19463 20059 19305.87 0 20059 98266 98266 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 5555 11.8% 43.2 6.91sec 38528 33240 Direct 43.2 32741 65744 38528 17.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.21 43.21 0.00 0.00 0.00 1.1591 0.0000 1664937.50 1664937.50 0.00% 33240.25 33240.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.46% 35.64 21 52 32740.81 7897 111904 32799.12 22728 42388 1166736 1166736 0.00%
crit 17.54% 7.58 0 20 65743.71 15795 224987 65845.63 0 134738 498202 498202 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [M]:38.77
  • if_expr:buff.hailstorm.up
    single
    [T]:4.45
Ice Strike 1990 4.2% 24.7 12.26sec 24151 20779 Direct 24.7 20566 41268 24151 17.3% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.70 24.70 0.00 0.00 0.00 1.1623 0.0000 596428.89 596428.89 0.00% 20778.60 20778.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 20.42 9 30 20566.35 15697 47297 20569.85 18012 24651 419970 419970 0.00%
crit 17.31% 4.28 0 12 41268.02 31393 92480 40887.08 0 77679 176459 176459 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:24.70
  • if_expr:talent.hailstorm.enabled
Lava Lash 9532 20.2% 66.4 4.46sec 43012 36948 Direct 66.4 (66.4) 36563 73551 43011 17.4% (17.4%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.45 66.45 0.00 0.00 0.00 1.1641 0.0000 2857955.65 2857955.65 0.00% 36948.36 36948.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.57% 54.86 22 90 36563.45 18515 121753 36585.30 30857 43557 2005971 2005971 0.00%
crit 17.43% 11.58 1 29 73550.84 37029 211843 73624.84 53586 111383 851985 851985 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [I]:50.96
  • if_expr:buff.hot_hand.up|buff.ashen_catalyst.stack=8
    single
    [Q]:15.49
Lightning Bolt 3927 8.3% 18.6 16.31sec 63296 53151 Direct 18.6 52214 104273 63296 21.3% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.59 18.59 0.00 0.00 0.00 1.1909 0.0000 1176544.07 1176544.07 0.00% 53150.71 53150.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.71% 14.63 5 24 52214.06 29713 140249 52301.03 38547 67787 763919 763919 0.00%
crit 21.29% 3.96 0 13 104272.85 59426 270711 102804.95 0 228444 412625 412625 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [K]:6.99
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [O]:1.63
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [R]:9.96
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1705 3.6% 193.2 1.81sec 2646 1485 Direct 193.2 2612 5255 2646 17.4% 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.18 193.18 0.00 0.00 0.00 1.7816 0.0000 511072.70 730122.47 30.00% 1484.99 1484.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.23% 127.95 84 180 2611.84 2204 4445 2611.85 2377 2906 334179 477410 30.00%
crit 17.43% 33.66 11 59 5255.03 4408 8778 5254.52 4628 6216 176894 252712 30.00%
miss 16.34% 31.57 8 59 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 854 1.8% 193.3 1.80sec 1324 743 Direct 193.3 1308 2631 1324 17.4% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.33 193.33 0.00 0.00 0.00 1.7813 0.0000 255996.69 365718.88 30.00% 743.37 743.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.26% 128.09 84 176 1307.89 1102 2223 1307.86 1203 1469 167529 239333 30.00%
crit 17.39% 33.63 13 61 2630.71 2204 4389 2630.56 2311 3013 88468 126386 30.00%
miss 16.35% 31.61 12 60 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 164 (2976) 0.3% (6.3%) 7.0 45.72sec 126799 106470 Direct 7.0 (14.0) 5983 12007 7002 16.9% (18.9%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.00 1.1910 0.0000 49187.97 49187.97 0.00% 106469.56 106469.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.09% 5.84 2 8 5982.77 4707 9434 5986.66 4707 7506 34922 34922 0.00%
crit 16.91% 1.19 0 6 12006.52 9413 18868 8698.89 0 18622 14266 14266 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:7.03
  • if_expr:buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
    Lightning Bolt (_pw) 2812 6.0% 7.0 45.91sec 120371 0 Direct 7.0 99405 199932 120376 20.9% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.99 6.99 0.00 0.00 0.00 0.0000 0.0000 841855.79 841855.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.14% 5.54 1 8 99405.12 69330 210374 99484.62 69641 150876 550214 550214 0.00%
crit 20.86% 1.46 0 6 199932.49 138661 404568 160028.08 0 362605 291642 291642 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (1843) 0.0% (3.9%) 46.4 6.36sec 11897 10163

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.45 0.00 0.00 0.00 0.00 1.1707 0.0000 0.00 0.00 0.00% 10162.55 10162.55

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [P]:46.45
    Stormstrike (_mh) 1229 2.6% 46.4 6.36sec 7931 0 Direct 46.4 6739 13565 7931 17.5% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.45 46.45 0.00 0.00 0.00 0.0000 0.0000 368398.97 526297.66 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.53% 38.33 19 62 6738.62 5715 11523 6738.20 5998 7792 258300 369010 30.00%
crit 17.47% 8.12 1 20 13564.70 11430 23046 13559.94 11430 17817 110099 157288 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 614 1.3% 46.4 6.36sec 3965 0 Direct 46.4 3370 6778 3965 17.5% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.45 46.45 0.00 0.00 0.00 0.0000 0.0000 184179.26 263119.93 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.53% 38.33 16 63 3369.80 2858 5762 3369.71 3005 3799 129173 184537 30.00%
crit 17.47% 8.12 1 20 6778.02 5715 11523 6774.65 5715 8609 55007 78583 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 805 1.7% 5.7 53.91sec 42385 36384 Direct 5.7 36134 72321 42386 17.3% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.69 0.00 0.00 0.00 1.1650 0.0000 241335.03 241335.03 0.00% 36383.99 36383.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 4.71 0 8 36133.86 27905 77621 36102.45 0 60897 170196 170196 0.00%
crit 17.27% 0.98 0 5 72321.31 55810 153543 47381.96 0 144551 71139 71139 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [S]:5.69
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (736) 0.0% (1.6%) 1.0 0.00sec 220531 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 736 1.6% 148.9 4.14sec 1481 0 Direct 148.9 1259 2531 1481 17.5% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.87 148.87 0.00 0.00 0.00 0.0000 0.0000 220531.32 315052.77 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 122.84 61 197 1259.03 1063 2143 1259.03 1151 1417 154654 220940 30.00%
crit 17.49% 26.03 8 53 2530.80 2125 4285 2530.45 2224 2978 65878 94113 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
pet - greater_earth_elemental 427 / 89
melee 427 0.2% 39.9 2.24sec 662 434 Direct 39.9 564 1128 662 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.91 39.91 0.00 0.00 0.00 1.5256 0.0000 26415.14 37736.87 30.00% 433.84 433.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 33.01 8 61 564.32 490 969 563.26 490 723 18626 26609 30.00%
crit 17.30% 6.91 0 20 1128.00 980 1913 1124.67 0 1519 7790 11128 29.95%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2406 / 702
melee 2406 1.5% 89.3 3.41sec 2353 2092 Direct 89.3 2001 3998 2353 17.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.30 89.30 0.00 0.00 0.00 1.1245 0.0000 210093.85 300141.72 30.00% 2092.03 2092.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.38% 73.57 8 160 2000.67 1660 3306 1999.22 1660 2676 147190 210277 30.00%
crit 17.62% 15.73 0 45 3998.07 3321 6611 3993.23 0 5504 62904 89865 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2432 / 711
melee 2432 1.5% 89.9 3.41sec 2370 2107 Direct 89.9 2015 4026 2370 17.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.86 89.86 0.00 0.00 0.00 1.1244 0.0000 212925.01 304186.34 30.00% 2107.38 2107.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.38% 74.03 9 190 2015.32 1660 3306 2012.52 1660 2549 149191 213136 30.00%
crit 17.62% 15.83 0 48 4026.37 3321 6611 4021.42 0 5558 63734 91051 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2419 / 706
melee 2419 1.5% 89.3 3.42sec 2365 2100 Direct 89.3 2012 4025 2365 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.35 89.35 0.00 0.00 0.00 1.1258 0.0000 211263.39 301812.53 30.00% 2100.31 2100.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.47% 73.68 8 174 2011.65 1660 3306 2008.30 1660 2793 148230 211762 30.00%
crit 17.53% 15.66 0 46 4024.55 3321 6611 4017.46 0 5575 63033 90050 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 309.97sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.12 0.00 0.00 0.00 0.00 1.0267 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [U]:1.12
Feral Spirit 10.7 30.03sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.74 0.00 0.00 0.00 0.00 1.1811 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:10.74
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.75sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.47
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 66.0 126.2 4.5sec 1.6sec 3.7sec 81.86% 98.17% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.4s

Stack Uptimes

  • ashen_catalyst_1:30.77%
  • ashen_catalyst_2:16.19%
  • ashen_catalyst_3:11.75%
  • ashen_catalyst_4:9.75%
  • ashen_catalyst_5:6.58%
  • ashen_catalyst_6:3.86%
  • ashen_catalyst_7:2.29%
  • ashen_catalyst_8:0.67%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.0 0.0 48.3sec 48.3sec 14.7sec 29.15% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.4s / 279.9s
  • trigger_min/max:12.4s / 279.9s
  • trigger_pct:85.03%
  • duration_min/max:0.0s / 29.7s

Stack Uptimes

  • crackling_surge_1:23.33%
  • crackling_surge_2:5.82%
  • crackling_surge_3:0.00%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.5sec 12.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.9s
  • trigger_pct:100.00%
  • duration_min/max:16.1s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.35%
  • crumbling_power_3:0.58%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.67%
  • crumbling_power_7:0.66%
  • crumbling_power_8:0.66%
  • crumbling_power_9:0.65%
  • crumbling_power_10:0.63%
  • crumbling_power_11:0.63%
  • crumbling_power_12:0.63%
  • crumbling_power_13:0.63%
  • crumbling_power_14:0.64%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.73%
  • crumbling_power_17:0.78%
  • crumbling_power_18:0.82%
  • crumbling_power_19:1.00%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 6.3 1.0 44.1sec 37.2sec 10.8sec 22.82% 0.00% 1.0 (1.0) 6.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 301.0s
  • trigger_min/max:1.6s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.5s

Stack Uptimes

  • elemental_blast_critical_strike_1:22.82%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 6.3 1.0 44.3sec 37.2sec 10.8sec 22.78% 0.00% 1.0 (1.0) 6.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 276.6s
  • trigger_min/max:1.6s / 276.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.4s

Stack Uptimes

  • elemental_blast_haste_1:22.78%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 6.3 1.1 44.1sec 37.0sec 10.8sec 22.84% 0.00% 1.1 (1.1) 6.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 292.9s
  • trigger_min/max:1.6s / 292.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.9s

Stack Uptimes

  • elemental_blast_mastery_1:22.84%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.2sec 98.7sec 58.2sec 25.26% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.6s

Stack Uptimes

  • elemental_chaos_air_1:25.26%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.8sec 98.6sec 57.8sec 24.75% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:24.75%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.2sec 99.6sec 58.4sec 25.28% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 315.3s

Stack Uptimes

  • elemental_chaos_fire_1:25.28%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 122.7sec 98.7sec 57.8sec 24.71% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:24.71%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.8sec 302.8sec 27.4sec 13.16% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.9s
  • trigger_min/max:300.0s / 329.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.16%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 0.0 29.2sec 30.0sec 14.7sec 52.59% 0.00% 42.0 (42.0) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 48.3s
  • trigger_min/max:16.0s / 47.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • feral_spirit_1:52.59%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 50.0 227.1 6.0sec 1.1sec 4.7sec 78.58% 87.73% 227.1 (489.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 49.0s
  • trigger_min/max:0.0s / 18.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.5s

Stack Uptimes

  • flurry_1:21.91%
  • flurry_2:33.83%
  • flurry_3:22.84%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.4sec 46.3sec 13.0sec 19.48% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 216.9s
  • trigger_min/max:0.1s / 210.0s
  • trigger_pct:98.89%
  • duration_min/max:0.0s / 52.2s

Stack Uptimes

  • forgestorm_ignited_1:19.48%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 39.1 1.6 7.7sec 7.4sec 2.4sec 30.85% 89.80% 1.6 (10.4) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 29.9s
  • trigger_min/max:1.2s / 29.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.8s

Stack Uptimes

  • hailstorm_5:9.79%
  • hailstorm_6:6.06%
  • hailstorm_7:3.70%
  • hailstorm_8:2.26%
  • hailstorm_9:1.38%
  • hailstorm_10:7.66%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.6 5.6 27.7sec 17.6sec 9.9sec 34.93% 89.06% 5.6 (5.6) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 200.7s
  • trigger_min/max:0.0s / 200.7s
  • trigger_pct:4.99%
  • duration_min/max:0.0s / 50.8s

Stack Uptimes

  • hot_hand_1:34.93%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.7 0.0 12.3sec 12.3sec 3.6sec 29.72% 56.11% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 25.9s
  • trigger_min/max:7.7s / 24.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.4s

Stack Uptimes

  • ice_strike_1:29.72%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 5.9 0.0 48.3sec 48.3sec 14.7sec 29.14% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 317.6s
  • trigger_min/max:12.3s / 317.6s
  • trigger_pct:84.89%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • icy_edge_1:23.27%
  • icy_edge_2:5.88%
  • icy_edge_3:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 41.5 224.4 7.3sec 2.3sec 6.2sec 85.88% 100.00% 17.3 (35.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 30.3s
  • trigger_min/max:0.0s / 15.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.3s

Stack Uptimes

  • maelstrom_weapon_1:12.21%
  • maelstrom_weapon_2:13.56%
  • maelstrom_weapon_3:14.11%
  • maelstrom_weapon_4:14.31%
  • maelstrom_weapon_5:9.90%
  • maelstrom_weapon_6:6.64%
  • maelstrom_weapon_7:4.35%
  • maelstrom_weapon_8:2.80%
  • maelstrom_weapon_9:1.73%
  • maelstrom_weapon_10:6.27%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 6.0 0.0 48.4sec 48.4sec 14.7sec 29.27% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 286.5s
  • trigger_min/max:14.0s / 286.5s
  • trigger_pct:84.76%
  • duration_min/max:0.0s / 29.4s

Stack Uptimes

  • molten_weapon_1:23.36%
  • molten_weapon_2:5.91%
  • molten_weapon_3:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Primordial Wave 7.0 0.0 45.7sec 45.7sec 2.0sec 4.61% 38.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 52.4s
  • trigger_min/max:45.0s / 52.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.7s

Stack Uptimes

  • primordial_wave_1:4.61%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.2 60.7sec 45.4sec 16.5sec 23.76% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 209.5s
  • trigger_min/max:0.0s / 209.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.1s

Stack Uptimes

  • sophic_devotion_1:23.76%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.0sec 45.7sec 32.1sec 38.21% 0.00% 25.6 (25.6) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 253.4s
  • trigger_min/max:0.1s / 210.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 200.9s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.72%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 7.0 0.0 45.9sec 45.9sec 11.8sec 27.59% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:38.3s / 54.1s
  • trigger_min/max:38.3s / 54.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • splintered_elements_1:27.59%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 28.5 9.4 10.3sec 7.7sec 3.5sec 32.96% 59.44% 9.4 (9.4) 0.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 100.9s
  • trigger_min/max:0.0s / 96.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.5s

Stack Uptimes

  • stormbringer_1:32.96%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.7 10.0 47.0 11.0s 1.1s 128.6s
windfury_totem_extra_attack_oh 26.8 8.0 49.0 10.9s 1.1s 139.6s
Maelstrom Weapon: Feral Spirit 63.0 48.0 78.0 4.8s 0.0s 32.3s
Maelstrom Weapon: Swirling Maelstrom 63.5 45.0 82.0 4.7s 0.8s 23.4s
Maelstrom Weapon: Primordial Wave 70.3 60.0 80.0 45.7s 45.0s 52.4s
Flametongue: Windfury Attack 148.9 76.0 238.0 4.1s 0.0s 49.4s
Stormbringer: Windfury Attack 16.7 2.0 39.0 18.2s 0.0s 219.7s
Maelstrom Weapon: Windfury Attack 29.9 9.0 57.0 11.0s 0.0s 132.4s
Flametongue: main_hand 161.6 111.0 220.0 2.2s 1.1s 15.8s
Hot Hand: main_hand 8.1 0.0 23.0 32.9s 1.1s 282.9s
Maelstrom Weapon: main_hand 32.3 13.0 58.0 9.4s 1.1s 112.7s
Windfury: main_hand 50.5 24.0 85.0 6.2s 1.1s 82.2s
Flametongue: offhand 161.7 108.0 220.0 2.2s 1.1s 16.3s
Hot Hand: offhand 8.0 0.0 20.0 33.0s 1.1s 294.7s
Maelstrom Weapon: offhand 32.4 10.0 59.0 9.4s 1.1s 116.4s
Flametongue: Sundering 5.7 2.0 8.0 54.0s 40.0s 181.8s
Stormbringer: Sundering 0.6 0.0 4.0 115.3s 40.0s 332.0s
Maelstrom Weapon: Sundering 1.1 0.0 6.0 105.0s 40.0s 325.6s
Windfury: Sundering 1.8 0.0 7.0 98.6s 40.0s 345.4s
Flametongue: Lava Lash 66.4 30.0 103.0 4.5s 0.8s 15.5s
Stormbringer: Lava Lash 7.4 0.0 19.0 34.7s 0.8s 297.2s
Maelstrom Weapon: Lava Lash 13.3 2.0 29.0 21.0s 0.8s 258.7s
Flametongue: Ice Strike 24.7 19.0 30.0 12.3s 7.7s 24.3s
Stormbringer: Ice Strike 2.8 0.0 10.0 69.5s 7.7s 336.4s
Maelstrom Weapon: Ice Strike 4.9 0.0 14.0 50.3s 7.7s 336.1s
Windfury: Ice Strike 7.7 1.0 19.0 35.9s 7.7s 294.5s
Flametongue: Stormstrike 46.4 28.0 71.0 6.4s 0.8s 49.3s
Stormbringer: Stormstrike 5.2 0.0 16.0 44.7s 0.8s 309.6s
Maelstrom Weapon: Stormstrike 9.3 0.0 23.0 29.1s 0.8s 278.0s
Windfury: Stormstrike 14.5 2.0 28.0 19.5s 0.8s 210.6s
Flametongue: Stormstrike Off-Hand 46.4 28.0 71.0 6.4s 0.8s 49.3s
Stormbringer: Stormstrike Off-Hand 5.2 0.0 16.0 44.1s 0.8s 317.1s
Maelstrom Weapon: Stormstrike Off-Hand 9.2 0.0 23.0 29.2s 0.8s 286.3s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 23.23% 13.22% 31.34% 0.5s 0.0s 4.0s
Hot Hand 34.93% 6.47% 70.15% 9.9s 0.0s 50.8s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.8530.0011.5137.6101.98312.933
Sundering14.5590.002141.78665.7354.483189.341
Primordial Wave0.9000.0017.3994.3590.02015.099
Lava Lash0.9900.00112.25163.74128.769115.658
Flame Shock23.4590.001242.949180.2440.000302.302
Ice Strike0.6930.00113.38114.2581.66638.288
Frost Shock2.4160.00123.97995.58248.850146.012
Elemental Blast4.3580.00134.27436.4422.76289.539
Stormstrike2.4070.00135.196104.33846.049172.687
Earth Elemental10.4930.00443.9571.2130.00043.957

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana624.05219398.38100.00%351.57259974.0954.23%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 731.33 733.39 259973.7 49383.0 47000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 22.0930374.101375.001375.0180.03
Flame ShockMana 8.796594.32750.0080.26221.04
Frost ShockMana 43.2121606.79500.00500.0077.06
Ice StrikeMana 24.7040748.911650.001650.0114.64
Lava LashMana 66.4426577.84400.00400.00107.53
Lightning BoltMana 18.599294.03500.00500.00126.59
Primordial WaveMana 7.0310540.791500.001500.0084.53
StormstrikeMana 46.4546447.011000.00999.9811.90
SunderingMana 5.6917081.723000.003000.0414.13

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 47139.85
Minimum 40429.58
Maximum 54857.48
Spread ( max - min ) 14427.90
Range [ ( max - min ) / 2 * 100% ] 15.30%
Standard Deviation 2003.6496
5th Percentile 44010.93
95th Percentile 50589.73
( 95th Percentile - 5th Percentile ) 6578.80
Mean Distribution
Standard Deviation 23.1377
95.00% Confidence Interval ( 47094.50 - 47185.20 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6941
0.1 Scale Factor Error with Delta=300 34272
0.05 Scale Factor Error with Delta=300 137085
0.01 Scale Factor Error with Delta=300 3427104
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 47139.85
Minimum 40429.58
Maximum 54857.48
Spread ( max - min ) 14427.90
Range [ ( max - min ) / 2 * 100% ] 15.30%
Standard Deviation 2003.6496
5th Percentile 44010.93
95th Percentile 50589.73
( 95th Percentile - 5th Percentile ) 6578.80
Mean Distribution
Standard Deviation 23.1377
95.00% Confidence Interval ( 47094.50 - 47185.20 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6941
0.1 Scale Factor Error with Delta=300 34272
0.05 Scale Factor Error with Delta=300 137085
0.01 Scale Factor Error with Delta=300 3427104
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 47139.85
Minimum 40429.58
Maximum 54857.48
Spread ( max - min ) 14427.90
Range [ ( max - min ) / 2 * 100% ] 15.30%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 13468671.30
Minimum 9824681.12
Maximum 18116081.70
Spread ( max - min ) 8291400.58
Range [ ( max - min ) / 2 * 100% ] 30.78%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.47 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 10.74 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
G 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
H 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
I 50.96 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
0.00 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
0.00 ice_strike,if=buff.doom_winds_talent.up
0.00 sundering,if=buff.doom_winds_talent.up
J 7.03 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking
K 6.99 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
L 24.70 ice_strike,if=talent.hailstorm.enabled
M 38.77 frost_shock,if=buff.hailstorm.up
0.00 lava_lash,if=dot.flame_shock.refreshable
0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
0.00 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
N 22.09 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
O 1.63 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
P 46.45 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
Q 15.49 lava_lash
0.00 bag_of_tricks
R 9.96 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
S 5.69 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
T 4.45 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
U 1.12 earth_elemental
V 8.79 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ACDEFBJKLMNPPMPQNMLPRMQSFNMPLPQRMUPPQNLMPPPPQRMVLPQPFNJKMPLPNIMPPRMILIFINIIMIPILNMPIRIMIPILPJFKMPQSTILINIMIPITILINMPVTQPLRMPPQTVJFKILIMINIMNPSLMQPRMVPPLIPINFIMPVLDENMJKPIMPRLMQPPSTIVILFINMPPQTNLPMQRVMPVJKLIIMIFINIILIMINPMPPQLOMPSQITIPILPNFJKMPQVLNMPQVTPRLMPQIN

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_earth
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_earth
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), crumbling_power(20), elemental_chaos_earth
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry(3), crumbling_power(20), elemental_chaos_earth
0:00.893 default B potion Fluffy_Pillow 40678.8/50000: 81% mana bloodlust, berserking, flurry, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(2), crumbling_power(19), elemental_chaos_earth
0:00.893 single J primordial_wave Fluffy_Pillow 40678.8/50000: 81% mana bloodlust, berserking, flurry, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(2), crumbling_power(19), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:01.789 single K lightning_bolt Fluffy_Pillow 40612.4/50000: 81% mana bloodlust, berserking, flurry(2), primordial_wave, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(10), crumbling_power(19), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.684 single L ice_strike Fluffy_Pillow 41544.4/50000: 83% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(2), hailstorm(10), crumbling_power(18), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.497 single M frost_shock Fluffy_Pillow 41195.2/50000: 82% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), hailstorm(10), ice_strike, crumbling_power(17), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.310 single N elemental_blast Fluffy_Pillow 41996.0/50000: 84% mana bloodlust, berserking, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(7), crumbling_power(16), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.123 single P stormstrike Fluffy_Pillow 41921.8/50000: 84% mana bloodlust, berserking, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hailstorm(7), crumbling_power(15), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.913 single P stormstrike Fluffy_Pillow 42185.8/50000: 84% mana bloodlust, berserking, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, hailstorm(7), crumbling_power(14), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.703 single M frost_shock Fluffy_Pillow 42449.8/50000: 85% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), hailstorm(7), crumbling_power(13), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.492 single P stormstrike Fluffy_Pillow 43212.2/50000: 86% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(3), crumbling_power(12), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.280 single Q lava_lash Fluffy_Pillow 43473.0/50000: 87% mana bloodlust, berserking, flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(4), crumbling_power(11), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.070 single N elemental_blast Fluffy_Pillow 44337.0/50000: 89% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(6), crumbling_power(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.859 single M frost_shock Fluffy_Pillow 44224.4/50000: 88% mana bloodlust, berserking, flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(6), crumbling_power(9), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.650 single L ice_strike Fluffy_Pillow 44990.0/50000: 90% mana bloodlust, berserking, flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), crumbling_power(8), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.440 single P stormstrike Fluffy_Pillow 44604.0/50000: 89% mana bloodlust, berserking, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(5), ice_strike, crumbling_power(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.228 single R lightning_bolt Fluffy_Pillow 44864.8/50000: 90% mana bloodlust, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(8), ice_strike, crumbling_power(6), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.098 single M frost_shock Fluffy_Pillow 45756.8/50000: 92% mana bloodlust, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hailstorm(8), ice_strike, crumbling_power(5), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.971 single Q lava_lash Fluffy_Pillow 46653.6/50000: 93% mana bloodlust, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(2), crumbling_power(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.925 single S sundering Fluffy_Pillow 47780.0/50000: 96% mana bloodlust, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(2), crumbling_power(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.879 default F feral_spirit Fluffy_Pillow 46306.4/50000: 93% mana bloodlust, elemental_blast_haste, ashen_catalyst, maelstrom_weapon(4), crumbling_power(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.955 single N elemental_blast Fluffy_Pillow 48028.0/50000: 96% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(6), crumbling_power, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.910 single M frost_shock Fluffy_Pillow 48181.0/50000: 96% mana bloodlust, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), hailstorm(6), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.866 single P stormstrike Fluffy_Pillow 49210.6/50000: 98% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.821 single L ice_strike Fluffy_Pillow 49738.6/50000: 99% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.778 single P stormstrike Fluffy_Pillow 49619.8/50000: 99% mana bloodlust, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(5), stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.733 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(6), maelstrom_weapon(4), ice_strike, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.689 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.644 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon, hailstorm(5), ice_strike, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.599 single U earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.555 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.510 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.467 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(5), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.451 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.435 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), hailstorm(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.391 single M frost_shock Fluffy_Pillow 49879.6/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon, hailstorm(7), ice_strike, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:31.346 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_earth
0:32.301 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, ashen_catalyst(4), stormbringer, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_earth
0:33.256 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(5), stormbringer, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_earth
0:34.212 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(5), stormbringer, maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_earth
0:35.171 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, ashen_catalyst(6), maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_earth
0:36.126 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst, maelstrom_weapon(9), forgestorm_ignited, elemental_chaos_earth
0:37.081 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, ashen_catalyst(2), hailstorm(9), forgestorm_ignited, elemental_chaos_earth
0:38.037 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_earth
0:38.992 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(3), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_earth
0:39.975 single P stormstrike Fluffy_Pillow 49922.8/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(4), maelstrom_weapon(4), ice_strike, forgestorm_ignited, elemental_chaos_earth
0:40.958 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(5), maelstrom_weapon(5), ice_strike, forgestorm_ignited, elemental_chaos_earth
0:42.235 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), stormbringer, maelstrom_weapon(7), ice_strike, forgestorm_ignited, elemental_chaos_earth
0:43.514 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(9), ice_strike, elemental_chaos_earth
0:44.791 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(10), ice_strike, elemental_chaos_earth
0:46.068 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon, hailstorm(10), ice_strike, elemental_chaos_earth
0:47.308 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(10), hailstorm(10), ice_strike, elemental_chaos_earth
0:48.548 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), hailstorm(10), ice_strike, elemental_chaos_earth
0:49.676 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_earth
0:50.803 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(6), stormbringer, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_earth
0:52.000 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(7), stormbringer, maelstrom_weapon(7), ice_strike, forgestorm_ignited, elemental_chaos_earth
0:53.128 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(7), stormbringer, maelstrom_weapon(9), ice_strike, forgestorm_ignited, elemental_chaos_earth
0:54.255 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(8), stormbringer, maelstrom_weapon, hailstorm(9), ice_strike, forgestorm_ignited, elemental_chaos_earth
0:55.382 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon, hailstorm(9), ice_strike, forgestorm_ignited, elemental_chaos_earth
0:56.509 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_earth
0:57.636 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_earth
0:58.764 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(3), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_earth
0:59.890 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), stormbringer, maelstrom_weapon, hailstorm(5), forgestorm_ignited, elemental_chaos_earth
1:01.174 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(5), hot_hand, stormbringer, maelstrom_weapon(3), elemental_chaos_air
1:02.378 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, hot_hand, stormbringer, maelstrom_weapon(3), elemental_chaos_air
1:03.581 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_air
1:04.820 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_air
1:06.058 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_air
1:07.297 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_air
1:08.535 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), ice_strike, elemental_chaos_air
1:09.772 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(8), ice_strike, elemental_chaos_air
1:11.008 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(8), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:12.245 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:13.483 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:14.719 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:15.955 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:17.193 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:18.430 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, hailstorm(10), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:19.665 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon, sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:20.903 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(4), hot_hand, maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:22.140 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, hot_hand, maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:23.379 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, hailstorm(5), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:24.617 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, hailstorm(5), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:25.853 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon, sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:27.091 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, hot_hand, stormbringer, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_air
1:28.327 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_air
1:29.565 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, stormbringer, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
1:30.802 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), ice_strike, forgestorm_ignited, elemental_chaos_air
1:32.039 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(5), ice_strike, forgestorm_ignited, elemental_chaos_air
1:33.276 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, ashen_catalyst(3), maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_air
1:34.515 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(10), ice_strike, elemental_chaos_air
1:35.753 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hailstorm(10), ice_strike, elemental_chaos_air
1:36.879 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(2), elemental_chaos_air
1:38.006 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(2), elemental_chaos_air
1:39.131 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(2), elemental_chaos_air
1:40.256 single T frost_shock Fluffy_Pillow 48800.0/50000: 98% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), elemental_chaos_air
1:41.382 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(3), elemental_chaos_air
1:42.510 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(5), elemental_chaos_air
1:43.634 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_air
1:44.759 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds, elemental_chaos_air
1:45.886 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), ice_strike, spiraling_winds(2), elemental_chaos_air
1:47.012 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(8), ice_strike, spiraling_winds(2), elemental_chaos_air
1:48.251 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), spiraling_winds(3), elemental_chaos_air
1:49.488 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds(3), elemental_chaos_air
1:50.725 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), spiraling_winds(4), elemental_chaos_air
1:51.963 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, hot_hand, maelstrom_weapon(4), spiraling_winds(5), elemental_chaos_air
1:53.201 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(4), spiraling_winds(5), elemental_chaos_air
1:54.438 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(5), spiraling_winds(7), elemental_chaos_air
1:55.679 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), ice_strike, spiraling_winds(8), elemental_chaos_air
1:56.917 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(6), ice_strike, spiraling_winds(8), elemental_chaos_air
1:58.154 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hailstorm(6), ice_strike, spiraling_winds(9), elemental_chaos_air
1:59.355 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon, spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
2:00.557 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:01.796 Waiting     1.011 sec 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:02.807 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:04.278 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(5), maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:05.517 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:06.758 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:07.998 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(5), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:09.275 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), stormbringer, hailstorm(5), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:10.553 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), stormbringer, maelstrom_weapon, spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth
2:11.831 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), stormbringer, maelstrom_weapon, spiraling_winds(10), elemental_chaos_earth
2:13.108 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), maelstrom_weapon, spiraling_winds(10), elemental_chaos_earth
2:14.386 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon, spiraling_winds(10), elemental_chaos_earth
2:15.664 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_earth
2:16.944 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_earth
2:18.316 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, ashen_catalyst(3), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_earth
2:19.594 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_earth
2:20.872 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), hot_hand, stormbringer, hailstorm(10), spiraling_winds(10), elemental_chaos_earth
2:22.033 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), spiraling_winds(10), elemental_chaos_earth
2:23.193 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(10), elemental_chaos_earth
2:24.354 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, spiraling_winds(10), elemental_chaos_earth
2:25.517 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_earth
2:26.678 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, molten_weapon, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_earth
2:27.839 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), spiraling_winds(10), elemental_chaos_earth
2:29.000 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(3), hailstorm(5), spiraling_winds(10), elemental_chaos_earth
2:30.163 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_earth
2:31.325 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(6), spiraling_winds(10), elemental_chaos_earth
2:32.487 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), hailstorm(6), elemental_chaos_earth
2:33.765 single L ice_strike Fluffy_Pillow 49044.8/50000: 98% mana elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(4), maelstrom_weapon(4), hailstorm(6), elemental_chaos_earth
2:35.088 single M frost_shock Fluffy_Pillow 49511.6/50000: 99% mana elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(5), maelstrom_weapon(6), hailstorm(6), ice_strike, elemental_chaos_earth
2:36.365 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(6), maelstrom_weapon(8), elemental_chaos_earth
2:37.643 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, stormbringer, maelstrom_weapon(8), elemental_chaos_earth
2:38.921 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(8), elemental_chaos_earth
2:40.198 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hailstorm(8), elemental_chaos_earth
2:41.477 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_earth
2:42.754 Waiting     1.105 sec 50000.0/50000: 100% mana flurry, ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_earth
2:43.859 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), maelstrom_weapon(2), elemental_chaos_earth
2:45.286 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), stormbringer, maelstrom_weapon(4), elemental_chaos_earth
2:46.562 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(6), stormbringer, maelstrom_weapon(5), elemental_chaos_earth
2:47.840 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(6), hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_earth
2:49.117 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_earth
2:50.394 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(8), ice_strike, elemental_chaos_earth
2:51.672 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(8), ice_strike, elemental_chaos_earth
2:52.949 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(8), ice_strike, elemental_chaos_earth
2:54.227 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(8), ice_strike, elemental_chaos_earth
2:55.505 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(2), hailstorm(8), ice_strike, elemental_chaos_earth
2:56.779 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), elemental_chaos_earth
2:58.056 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), elemental_chaos_earth
2:59.333 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(5), elemental_chaos_earth
3:00.611 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(6), ice_strike, elemental_chaos_earth
3:00.611 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(6), ice_strike, crumbling_power(20), elemental_chaos_earth
3:00.611 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(6), ice_strike, crumbling_power(20), elemental_chaos_earth
3:01.772 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), hailstorm(6), ice_strike, crumbling_power(19), elemental_chaos_earth
3:02.933 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(2), crumbling_power(18), elemental_chaos_earth
3:04.094 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(10), crumbling_power(18), elemental_chaos_earth
3:05.256 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), maelstrom_weapon, hailstorm(10), crumbling_power(17), elemental_chaos_earth
3:06.314 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), stormbringer, maelstrom_weapon(3), hailstorm(10), crumbling_power(16), elemental_chaos_earth
3:07.370 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, crackling_surge, stormbringer, maelstrom_weapon(3), hailstorm(10), crumbling_power(15), elemental_chaos_earth
3:08.426 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst, stormbringer, maelstrom_weapon(5), crumbling_power(14), elemental_chaos_earth
3:09.482 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_critical_strike, splintered_elements, ashen_catalyst(2), maelstrom_weapon(7), crumbling_power(13), elemental_chaos_earth
3:10.540 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_critical_strike, splintered_elements, ashen_catalyst(3), hailstorm(7), crumbling_power(12), elemental_chaos_earth
3:11.597 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, splintered_elements, ashen_catalyst(3), maelstrom_weapon, hailstorm(7), ice_strike, crumbling_power(11), elemental_chaos_earth
3:12.653 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(4), maelstrom_weapon(2), crumbling_power(10), elemental_chaos_earth
3:13.907 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst, maelstrom_weapon(3), crumbling_power(9), elemental_chaos_earth
3:15.067 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), crumbling_power(8), elemental_chaos_earth
3:16.228 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(3), crumbling_power(7), elemental_chaos_earth
3:17.505 single T frost_shock Fluffy_Pillow 49043.2/50000: 98% mana flurry, ashen_catalyst(3), maelstrom_weapon(3), crumbling_power(6), elemental_chaos_earth
3:18.780 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), hot_hand, maelstrom_weapon(3), crumbling_power(5), elemental_chaos_earth
3:20.058 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(3), crumbling_power(4), elemental_chaos_earth
3:21.335 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(3), elemental_chaos_earth
3:22.611 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), elemental_chaos_earth
3:23.888 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_earth
3:25.165 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge(2), ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_earth
3:26.443 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge(2), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_earth
3:27.722 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon, hailstorm(8), ice_strike, elemental_chaos_earth
3:29.000 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(2), elemental_chaos_earth
3:30.278 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(3), elemental_chaos_earth
3:31.555 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_earth
3:32.833 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(4), elemental_chaos_earth
3:34.111 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(5), elemental_chaos_earth
3:35.390 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(3), hailstorm(5), elemental_chaos_earth
3:36.629 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(2), hailstorm(5), ice_strike, elemental_chaos_earth
3:37.871 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(2), hailstorm(5), ice_strike, elemental_chaos_earth
3:39.113 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(5), maelstrom_weapon(5), elemental_chaos_earth
3:40.354 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, maelstrom_weapon(6), elemental_chaos_earth
3:41.595 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, hailstorm(6), elemental_chaos_earth
3:42.833 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), hailstorm(6), elemental_chaos_earth
3:44.076 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon, elemental_chaos_earth
3:45.316 Waiting     1.073 sec 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(2), elemental_chaos_earth
3:46.389 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), maelstrom_weapon(2), elemental_chaos_earth
3:47.890 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), maelstrom_weapon(2), elemental_chaos_earth
3:49.212 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(6), maelstrom_weapon(10), elemental_chaos_earth
3:50.489 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(7), maelstrom_weapon, hailstorm(10), elemental_chaos_earth
3:51.650 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(8), maelstrom_weapon(3), hailstorm(10), ice_strike, elemental_chaos_earth
3:52.810 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, hot_hand, maelstrom_weapon(3), hailstorm(10), ice_strike, elemental_chaos_earth
3:53.972 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), ice_strike, elemental_chaos_earth
3:55.134 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), elemental_chaos_earth
3:56.295 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(4), elemental_chaos_earth
3:57.456 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), elemental_chaos_earth
3:58.619 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), elemental_chaos_earth
3:59.780 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(7), elemental_chaos_earth
4:00.941 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(7), elemental_chaos_fire
4:02.103 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(3), hailstorm(7), elemental_chaos_fire
4:03.427 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), hailstorm(7), ice_strike, elemental_chaos_fire
4:04.703 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), hailstorm(7), ice_strike, elemental_chaos_fire
4:05.981 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(9), elemental_chaos_fire
4:07.255 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, hot_hand, maelstrom_weapon(9), spiraling_winds, elemental_chaos_fire
4:08.531 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon, hailstorm(9), spiraling_winds(3), elemental_chaos_fire
4:09.808 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), hailstorm(9), spiraling_winds(3), elemental_chaos_fire
4:11.085 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), spiraling_winds(4), elemental_chaos_fire
4:12.363 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon(6), spiraling_winds(4), elemental_chaos_fire
4:13.641 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(7), spiraling_winds(5), elemental_chaos_fire
4:14.919 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, stormbringer, maelstrom_weapon(7), spiraling_winds(6), sophic_devotion, elemental_chaos_fire
4:16.198 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(6), sophic_devotion, elemental_chaos_fire
4:17.476 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), stormbringer, hailstorm(10), ice_strike, spiraling_winds(7), sophic_devotion, elemental_chaos_fire
4:18.756 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), stormbringer, maelstrom_weapon, spiraling_winds(8), sophic_devotion, elemental_chaos_fire
4:20.033 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), maelstrom_weapon, spiraling_winds(8), sophic_devotion, elemental_chaos_fire
4:21.311 single Q lava_lash Fluffy_Pillow 49044.8/50000: 98% mana flurry(2), ashen_catalyst(5), maelstrom_weapon, spiraling_winds(9), sophic_devotion, elemental_chaos_fire
4:22.607 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), hot_hand, maelstrom_weapon, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
4:23.887 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
4:25.164 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
4:26.442 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
4:27.720 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
4:28.996 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
4:30.273 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_fire
4:31.550 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(3), maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_fire
4:32.828 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon, hailstorm(5), ice_strike, spiraling_winds(10), elemental_chaos_fire
4:34.070 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(10), elemental_chaos_fire
4:35.313 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(5), stormbringer, maelstrom_weapon(10), hailstorm(5), ice_strike, spiraling_winds(10), elemental_chaos_fire
4:36.553 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(6), stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(10), elemental_chaos_fire
4:37.680 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(6), stormbringer, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_fire
4:38.807 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(7), maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_fire
4:39.935 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
4:41.064 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
4:42.194 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(6), ice_strike, sophic_devotion, elemental_chaos_fire
4:43.355 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), hailstorm(6), ice_strike, sophic_devotion, elemental_chaos_fire
4:44.483 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
4:45.610 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(2), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
4:46.737 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(2), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
4:47.866 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, maelstrom_weapon(3), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
4:49.145 Waiting     1.063 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(3), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
4:50.208 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
4:51.620 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
4:52.861 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), hailstorm(5), sophic_devotion, forgestorm_ignited, elemental_chaos_fire
4:54.137 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), stormbringer, maelstrom_weapon(2), hailstorm(5), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
4:55.415 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(6), stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
4:56.693 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(7), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
4:57.971 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana hot_hand, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_fire
4:59.249 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_fire

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.82% 15.82% 1047
Haste 17.79% 17.79% 3025
Versatility 7.11% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 58.70% 58.70% 3843
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +386 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1047
# gear_haste_rating=3025
# gear_mastery_rating=3843
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Gamba : 48152 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
48151.7 48151.7 86.5 / 0.180% 14967.6 / 31.1% 53.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
844.1 841.5 Mana 1.47% 52.2 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Gamba 48152
Ascendance (_dre) 0 (1066) 0.0% (2.2%) 8.3 30.64sec 38239 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.35 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1066 2.2% 8.3 30.64sec 38239 0 Direct 8.3 31945 64226 38238 19.5% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.35 8.35 0.00 0.00 0.00 0.0000 0.0000 319181.22 319181.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 6.72 0 20 31944.82 26454 55551 31916.72 0 49236 214657 214657 0.00%
crit 19.50% 1.63 0 8 64226.39 52908 109483 51454.93 0 109483 104524 104524 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 84 0.2% 3.7 90.41sec 6681 6108 Direct 3.7 6681 0 6681 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0939 0.0000 24938.15 35626.84 30.00% 6107.80 6107.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 6680.63 3838 14030 6697.01 5198 9112 24938 35627 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 7084 14.7% 25.1 11.77sec 84692 72120 Direct 25.1 70139 140722 84729 20.7% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.08 25.07 0.00 0.00 0.00 1.1743 0.0000 2124220.88 2124220.88 0.00% 72119.95 72119.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.33% 19.89 10 30 70138.75 45017 149965 70166.15 57080 85735 1394914 1394914 0.00%
crit 20.67% 5.18 0 14 140722.15 90033 296110 140214.12 0 244159 729307 729307 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [R]:25.08
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 1550 3.2% 30.1 9.83sec 15449 34958 Direct 30.1 2805 5631 3296 17.4% 0.0%
Periodic 186.9 1667 3346 1957 17.3% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.08 30.08 186.87 186.87 28.78 0.4420 1.5555 464760.16 464760.16 0.00% 1528.98 34957.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 24.86 11 42 2804.63 2342 5016 2806.21 2497 3288 69715 69715 0.00%
crit 17.37% 5.23 0 16 5631.07 4685 9904 5604.21 0 9052 29425 29425 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.72% 154.58 107 200 1666.51 1 2984 1667.21 1528 1922 257618 257618 0.00%
crit 17.28% 32.28 11 56 3345.63 16 5968 3347.03 2984 3924 108002 108002 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [N]:1.30
  • if_expr:!ticking
    single
    [Z]:10.20
Flametongue Weapon 0 (1560) 0.0% (3.2%) 1.0 0.00sec 467426 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1560 3.2% 1129.5 0.67sec 414 0 Direct 1129.5 353 707 414 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1129.45 1129.45 0.00 0.00 0.00 0.0000 0.0000 467426.40 467426.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 934.48 638 1312 352.58 290 614 352.80 323 403 329485 329485 0.00%
crit 17.26% 194.97 118 287 707.49 580 1229 707.99 640 810 137942 137942 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1111 2.3% 29.0 7.58sec 11518 0 Direct 29.0 9807 19718 11518 17.3% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.96 28.96 0.00 0.00 0.00 0.0000 0.0000 333623.34 333623.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 23.96 2 64 9806.52 9732 10030 9806.57 9732 10030 234982 234982 0.00%
crit 17.27% 5.00 0 19 19718.32 19463 20059 19366.63 0 20059 98641 98641 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1055 2.2% 16.7 16.78sec 18891 16137 Direct 16.7 16085 32228 18891 17.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.74 16.74 0.00 0.00 0.00 1.1707 0.0000 316288.35 316288.35 0.00% 16137.16 16137.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 13.83 3 31 16085.17 7567 32412 16158.57 12082 20930 222493 222493 0.00%
crit 17.38% 2.91 0 13 32228.11 15135 64235 30705.56 0 56361 93795 93795 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [X]:16.74
Ice Strike 1450 3.0% 20.3 14.86sec 21372 18451 Direct 20.3 18187 36521 21372 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.32 20.32 0.00 0.00 0.00 1.1583 0.0000 434296.00 434296.00 0.00% 18450.85 18450.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 16.79 8 26 18186.87 15041 31988 18195.44 16042 21615 305384 305384 0.00%
crit 17.37% 3.53 0 12 36521.11 30081 63977 35790.63 0 59225 128912 128912 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:2.55
  • if_expr:buff.doom_winds_talent.up
    single
    [T]:17.77
Lava Lash 1378 2.9% 18.6 15.75sec 22226 18953 Direct 18.6 18916 37938 22226 17.4% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.58 18.58 0.00 0.00 0.00 1.1727 0.0000 413027.95 413027.95 0.00% 18953.19 18953.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 15.35 6 24 18916.10 15840 33688 18921.00 16794 22125 290344 290344 0.00%
crit 17.40% 3.23 0 11 37938.15 31680 65662 36788.32 0 64424 122684 122684 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [O]:4.16
  • if_expr:dot.flame_shock.refreshable
    single
    [U]:14.42
Lightning Bolt 2833 5.9% 16.5 17.11sec 51602 43931 Direct 16.5 42388 85202 51601 21.5% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.46 16.46 0.00 0.00 0.00 1.1747 0.0000 849441.37 849441.37 0.00% 43930.56 43930.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.48% 12.92 3 25 42387.55 28471 93465 42419.79 33479 54818 547612 547612 0.00%
crit 21.52% 3.54 0 11 85202.14 56942 186930 83344.60 0 175536 301829 301829 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [S]:4.18
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [V]:12.28
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1426 3.0% 163.1 2.14sec 2621 1543 Direct 163.1 2592 5209 2621 17.3% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 163.05 163.05 0.00 0.00 0.00 1.6987 0.0000 427366.70 610539.42 30.00% 1542.93 1542.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.35% 108.18 60 161 2592.44 2204 4445 2593.67 2335 2997 280458 400664 30.00%
crit 17.30% 28.20 9 55 5209.50 4408 8891 5211.75 4525 6164 146909 209876 30.00%
miss 16.36% 26.67 10 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 731 1.5% 166.8 2.09sec 1313 773 Direct 166.8 1298 2610 1313 17.3% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 166.75 166.75 0.00 0.00 0.00 1.6988 0.0000 218980.53 312837.30 30.00% 773.01 773.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.29% 110.54 59 168 1298.40 1102 2223 1299.08 1176 1466 143526 205042 30.00%
crit 17.34% 28.91 9 56 2609.77 2204 4445 2610.64 2317 3078 75455 107795 30.00%
miss 16.37% 27.30 10 53 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7867) 0.0% (16.3%) 91.9 3.25sec 25644 22068

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 91.93 0.00 0.00 0.00 0.00 1.1620 0.0000 0.00 0.00 0.00% 22067.70 22067.70

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:12.89
  • if_expr:buff.doom_winds_talent.up
    single
    [Q]:79.04
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Stormstrike (_mh) 4239 (5245) 8.8% (10.9%) 122.6 3.25sec 12823 0 Direct 122.6 (183.6) 8813 17736 10363 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.57 122.57 0.00 0.00 0.00 0.0000 0.0000 1270192.63 1814607.17 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 101.28 53 166 8812.89 2743 25073 8833.50 7536 10655 892596 1275170 30.00%
crit 17.37% 21.29 6 45 17736.43 5486 49280 17780.70 10920 24460 377596 539437 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 1007 2.1% 61.1 5.47sec 4938 0 Direct 61.1 4938 0 4938 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.07 61.07 0.00 0.00 0.00 0.0000 0.0000 301537.98 301537.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.07 22 108 4937.62 1205 21639 4953.66 3798 6511 301538 301538 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2119 (2622) 4.4% (5.4%) 122.6 3.25sec 6410 0 Direct 122.6 (183.6) 4407 8861 5180 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.57 122.57 0.00 0.00 0.00 0.0000 0.0000 634945.19 907087.68 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 101.30 53 167 4407.24 1372 12536 4417.72 3756 5264 446446 637796 30.00%
crit 17.36% 21.27 5 42 8860.54 2743 24493 8882.16 5660 12192 188499 269291 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 503 1.0% 61.1 5.47sec 2468 0 Direct 61.1 2468 0 2468 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.07 61.07 0.00 0.00 0.00 0.0000 0.0000 150728.44 150728.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.07 22 108 2468.15 602 11149 2476.87 1934 3429 150728 150728 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1051 2.2% 6.4 49.21sec 49144 42387 Direct 6.4 41896 83991 49144 17.2% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 6.41 0.00 0.00 0.00 1.1595 0.0000 314808.01 314808.01 0.00% 42386.97 42386.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.78% 5.30 1 9 41895.76 26739 81436 41935.19 26739 57192 222162 222162 0.00%
crit 17.22% 1.10 0 6 83991.46 53478 181403 58081.03 0 181403 92646 92646 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [M]:1.65
  • if_expr:buff.doom_winds_talent.up
    single
    [W]:4.76
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7142) 0.0% (14.8%) 1.0 0.00sec 2137192 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7142 14.8% 417.3 2.40sec 5122 0 Direct 417.3 4366 8751 5122 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 417.29 417.29 0.00 0.00 0.00 0.0000 0.0000 2137192.23 3053209.61 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.77% 345.39 210 542 4366.04 1488 12821 4365.07 3686 5227 1507977 2154308 30.00%
crit 17.23% 71.90 32 125 8750.92 2976 25310 8750.02 7000 11065 629215 898901 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 505 1.0% 33.7 8.45sec 4492 3195 Direct 33.7 3700 7439 4491 21.2% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.68 33.68 0.00 0.00 0.00 1.4058 0.0000 151279.00 151279.00 0.00% 3195.11 3195.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.83% 26.55 0 82 3700.14 3148 6351 3701.62 0 5429 98244 98244 0.00%
crit 21.17% 7.13 0 24 7438.61 6297 12540 7362.72 0 11572 53035 53035 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 292 0.6% 39.0 7.31sec 2244 1545 Direct 39.0 1851 3718 2244 21.1% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.98 38.98 0.00 0.00 0.00 1.4527 0.0000 87482.38 87482.38 0.00% 1544.89 1544.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.92% 30.76 0 80 1850.59 1574 3175 1851.65 0 2683 56933 56933 0.00%
crit 21.08% 8.22 0 31 3718.18 3148 6351 3696.91 0 5569 30549 30549 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (7066) 0.0% (14.7%) 27.5 8.59sec 77030 66924

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.46 0.00 0.00 0.00 0.00 1.1510 0.0000 0.00 0.00 0.00% 66923.65 66923.65

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:27.40
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [P]:0.06
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1919 (2267) 4.0% (4.7%) 36.6 8.59sec 18528 0 Direct 36.6 (49.1) 13377 26883 15691 17.1% (12.8%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.62 36.61 0.00 0.00 0.00 0.0000 0.0000 574377.77 574377.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.87% 30.33 0 97 13377.46 3919 36278 13371.35 0 20195 405794 405794 0.00%
crit 17.13% 6.27 0 32 26882.96 7838 67028 26390.67 0 52533 168583 168583 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 348 0.7% 12.5 18.26sec 8344 0 Direct 12.5 8343 0 8343 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.48 12.48 0.00 0.00 0.00 0.0000 0.0000 104132.88 104132.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.48 0 40 8343.45 2898 28924 8262.81 0 19770 104133 104133 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 960 (1134) 2.0% (2.4%) 36.6 8.59sec 9266 0 Direct 36.6 (49.1) 6690 13426 7849 17.2% (12.8%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.62 36.61 0.00 0.00 0.00 0.0000 0.0000 287313.81 287313.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.80% 30.31 0 93 6690.42 1959 18139 6685.80 0 10467 202776 202776 0.00%
crit 17.20% 6.30 0 25 13425.60 3919 33260 13178.29 0 27863 84537 84537 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 174 0.4% 12.5 18.26sec 4168 0 Direct 12.5 4168 0 4168 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.48 12.48 0.00 0.00 0.00 0.0000 0.0000 52019.99 52019.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.48 0 40 4168.03 1338 14604 4126.47 0 10696 52020 52020 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3666 7.6% 27.4 8.61sec 40048 0 Direct 27.4 32995 66258 40047 21.2% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.40 27.40 0.00 0.00 0.00 0.0000 0.0000 1097411.34 1097411.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.80% 21.59 0 65 32995.49 15817 60972 33020.61 0 47243 712500 712500 0.00%
crit 21.20% 5.81 0 25 66257.61 31634 120392 65176.88 0 114506 384912 384912 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 425 / 89
melee 425 0.2% 41.0 2.37sec 648 432 Direct 41.0 552 1105 648 17.2% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.96 40.96 0.00 0.00 0.00 1.5000 0.0000 26524.94 37893.74 30.00% 431.69 431.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.76% 33.90 21 63 552.31 490 953 551.79 490 702 18725 26751 30.00%
crit 17.24% 7.06 0 20 1104.66 980 1906 1103.95 0 1463 7800 11143 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4032 / 2811
melee 4032 5.8% 365.7 1.63sec 2302 2015 Direct 365.7 1964 3922 2302 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 365.68 365.68 0.00 0.00 0.00 1.1422 0.0000 841760.80 1202546.08 30.00% 2015.22 2015.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 302.51 187 423 1963.56 1660 3348 1964.69 1807 2206 594006 848602 30.00%
crit 17.27% 63.17 29 111 3922.05 3321 6696 3924.96 3524 4488 247755 353945 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Gamba
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.2 308.99sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.15 0.00 0.00 0.00 0.00 1.0022 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Y]:1.15
Feral Spirit 14.7 21.44sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.70 0.00 0.00 0.00 0.00 1.1537 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:14.70
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.00
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 6.4 0.0 41.4sec 41.4sec 7.7sec 16.50% 91.39% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 320.8s
  • trigger_min/max:6.0s / 320.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 84.0s

Stack Uptimes

  • ascendance_1:16.50%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.1s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.73%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.74%
  • crumbling_power_19:1.21%
  • crumbling_power_20:0.06%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds (_talent) 3.7 0.0 90.4sec 90.4sec 7.9sec 9.88% 11.41% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_doom_winds_talent
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_talent_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 14.7 0.0 24.1sec 21.0sec 17.5sec 69.69% 100.00% 0.0 (0.0) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.7s / 106.7s
  • trigger_min/max:6.7s / 44.3s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 101.3s

Stack Uptimes

  • earthen_weapon_2:67.52%
  • earthen_weapon_4:2.17%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.4 1.0 37.6sec 32.8sec 10.8sec 26.46% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 257.1s
  • trigger_min/max:1.7s / 257.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.6s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.46%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.5 1.0 37.4sec 32.6sec 10.7sec 26.60% 0.00% 1.0 (1.0) 7.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 310.7s
  • trigger_min/max:1.7s / 310.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.7s

Stack Uptimes

  • elemental_blast_haste_1:26.60%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.4 1.0 37.7sec 32.9sec 10.7sec 26.33% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 293.4s
  • trigger_min/max:1.7s / 293.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.0s

Stack Uptimes

  • elemental_blast_mastery_1:26.33%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.2sec 99.0sec 57.8sec 25.21% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:25.21%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 125.3sec 101.4sec 57.6sec 24.69% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 314.8s

Stack Uptimes

  • elemental_chaos_earth_1:24.69%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.0sec 98.4sec 58.5sec 24.89% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.8s

Stack Uptimes

  • elemental_chaos_fire_1:24.89%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.8sec 99.4sec 58.3sec 25.22% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.22%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0sec 0.0sec 29.4sec 9.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.6s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.94%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 11.9 2.8 26.1sec 21.4sec 17.5sec 69.70% 0.00% 59.4 (59.4) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 106.7s
  • trigger_min/max:7.4s / 44.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 101.2s

Stack Uptimes

  • feral_spirit_1:69.70%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.6 387.7 6.9sec 0.7sec 5.9sec 85.19% 90.86% 387.7 (920.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 77.5s
  • trigger_min/max:0.0s / 16.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.5s

Stack Uptimes

  • flurry_1:19.86%
  • flurry_2:34.75%
  • flurry_3:30.58%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 121.7 17.7sec 2.1sec 14.6sec 84.88% 100.00% 58.4 (58.4) 16.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 45.4s
  • trigger_min/max:0.0s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.51%
  • forceful_winds_2:13.81%
  • forceful_winds_3:12.39%
  • forceful_winds_4:10.62%
  • forceful_winds_5:33.55%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.3sec 46.2sec 13.0sec 19.60% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 202.8s
  • trigger_min/max:0.3s / 202.8s
  • trigger_pct:98.96%
  • duration_min/max:0.0s / 50.8s

Stack Uptimes

  • forgestorm_ignited_1:19.60%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 19.2 1.1 15.8sec 14.9sec 7.7sec 49.07% 79.38% 1.1 (1.1) 5.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.3s / 88.6s
  • trigger_min/max:8.3s / 88.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.3s

Stack Uptimes

  • ice_strike_1:49.07%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 23.3 20.3 12.8sec 6.8sec 7.9sec 61.65% 0.00% 20.3 (20.3) 22.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 78.5s
  • trigger_min/max:0.8s / 40.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 89.1s

Stack Uptimes

  • legacy_of_the_frost_witch_1:61.65%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 49.9 420.3 6.1sec 1.2sec 5.2sec 86.89% 100.00% 66.1 (70.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 42.1s
  • trigger_min/max:0.0s / 8.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.8s

Stack Uptimes

  • maelstrom_weapon_1:8.93%
  • maelstrom_weapon_2:10.46%
  • maelstrom_weapon_3:12.14%
  • maelstrom_weapon_4:12.69%
  • maelstrom_weapon_5:8.52%
  • maelstrom_weapon_6:7.21%
  • maelstrom_weapon_7:5.64%
  • maelstrom_weapon_8:4.78%
  • maelstrom_weapon_9:3.83%
  • maelstrom_weapon_10:12.68%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.8sec 45.4sec 16.5sec 23.74% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 213.1s
  • trigger_min/max:0.1s / 213.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.3s

Stack Uptimes

  • sophic_devotion_1:23.74%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.0sec 45.3sec 32.3sec 38.35% 0.00% 25.9 (25.9) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 265.6s
  • trigger_min/max:0.0s / 202.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 196.3s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.28%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.22%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.90%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 6.5 1.8 40.6sec 30.7sec 7.1sec 15.54% 100.00% 41.4 (41.4) 6.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 320.8s
  • trigger_min/max:0.8s / 320.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.1s

Stack Uptimes

  • static_accumulation_1:15.54%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 63.0 19.3 4.7sec 3.6sec 1.1sec 23.69% 52.43% 19.3 (19.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 66.6s
  • trigger_min/max:0.0s / 66.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • stormbringer_1:23.69%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.8 36.0 66.0 17.8s 15.0s 53.3s
Windfury-ForcefulWinds: 2 51.5 33.0 72.0 18.0s 0.4s 63.6s
Windfury-ForcefulWinds: 3 49.9 30.0 75.0 18.5s 0.7s 107.8s
Windfury-ForcefulWinds: 4 46.7 24.0 69.0 19.8s 1.1s 105.9s
Windfury-ForcefulWinds: 5 217.4 108.0 366.0 4.6s 0.0s 96.3s
windfury_totem_extra_attack_mh 28.1 10.0 51.0 10.4s 1.2s 128.4s
windfury_totem_extra_attack_oh 29.5 9.0 56.0 9.9s 0.1s 126.5s
Windfury: Unruly Winds 139.1 83.0 207.0 2.4s 0.0s 40.2s
Maelstrom Weapon: Feral Spirit 79.8 53.0 110.0 3.8s 0.0s 29.3s
Maelstrom Weapon: Elemental Assault 119.4 74.0 167.0 2.5s 0.8s 9.9s
Maelstrom Weapon: Static Accumulation 89.4 0.0 226.0 5.3s 1.0s 288.2s
Stormflurry 39.8 11.0 75.0 9.8s 0.8s 129.8s
Flametongue: Windfury Attack 417.3 249.0 621.0 2.4s 0.0s 40.2s
Stormbringer: Windfury Attack 44.0 15.0 81.0 7.7s 0.0s 104.8s
Maelstrom Weapon: Windfury Attack 83.7 43.0 132.0 4.6s 0.0s 66.7s
Flametongue: main_hand 136.4 78.0 197.0 2.6s 1.2s 92.5s
Maelstrom Weapon: main_hand 27.3 8.0 49.0 11.1s 1.2s 159.2s
Windfury: main_hand 52.0 24.0 89.0 6.3s 1.2s 95.8s
Flametongue: Windlash 33.7 0.0 96.0 8.5s 1.2s 291.0s
Maelstrom Weapon: Windlash 6.8 0.0 28.0 32.5s 1.2s 320.6s
Windfury: Windlash 12.7 0.0 40.0 19.6s 1.2s 319.9s
Flametongue: offhand 139.5 77.0 199.0 2.6s 1.2s 91.6s
Maelstrom Weapon: offhand 28.0 9.0 53.0 10.8s 1.2s 144.6s
Flametongue: Windlash Off-Hand 39.0 0.0 99.0 7.3s 0.0s 315.6s
Maelstrom Weapon: Windlash Off-Hand 7.8 0.0 27.0 29.3s 0.2s 321.5s
Flametongue: Sundering 6.4 3.0 9.0 49.2s 40.0s 151.7s
Stormbringer: Sundering 0.7 0.0 4.0 111.9s 40.0s 332.9s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 104.1s 40.0s 342.2s
Windfury: Sundering 3.1 0.0 8.0 88.1s 40.0s 347.5s
Flametongue: Windstrike 36.6 0.0 114.0 8.6s 0.8s 289.5s
Stormbringer: Windstrike 3.8 0.0 18.0 45.7s 0.8s 330.9s
Maelstrom Weapon: Windstrike 7.4 0.0 26.0 30.6s 0.8s 327.5s
Windfury: Windstrike 14.0 0.0 46.0 18.8s 0.8s 295.6s
Flametongue: Windstrike Off-Hand 36.6 0.0 114.0 8.6s 0.8s 289.5s
Stormbringer: Windstrike Off-Hand 3.8 0.0 18.0 45.5s 0.8s 335.2s
Maelstrom Weapon: Windstrike Off-Hand 7.3 0.0 30.0 30.9s 0.8s 329.4s
Flametongue: Lava Lash 18.6 12.0 26.0 15.7s 8.4s 83.0s
Stormbringer: Lava Lash 2.0 0.0 8.0 77.5s 8.7s 335.0s
Maelstrom Weapon: Lava Lash 3.7 0.0 12.0 58.5s 8.7s 320.5s
Flametongue: Ice Strike 20.3 10.0 28.0 14.9s 8.3s 88.6s
Stormbringer: Ice Strike 2.1 0.0 9.0 77.6s 8.3s 340.0s
Maelstrom Weapon: Ice Strike 4.1 0.0 12.0 57.4s 8.3s 326.8s
Windfury: Ice Strike 8.0 2.0 17.0 37.1s 8.3s 291.1s
Flametongue: Stormstrike 122.6 69.0 189.0 3.3s 0.8s 87.5s
Stormbringer: Stormstrike 12.9 1.0 34.0 22.1s 0.8s 245.7s
Maelstrom Weapon: Stormstrike 24.5 7.0 49.0 12.6s 0.8s 152.8s
Windfury: Stormstrike 49.4 21.0 92.0 7.1s 0.8s 114.5s
Flametongue: Stormstrike Off-Hand 122.6 69.0 189.0 3.3s 0.8s 87.5s
Stormbringer: Stormstrike Off-Hand 12.9 1.0 31.0 22.1s 0.8s 252.0s
Maelstrom Weapon: Stormstrike Off-Hand 24.5 7.0 50.0 12.6s 0.8s 160.8s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 26.35% 14.27% 45.21% 0.8s 0.0s 29.6s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7910.0011.47910.2292.89319.230
Doom Winds0.5240.0012.4481.1180.0005.225
Sundering9.6090.001111.69949.5263.892145.149
Windstrike1.0490.0013.94428.5520.00084.031
Lava Lash4.1000.00173.30370.16720.766144.177
Flame Shock21.1150.001270.038219.60138.740319.467
Ice Strike3.3950.00176.51063.12810.986136.643
Frost Shock12.4820.001167.804190.35168.039290.307
Elemental Blast4.0960.00145.4093.3900.00048.197
Stormstrike1.0510.0014.98092.02148.907148.856
Earth Elemental9.4930.00546.1191.3380.00046.119

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Gamba
mana_regenMana669.36252441.77100.00%377.14226956.8947.34%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 841.47 844.06 226957.3 49224.8 42565.8 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Gamba
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 25.0834487.551375.001375.0161.59
Flame ShockMana 11.508624.85750.00286.7153.89
Frost ShockMana 16.748371.42500.00500.0137.78
Ice StrikeMana 20.3233529.911650.001650.0012.95
Lava LashMana 18.587433.14400.00400.0055.57
Lightning BoltMana 16.468230.70500.00500.00103.20
StormstrikeMana 122.57122571.791000.001333.3219.23
SunderingMana 6.4119217.843000.003000.0716.38

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Gamba Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Gamba Damage Per Second
Count 7499
Mean 48151.72
Minimum 35367.32
Maximum 62502.24
Spread ( max - min ) 27134.92
Range [ ( max - min ) / 2 * 100% ] 28.18%
Standard Deviation 3822.9481
5th Percentile 42366.38
95th Percentile 54847.51
( 95th Percentile - 5th Percentile ) 12481.13
Mean Distribution
Standard Deviation 44.1465
95.00% Confidence Interval ( 48065.20 - 48238.25 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 243
0.1% Error 24215
0.1 Scale Factor Error with Delta=300 124762
0.05 Scale Factor Error with Delta=300 499046
0.01 Scale Factor Error with Delta=300 12476147
Priority Target DPS
PR_Shaman_Enhancement_Gamba Priority Target Damage Per Second
Count 7499
Mean 48151.72
Minimum 35367.32
Maximum 62502.24
Spread ( max - min ) 27134.92
Range [ ( max - min ) / 2 * 100% ] 28.18%
Standard Deviation 3822.9481
5th Percentile 42366.38
95th Percentile 54847.51
( 95th Percentile - 5th Percentile ) 12481.13
Mean Distribution
Standard Deviation 44.1465
95.00% Confidence Interval ( 48065.20 - 48238.25 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 243
0.1% Error 24215
0.1 Scale Factor Error with Delta=300 124762
0.05 Scale Factor Error with Delta=300 499046
0.01 Scale Factor Error with Delta=300 12476147
DPS(e)
PR_Shaman_Enhancement_Gamba Damage Per Second (Effective)
Count 7499
Mean 48151.72
Minimum 35367.32
Maximum 62502.24
Spread ( max - min ) 27134.92
Range [ ( max - min ) / 2 * 100% ] 28.18%
Damage
PR_Shaman_Enhancement_Gamba Damage
Count 7499
Mean 13556972.70
Minimum 8629875.84
Maximum 19313849.10
Spread ( max - min ) 10683973.26
Range [ ( max - min ) / 2 * 100% ] 39.40%
DTPS
PR_Shaman_Enhancement_Gamba Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Gamba Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Gamba Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Gamba Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Gamba Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Gamba Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_GambaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Gamba Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.00 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 14.70 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
G 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 27.40 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
K 12.89 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
L 2.55 ice_strike,if=buff.doom_winds_talent.up
M 1.65 sundering,if=buff.doom_winds_talent.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
N 1.30 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 frost_shock,if=buff.hailstorm.up
O 4.16 lava_lash,if=dot.flame_shock.refreshable
P 0.06 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
Q 79.04 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 25.08 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
S 4.18 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
0.00 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
T 17.77 ice_strike
U 14.42 lava_lash
0.00 bag_of_tricks
V 12.28 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 4.76 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
X 16.74 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Y 1.15 earth_elemental
Z 10.20 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGKKJJJJJJFJJJJJJNJJFJJJJTJJUJRJWJJFRQQTQJJRJJQOVQFTVXQYZURQXTZRQQVUWXQTZXQRFQUVTXQZGKRKUKLQQQQFQRQUTRQWXVZQXUTRQQQVQFXQSQRTOXQQQQJJFJQRQTUQVWXZQQRQQTFQJJJJREDQGLFOKKKKRQQQQRQTOQWXZFQRQTUVQJXJJRQTUXZQFQQRQJTJJSQFUWRQTVXZQUXRQTXZQVUXBZGKLKFKRQUXZQQRQTRQQJUJFQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 2 augmentation PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_earth
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), elemental_chaos_earth
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), crumbling_power(20), elemental_chaos_earth
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry(2), crumbling_power(20), elemental_chaos_earth
0:00.867 default G doom_winds Fluffy_Pillow 40637.2/50000: 81% mana bloodlust, berserking, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_earth
0:01.734 single K stormstrike Fluffy_Pillow 42024.4/50000: 84% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, doom_winds_talent, crumbling_power(19), elemental_chaos_earth
0:02.601 single K stormstrike Fluffy_Pillow 42411.6/50000: 85% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds_talent, crumbling_power(18), elemental_chaos_earth
0:03.467 single J windstrike Fluffy_Pillow 42797.2/50000: 86% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, doom_winds_talent, crumbling_power(17), elemental_chaos_earth
0:04.334 single J windstrike Fluffy_Pillow 44184.4/50000: 88% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, crumbling_power(16), elemental_chaos_earth
0:05.202 single J windstrike Fluffy_Pillow 45573.2/50000: 91% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(15), elemental_chaos_earth
0:06.070 single J windstrike Fluffy_Pillow 46962.0/50000: 94% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_earth
0:06.939 single J windstrike Fluffy_Pillow 48352.4/50000: 97% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_earth
0:07.807 single J windstrike Fluffy_Pillow 49741.2/50000: 99% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_earth
0:08.674 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_earth
0:09.542 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, crumbling_power(10), forgestorm_ignited, elemental_chaos_earth
0:10.409 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, crumbling_power(9), forgestorm_ignited, elemental_chaos_earth
0:11.279 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, crumbling_power(8), forgestorm_ignited, elemental_chaos_earth
0:12.147 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, crumbling_power(7), forgestorm_ignited, elemental_chaos_earth
0:13.099 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, crumbling_power(6), forgestorm_ignited, elemental_chaos_earth
0:14.052 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(2), static_accumulation, legacy_of_the_frost_witch, crumbling_power(5), forgestorm_ignited, elemental_chaos_earth
0:15.006 single N flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, crumbling_power(4), forgestorm_ignited, elemental_chaos_earth
0:15.959 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, crumbling_power(3), forgestorm_ignited, elemental_chaos_earth
0:16.913 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, crumbling_power(2), forgestorm_ignited, elemental_chaos_earth
0:17.867 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, crumbling_power, forgestorm_ignited, elemental_chaos_earth
0:18.821 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, earthen_weapon(4), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
0:19.775 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, earthen_weapon(4), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
0:20.728 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, feral_spirit, forceful_winds(2), earthen_weapon(4), stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
0:21.681 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, feral_spirit, forceful_winds(2), earthen_weapon(4), maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_chaos_earth
0:22.634 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, feral_spirit, forceful_winds(3), earthen_weapon(4), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth
0:23.586 single J windstrike Fluffy_Pillow 49873.2/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:24.540 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:25.495 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:26.447 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:27.402 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:28.355 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:29.309 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:30.262 single J windstrike Fluffy_Pillow 48524.8/50000: 97% mana bloodlust, ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:31.215 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:32.169 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:33.121 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:34.074 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:35.028 single Q stormstrike Fluffy_Pillow 48526.4/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_earth
0:35.982 single T ice_strike Fluffy_Pillow 49052.8/50000: 98% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), elemental_chaos_earth
0:36.936 single Q stormstrike Fluffy_Pillow 48929.2/50000: 98% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_earth
0:37.892 single J windstrike Fluffy_Pillow 49458.8/50000: 99% mana bloodlust, ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, elemental_chaos_earth
0:38.847 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:39.801 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:40.756 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:41.993 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:43.230 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:44.470 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:45.707 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:46.947 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:48.187 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_earth
0:49.424 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_earth
0:50.662 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:51.900 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, elemental_chaos_earth
0:53.139 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, elemental_chaos_earth
0:54.376 single Y earth_elemental Fluffy_Pillow 49979.2/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_earth
0:55.617 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_earth
0:56.856 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_earth
0:58.095 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), elemental_chaos_earth
0:59.333 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
1:00.572 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
1:01.773 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
1:02.973 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:04.172 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(6), ice_strike, elemental_chaos_air
1:05.372 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:06.573 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:07.775 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:08.975 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:10.175 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon, ice_strike, spiraling_winds, elemental_chaos_air
1:11.374 single X frost_shock Fluffy_Pillow 48918.4/50000: 98% mana flurry, elemental_blast_critical_strike, maelstrom_weapon(2), ice_strike, spiraling_winds(2), elemental_chaos_air
1:12.575 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon(2), spiraling_winds(2), elemental_chaos_air
1:13.777 single T ice_strike Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon(3), spiraling_winds(3), elemental_chaos_air
1:14.974 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(3), ice_strike, spiraling_winds(3), elemental_chaos_air
1:16.176 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(3), ice_strike, spiraling_winds(4), elemental_chaos_air
1:17.376 Waiting     0.981 sec 50000.0/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(3), spiraling_winds(5), elemental_chaos_air
1:18.357 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds, maelstrom_weapon(3), spiraling_winds(5), sophic_devotion, elemental_chaos_air
1:19.758 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(2), maelstrom_weapon(6), spiraling_winds(6), sophic_devotion, elemental_chaos_air
1:20.957 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, elemental_chaos_air
1:22.122 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, elemental_chaos_air
1:23.287 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, elemental_chaos_air
1:24.452 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, elemental_chaos_air
1:25.618 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), spiraling_winds(9), sophic_devotion, elemental_chaos_air
1:26.784 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, spiraling_winds(9), sophic_devotion, elemental_chaos_air
1:27.950 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:29.115 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:30.280 Waiting     0.397 sec 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:30.677 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:32.069 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds_talent, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:33.269 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), doom_winds_talent, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:34.471 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), doom_winds_talent, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:35.670 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), doom_winds_talent, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_air
1:36.870 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(7), doom_winds_talent, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:38.069 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(10), doom_winds_talent, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:39.269 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_air
1:40.471 single Q stormstrike Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_air
1:41.672 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_air
1:42.873 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_air
1:44.072 default F feral_spirit Fluffy_Pillow 48918.4/50000: 98% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, forgestorm_ignited, elemental_chaos_air
1:45.273 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_air
1:46.474 single R elemental_blast Fluffy_Pillow 48921.6/50000: 98% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_air
1:47.676 single Q stormstrike Fluffy_Pillow 49469.8/50000: 99% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:48.875 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:50.076 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_air
1:51.278 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:52.603 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:53.768 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:54.934 single X frost_shock Fluffy_Pillow 48865.6/50000: 98% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:56.101 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:57.265 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), forgestorm_ignited, elemental_chaos_air
1:58.431 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, forgestorm_ignited, elemental_chaos_air
1:59.597 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_air
2:00.762 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_earth
2:01.964 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_earth
2:03.202 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(8), ice_strike, elemental_chaos_earth
2:04.643 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:05.845 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:07.049 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:08.250 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:09.454 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:10.658 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:11.859 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:13.061 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_earth
2:14.264 single S lightning_bolt Fluffy_Pillow 49924.8/50000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_earth
2:15.502 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
2:16.743 single R elemental_blast Fluffy_Pillow 49985.6/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_earth
2:17.983 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
2:19.185 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:20.388 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, elemental_chaos_earth
2:21.591 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, forgestorm_ignited, elemental_chaos_earth
2:22.794 single Q stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_earth
2:23.996 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_earth
2:25.198 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_earth
2:26.400 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(10), static_accumulation, forgestorm_ignited, elemental_chaos_earth
2:27.605 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), forceful_winds(4), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:28.845 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), forceful_winds(4), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:30.081 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:31.320 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:32.558 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
2:33.797 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
2:35.037 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
2:36.273 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:37.511 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:38.750 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_earth
2:39.989 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, elemental_chaos_earth
2:41.227 single X frost_shock Fluffy_Pillow 48980.8/50000: 98% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, elemental_chaos_earth
2:42.466 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_earth
2:43.703 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_earth
2:44.940 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds, stormbringer, maelstrom_weapon(7), elemental_chaos_earth
2:46.178 single R elemental_blast Fluffy_Pillow 49980.8/50000: 100% mana flurry, forceful_winds, maelstrom_weapon(9), elemental_chaos_earth
2:47.418 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_earth
2:48.659 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_earth
2:49.899 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_earth
2:51.137 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
2:52.376 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(4), elemental_chaos_earth
2:53.614 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, spiraling_winds(5), elemental_chaos_earth
2:54.852 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth
2:56.090 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth
2:57.329 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth
2:58.568 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth
2:59.805 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth
3:00.000 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_mastery, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air
3:00.000 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_mastery, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(20), spiraling_winds(8), elemental_chaos_air
3:01.091 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(9), elemental_chaos_air
3:02.183 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(9), elemental_chaos_air
3:03.275 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(18), spiraling_winds(10), elemental_chaos_air
3:04.368 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(4), maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(17), spiraling_winds(10), elemental_chaos_air
3:05.461 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(4), maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(16), spiraling_winds(10), elemental_chaos_air
3:06.553 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(15), spiraling_winds(10), elemental_chaos_air
3:07.645 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(14), spiraling_winds(10), elemental_chaos_air
3:08.737 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(13), spiraling_winds(10), elemental_chaos_air
3:09.827 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(12), spiraling_winds(10), elemental_chaos_air
3:10.917 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds(10), elemental_chaos_air
3:12.009 single Q stormstrike Fluffy_Pillow 49747.2/50000: 99% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(10), elemental_chaos_air
3:13.208 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(10), elemental_chaos_air
3:14.408 single Q stormstrike Fluffy_Pillow 49920.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(10), elemental_chaos_air
3:15.608 single R elemental_blast Fluffy_Pillow 49840.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), crumbling_power(7), spiraling_winds(10), elemental_chaos_air
3:16.808 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(10), elemental_chaos_air
3:18.010 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(10), elemental_chaos_air
3:19.210 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(10), elemental_chaos_air
3:20.411 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
3:21.612 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(3), ice_strike, elemental_chaos_air
3:22.811 single X frost_shock Fluffy_Pillow 48918.4/50000: 98% mana elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), ice_strike, elemental_chaos_air
3:24.013 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), elemental_chaos_air
3:25.213 Waiting     1.015 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), elemental_chaos_air
3:26.228 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(4), stormbringer, maelstrom_weapon(6), elemental_chaos_air
3:27.427 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), elemental_chaos_air
3:28.627 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), spiraling_winds, elemental_chaos_air
3:29.827 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_air
3:31.029 single T ice_strike Fluffy_Pillow 47923.2/50000: 96% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_air
3:32.229 single U lava_lash Fluffy_Pillow 48193.2/50000: 96% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_air
3:33.430 single V lightning_bolt Fluffy_Pillow 49714.8/50000: 99% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_air
3:34.631 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_air
3:35.829 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_air
3:37.030 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_air
3:38.230 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_air
3:39.432 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_air
3:40.632 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_air
3:41.831 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_air
3:43.031 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air
3:44.230 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air
3:45.430 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_air
3:46.628 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_air
3:47.828 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_air
3:49.030 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_air
3:50.231 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), spiraling_winds(10), elemental_chaos_air
3:51.431 single Q stormstrike Fluffy_Pillow 49920.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_air
3:52.633 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_air
3:53.833 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:55.035 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:56.236 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:57.439 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:58.639 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:59.838 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion, elemental_chaos_air
4:01.039 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_earth
4:02.280 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_earth
4:03.520 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(4), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, elemental_chaos_earth
4:04.756 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, elemental_chaos_earth
4:05.992 single R elemental_blast Fluffy_Pillow 48977.6/50000: 98% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(4), sophic_devotion, elemental_chaos_earth
4:07.230 single Q stormstrike Fluffy_Pillow 49583.4/50000: 99% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, elemental_chaos_earth
4:08.471 single T ice_strike Fluffy_Pillow 49569.0/50000: 99% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, elemental_chaos_earth
4:09.709 single V lightning_bolt Fluffy_Pillow 49899.8/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth
4:10.948 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth
4:12.186 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon, spiraling_winds(8), elemental_chaos_earth
4:13.425 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon, spiraling_winds(9), elemental_chaos_earth
4:14.663 Waiting     0.978 sec 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(9), elemental_chaos_earth
4:15.641 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_earth
4:17.104 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_earth
4:18.342 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_earth
4:19.582 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:20.819 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:22.058 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:23.298 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:24.536 Waiting     0.996 sec 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_earth
4:25.532 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_earth
4:26.992 single V lightning_bolt Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_earth
4:28.230 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_earth
4:29.469 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_earth
4:30.707 default B potion Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_earth
4:30.707 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:31.947 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:33.183 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(3), doom_winds_talent, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:34.421 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(8), doom_winds_talent, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:35.660 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(8), doom_winds_talent, ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:36.899 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:38.137 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:39.374 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:40.613 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:41.816 single U lava_lash Fluffy_Pillow 48924.8/50000: 98% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:43.017 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:44.218 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:45.422 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:46.624 single Q stormstrike Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:47.827 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:49.030 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:50.233 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:51.435 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:52.637 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:53.841 single Q stormstrike Fluffy_Pillow 49926.4/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:55.044 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:56.244 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:57.446 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(10), static_accumulation, ice_strike, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:58.647 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:59.885 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 25.34% 21.51% 3656
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.07% 52.07% 3246
Armor 3603 3603 3603
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Gamba"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Phys : 46586 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
46586.4 46586.4 52.4 / 0.113% 9145.3 / 19.6% 51.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
848.8 845.9 Mana 1.93% 52.0 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Phys 46586
Ascendance 0 (350) 0.0% (0.7%) 2.0 180.44sec 51870 47939

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0824 0.0000 0.00 0.00 0.00% 47939.45 47939.45

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [G]:2.00
  • if_expr:(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
    Ascendance (_damage) 350 0.7% 2.0 180.44sec 51870 0 Direct 2.0 43758 87874 51871 18.4% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 103740.98 103740.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.61% 1.63 0 2 43757.77 38272 56262 42246.61 0 56262 71423 71423 0.00%
crit 18.39% 0.37 0 2 87874.38 76545 112524 29261.02 0 111101 32318 32318 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 82 0.2% 3.7 90.47sec 6575 6013 Direct 3.7 6575 0 6575 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0938 0.0000 24471.00 34959.46 30.00% 6012.53 6012.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.72 3 4 6575.01 3838 10609 6597.44 5329 8557 24471 34959 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.72
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6674 14.4% 24.7 11.69sec 80967 68300 Direct 24.7 66860 134648 81001 20.9% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.74 24.73 0.00 0.00 0.00 1.1855 0.0000 2002979.23 2002979.23 0.00% 68300.46 68300.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.14% 19.57 9 30 66859.68 45017 144210 66846.77 54299 81602 1308391 1308391 0.00%
crit 20.86% 5.16 0 15 134648.39 90033 284343 134152.70 0 203487 694588 694588 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [S]:24.74
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 1552 3.3% 32.9 8.83sec 14165 28708 Direct 32.9 2776 5572 3259 17.3% 0.0%
Periodic 183.1 1667 3347 1959 17.4% 0.0% 95.5%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.89 32.89 183.12 183.12 31.74 0.4934 1.5645 465926.00 465926.00 0.00% 1539.12 28707.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 27.21 14 43 2776.44 2342 5016 2775.99 2497 3220 75560 75560 0.00%
crit 17.26% 5.68 0 15 5572.28 4685 9886 5553.77 0 8193 31637 31637 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.60% 151.27 105 196 1666.64 2 2984 1666.21 1525 1880 252105 252105 0.00%
crit 17.40% 31.86 12 55 3346.73 17 5892 3345.93 2929 3857 106623 106623 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [O]:1.16
  • if_expr:!ticking
    single
    [b]:12.65
Flametongue Weapon 0 (1526) 0.0% (3.3%) 1.0 0.00sec 456888 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1526 3.3% 1084.2 0.69sec 421 0 Direct 1084.2 359 720 421 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1084.16 1084.16 0.00 0.00 0.00 0.0000 0.0000 456888.12 456888.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 896.99 611 1182 359.15 290 614 359.25 329 412 322152 322152 0.00%
crit 17.26% 187.17 117 284 719.87 580 1229 720.10 657 803 134736 134736 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1101 2.4% 28.6 7.61sec 11526 0 Direct 28.6 9805 19715 11526 17.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.65 28.65 0.00 0.00 0.00 0.0000 0.0000 330179.91 330179.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 23.67 2 69 9805.23 9732 10030 9805.16 9732 10030 232110 232110 0.00%
crit 17.36% 4.97 0 18 19714.99 19463 20059 19362.31 0 20059 98070 98070 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1224 2.6% 20.0 13.83sec 18396 15478 Direct 20.0 15665 31437 18396 17.3% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.00 20.00 0.00 0.00 0.00 1.1886 0.0000 367932.93 367932.93 0.00% 15477.58 15477.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.68% 16.54 5 31 15664.68 7567 31940 15700.48 12142 19437 259055 259055 0.00%
crit 17.32% 3.46 0 11 31437.01 15135 63880 30553.16 0 58944 108878 108878 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [Z]:20.00
Ice Strike 1501 3.2% 21.2 14.16sec 21241 18181 Direct 21.2 18080 36220 21242 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.20 21.20 0.00 0.00 0.00 1.1683 0.0000 450219.29 450219.29 0.00% 18181.13 18181.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.57% 17.50 8 28 18080.40 15041 31988 18073.62 16203 20997 316440 316440 0.00%
crit 17.43% 3.69 0 11 36220.03 30081 63977 35552.77 0 54158 133780 133780 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:2.38
  • if_expr:buff.doom_winds_talent.up
    single
    [V]:18.82
Lava Lash 1398 3.0% 19.1 14.98sec 22000 18555 Direct 19.1 18725 37579 22002 17.4% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.09 19.09 0.00 0.00 0.00 1.1857 0.0000 419952.62 419952.62 0.00% 18554.88 18554.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 15.77 7 25 18724.53 15840 33688 18715.45 16435 21699 295324 295324 0.00%
crit 17.37% 3.32 0 10 37579.32 31680 66395 36345.79 0 58812 124629 124629 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [P]:2.55
  • if_expr:dot.flame_shock.refreshable
    single
    [W]:16.54
Lightning Bolt 3033 6.5% 18.1 15.43sec 50333 42631 Direct 18.1 41294 83061 50334 21.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.11 18.11 0.00 0.00 0.00 1.1807 0.0000 911498.29 911498.29 0.00% 42631.23 42631.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.36% 14.19 4 27 41293.57 28471 91404 41286.56 31698 52695 585932 585932 0.00%
crit 21.64% 3.92 0 14 83061.31 56942 174764 81730.07 0 154274 325566 325566 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [T]:4.05
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [X]:14.06
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1467 3.2% 172.0 1.93sec 2562 1439 Direct 172.0 2531 5090 2562 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 172.00 172.00 0.00 0.00 0.00 1.7802 0.0000 440721.94 629618.82 30.00% 1439.37 1439.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.20% 113.86 70 170 2530.94 2204 4389 2529.47 2310 2821 288166 411676 30.00%
crit 17.42% 29.97 9 57 5090.46 4408 8891 5087.10 4497 6105 152556 217943 30.00%
miss 16.38% 28.17 10 49 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 744 1.6% 173.9 2.01sec 1285 722 Direct 173.9 1270 2553 1285 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 173.85 173.85 0.00 0.00 0.00 1.7797 0.0000 223415.80 319173.57 30.00% 722.09 722.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.29% 115.24 71 161 1270.14 1102 2223 1269.53 1171 1424 146372 209109 30.00%
crit 17.36% 30.17 11 56 2553.45 2204 4445 2552.04 2235 2927 77043 110065 30.00%
miss 16.36% 28.44 11 52 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7189) 0.0% (15.5%) 88.6 3.21sec 24366 20562

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 88.65 0.00 0.00 0.00 0.00 1.1850 0.0000 0.00 0.00 0.00% 20561.60 20561.60

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:5.66
  • if_expr:buff.doom_winds_talent.up
    single
    [R]:70.30
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    single
    [U]:12.69
    Stormstrike (_mh) 3890 (4793) 8.4% (10.3%) 118.2 3.21sec 12178 0 Direct 118.2 (176.3) 8404 16913 9884 17.4% (11.7%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.25 118.25 0.00 0.00 0.00 0.0000 0.0000 1168727.45 1669653.22 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 97.68 55 155 8403.71 2743 21205 8414.85 6987 10086 820913 1172762 30.00%
crit 17.39% 20.57 5 51 16912.97 5486 42410 16932.54 10419 24611 347815 496891 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 903 1.9% 58.0 5.44sec 4679 0 Direct 58.0 4679 0 4679 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.00 58.00 0.00 0.00 0.00 0.0000 0.0000 271366.72 271366.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 58.00 23 108 4678.57 1205 19317 4688.15 3490 6016 271367 271367 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 1945 (2396) 4.2% (5.2%) 118.2 3.21sec 6087 0 Direct 118.2 (176.3) 4202 8456 4942 17.4% (11.7%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.25 118.25 0.00 0.00 0.00 0.0000 0.0000 584359.40 834820.43 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 97.68 53 152 4201.81 1372 10602 4207.27 3589 5056 410451 586374 30.00%
crit 17.39% 20.57 6 45 8456.47 2743 21305 8468.60 5616 11297 173908 248446 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 451 1.0% 58.0 5.44sec 2336 0 Direct 58.0 2336 0 2336 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.00 58.00 0.00 0.00 0.00 0.0000 0.0000 135481.26 135481.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 58.00 23 108 2335.77 602 9658 2340.49 1761 2985 135481 135481 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1034 2.2% 6.5 46.80sec 47462 40591 Direct 6.5 40398 81132 47460 17.3% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.54 6.54 0.00 0.00 0.00 1.1693 0.0000 310361.15 310361.15 0.00% 40591.31 40591.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 5.41 0 9 40397.93 26739 89399 40384.97 0 56751 218357 218357 0.00%
crit 17.34% 1.13 0 6 81131.50 53478 168134 57712.38 0 167285 92005 92005 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [N]:0.79
  • if_expr:buff.doom_winds_talent.up
    single
    [Y]:5.75
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7243) 0.0% (15.5%) 1.0 0.00sec 2164747 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7243 15.5% 408.6 2.46sec 5298 0 Direct 408.6 4521 9041 5298 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 408.58 408.58 0.00 0.00 0.00 0.0000 0.0000 2164746.53 3092573.90 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.81% 338.36 212 490 4521.44 1488 11843 4525.99 3933 5429 1529896 2185621 30.00%
crit 17.19% 70.22 32 124 9040.62 2976 23534 9050.38 7230 12346 634851 906953 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 453 1.0% 24.0 10.21sec 5595 4122 Direct 24.0 4625 9297 5595 20.8% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.95 23.95 0.00 0.00 0.00 1.3574 0.0000 134011.67 134011.67 0.00% 4121.79 4121.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.24% 18.98 9 28 4624.94 3540 6270 4625.97 4157 5592 87787 87787 0.00%
crit 20.76% 4.97 0 13 9297.40 7080 12540 9227.62 0 12013 46224 46224 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 239 0.5% 25.2 9.69sec 2802 2051 Direct 25.2 2318 4653 2802 20.7% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.21 25.21 0.00 0.00 0.00 1.3663 0.0000 70637.06 70637.06 0.00% 2050.96 2050.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.27% 19.98 10 29 2318.22 1770 3135 2318.25 2098 2771 46326 46326 0.00%
crit 20.73% 5.22 0 14 4652.87 3540 6270 4638.19 0 6189 24311 24311 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (6981) 0.0% (14.8%) 20.2 10.02sec 102048 103878

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.25 0.00 0.00 0.00 0.00 0.9824 0.0000 0.00 0.00 0.00% 103878.12 103878.12

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [K]:20.24
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [Q]:0.01
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1925 (2359) 4.1% (5.0%) 26.9 10.02sec 25929 0 Direct 26.9 (38.6) 18146 36330 21165 16.6% (11.6%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.92 26.92 0.00 0.00 0.00 0.0000 0.0000 569857.40 569857.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.39% 22.45 12 37 18145.63 5341 36395 18265.21 13365 24853 407432 407432 0.00%
crit 16.61% 4.47 0 13 36330.14 10757 65933 36059.36 0 63666 162426 162426 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 433 0.9% 11.6 17.74sec 11020 0 Direct 11.6 11020 0 11020 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.64 11.64 0.00 0.00 0.00 0.0000 0.0000 128257.98 128257.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.64 3 21 11020.17 3553 30330 11009.31 7726 16811 128258 128258 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 963 (1180) 2.0% (2.5%) 26.9 10.02sec 12966 0 Direct 26.9 (38.6) 9068 18211 10584 16.6% (11.6%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.92 26.92 0.00 0.00 0.00 0.0000 0.0000 284974.37 284974.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.42% 22.46 12 42 9068.38 2670 18197 9126.57 6762 12336 203675 203675 0.00%
crit 16.58% 4.46 0 13 18210.82 5341 32891 18145.53 0 30891 81299 81299 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 217 0.5% 11.6 17.74sec 5508 0 Direct 11.6 5509 0 5509 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.64 11.64 0.00 0.00 0.00 0.0000 0.0000 64110.47 64110.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.64 3 21 5508.53 1697 14476 5504.89 4003 8636 64110 64110 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3443 7.3% 20.2 10.02sec 50340 0 Direct 20.2 41674 83636 50339 20.7% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.24 20.24 0.00 0.00 0.00 0.0000 0.0000 1018935.53 1018935.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.35% 16.06 7 24 41674.47 18967 60196 41671.87 35449 51410 669336 669336 0.00%
crit 20.65% 4.18 0 11 83635.79 38693 120392 82783.09 0 111508 349600 349600 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 414 / 86
melee 414 0.2% 39.4 2.43sec 650 420 Direct 39.4 554 1108 650 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.39 39.39 0.00 0.00 0.00 1.5462 0.0000 25603.60 36577.50 30.00% 420.39 420.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 32.59 21 55 554.37 490 816 553.83 490 718 18068 25812 30.00%
crit 17.26% 6.80 0 19 1108.47 980 1631 1107.05 0 1469 7535 10765 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4356 / 2710
melee 4356 5.8% 342.3 1.73sec 2367 2111 Direct 342.3 2019 4028 2367 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 342.27 342.27 0.00 0.00 0.00 1.1210 0.0000 810124.23 1157349.84 30.00% 2111.38 2111.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 283.01 213 363 2019.04 1660 3306 2019.45 1867 2281 571416 816329 30.00%
crit 17.31% 59.26 31 96 4028.13 3321 6611 4029.14 3614 4680 238709 341021 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Phys
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.71sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 305.97sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.14 0.00 0.00 0.00 0.00 1.0081 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [a]:1.14
Feral Spirit 13.5 24.03sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.51 0.00 0.00 0.00 0.00 1.1405 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:13.51
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.50
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 95.67% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 180.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.2s / 182.7s
  • trigger_min/max:180.2s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.6sec 5.5sec 18.8sec 12.74% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.4s
  • trigger_min/max:0.0s / 164.3s
  • trigger_pct:100.00%
  • duration_min/max:17.1s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.72%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.70%
  • crumbling_power_7:0.70%
  • crumbling_power_8:0.68%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.71%
  • crumbling_power_18:1.24%
  • crumbling_power_19:0.84%
  • crumbling_power_20:0.02%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds (_talent) 3.7 0.0 90.5sec 90.5sec 7.9sec 9.85% 12.51% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_doom_winds_talent
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.6s
  • trigger_min/max:90.0s / 92.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_talent_1:9.85%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 13.5 0.0 26.0sec 22.9sec 17.5sec 62.21% 100.00% 0.0 (0.0) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 69.8s
  • trigger_min/max:6.2s / 46.0s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 53.9s

Stack Uptimes

  • earthen_weapon_2:58.11%
  • earthen_weapon_4:4.09%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.3 1.0 37.1sec 32.4sec 10.8sec 26.30% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 278.2s
  • trigger_min/max:1.7s / 278.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.9s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.30%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.3 0.9 37.5sec 32.7sec 10.7sec 26.00% 0.00% 0.9 (0.9) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 256.2s
  • trigger_min/max:1.7s / 256.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.2s

Stack Uptimes

  • elemental_blast_haste_1:26.00%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.3 0.9 37.5sec 32.7sec 10.7sec 26.11% 0.00% 0.9 (0.9) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 267.4s
  • trigger_min/max:1.7s / 259.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.1s

Stack Uptimes

  • elemental_blast_mastery_1:26.11%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 124.2sec 99.0sec 58.1sec 25.00% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 304.1s

Stack Uptimes

  • elemental_chaos_air_1:25.00%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.8sec 99.9sec 58.0sec 25.12% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:25.12%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 123.3sec 98.4sec 58.4sec 25.18% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 331.4s

Stack Uptimes

  • elemental_chaos_fire_1:25.18%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 125.8sec 101.4sec 58.2sec 24.70% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.3s

Stack Uptimes

  • elemental_chaos_frost_1:24.70%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 308.0sec 0.0sec 27.4sec 13.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 331.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.41%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 2.8 29.5sec 24.0sec 17.5sec 62.21% 0.00% 53.2 (53.2) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 69.8s
  • trigger_min/max:6.5s / 46.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.9s

Stack Uptimes

  • feral_spirit_1:62.21%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.9 368.2 6.9sec 0.7sec 5.8sec 84.15% 90.47% 368.2 (872.8) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 72.2s
  • trigger_min/max:0.0s / 15.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.2s

Stack Uptimes

  • flurry_1:20.18%
  • flurry_2:33.30%
  • flurry_3:30.66%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 119.0 17.8sec 2.2sec 14.6sec 84.02% 100.00% 57.5 (57.5) 16.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 49.8s
  • trigger_min/max:0.0s / 47.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:15.41%
  • forceful_winds_2:14.35%
  • forceful_winds_3:12.79%
  • forceful_winds_4:10.54%
  • forceful_winds_5:30.92%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.0sec 45.9sec 13.0sec 19.49% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 228.0s
  • trigger_min/max:0.2s / 216.1s
  • trigger_pct:98.84%
  • duration_min/max:0.0s / 56.4s

Stack Uptimes

  • forgestorm_ignited_1:19.49%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.4 0.7 14.7sec 14.1sec 7.1sec 48.12% 76.99% 0.7 (0.7) 4.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.9s / 63.2s
  • trigger_min/max:8.4s / 63.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.2s

Stack Uptimes

  • ice_strike_1:48.12%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 24.1 16.0 12.5sec 7.4sec 7.1sec 57.09% 0.00% 16.0 (16.0) 23.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 53.0s
  • trigger_min/max:0.8s / 37.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.1s

Stack Uptimes

  • legacy_of_the_frost_witch_1:57.09%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 46.7 380.1 6.5sec 1.4sec 5.5sec 85.49% 100.00% 43.0 (47.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 36.6s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.1s

Stack Uptimes

  • maelstrom_weapon_1:9.69%
  • maelstrom_weapon_2:11.38%
  • maelstrom_weapon_3:13.06%
  • maelstrom_weapon_4:13.70%
  • maelstrom_weapon_5:8.78%
  • maelstrom_weapon_6:7.10%
  • maelstrom_weapon_7:5.27%
  • maelstrom_weapon_8:4.29%
  • maelstrom_weapon_9:3.42%
  • maelstrom_weapon_10:8.81%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.9sec 45.5sec 16.5sec 23.73% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25
  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 213.6s
  • trigger_min/max:0.0s / 205.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.9s

Stack Uptimes

  • sophic_devotion_1:23.73%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.4sec 45.1sec 32.1sec 38.50% 0.00% 25.9 (25.9) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 245.5s
  • trigger_min/max:0.1s / 198.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 179.2s

Stack Uptimes

  • spiraling_winds_1:2.37%
  • spiraling_winds_2:2.33%
  • spiraling_winds_3:2.32%
  • spiraling_winds_4:2.30%
  • spiraling_winds_5:2.29%
  • spiraling_winds_6:2.28%
  • spiraling_winds_7:2.26%
  • spiraling_winds_8:2.24%
  • spiraling_winds_9:2.23%
  • spiraling_winds_10:17.89%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 59.8 18.7 5.0sec 3.8sec 1.2sec 23.21% 54.49% 18.7 (18.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 72.5s
  • trigger_min/max:0.0s / 72.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.3s

Stack Uptimes

  • stormbringer_1:23.21%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.3 33.0 69.0 17.9s 15.0s 56.8s
Windfury-ForcefulWinds: 2 50.6 30.0 69.0 18.1s 0.7s 77.2s
Windfury-ForcefulWinds: 3 48.7 27.0 72.0 18.8s 0.8s 77.8s
Windfury-ForcefulWinds: 4 45.1 21.0 69.0 20.4s 1.2s 105.6s
Windfury-ForcefulWinds: 5 212.9 93.0 339.0 4.7s 0.0s 87.6s
windfury_totem_extra_attack_mh 27.6 8.0 50.0 10.6s 1.2s 117.8s
windfury_totem_extra_attack_oh 28.3 11.0 54.0 10.4s 0.1s 113.6s
Windfury: Unruly Winds 136.2 84.0 193.0 2.5s 0.0s 47.3s
Maelstrom Weapon: Feral Spirit 71.2 52.0 94.0 4.2s 0.0s 31.0s
Maelstrom Weapon: Elemental Assault 108.9 74.0 150.0 2.7s 0.8s 11.0s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.4s
Stormflurry 36.3 11.0 69.0 10.7s 0.8s 159.0s
Flametongue: Windfury Attack 408.6 252.0 579.0 2.5s 0.0s 47.3s
Stormbringer: Windfury Attack 43.0 18.0 84.0 7.9s 0.0s 99.4s
Maelstrom Weapon: Windfury Attack 81.6 44.0 128.0 4.7s 0.0s 66.5s
Flametongue: main_hand 143.8 94.0 200.0 2.5s 1.3s 28.6s
Maelstrom Weapon: main_hand 28.8 11.0 55.0 10.1s 1.3s 127.6s
Windfury: main_hand 48.9 25.0 84.0 6.3s 1.3s 79.4s
Flametongue: Windlash 24.0 19.0 33.0 10.2s 1.2s 170.4s
Maelstrom Weapon: Windlash 4.8 0.0 13.0 44.0s 1.2s 195.0s
Windfury: Windlash 16.3 10.0 25.0 14.7s 1.2s 176.6s
Flametongue: offhand 145.4 96.0 196.0 2.5s 1.3s 27.7s
Maelstrom Weapon: offhand 29.1 9.0 53.0 10.1s 1.3s 112.6s
Flametongue: Windlash Off-Hand 25.2 21.0 32.0 9.7s 1.2s 168.3s
Maelstrom Weapon: Windlash Off-Hand 5.0 0.0 14.0 41.9s 1.2s 194.4s
Flametongue: Sundering 6.5 4.0 9.0 46.8s 40.0s 140.9s
Stormbringer: Sundering 0.7 0.0 5.0 110.1s 40.0s 320.0s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 102.7s 40.0s 330.3s
Windfury: Sundering 2.5 0.0 8.0 87.6s 40.0s 337.6s
Flametongue: Windstrike 26.9 17.0 43.0 10.0s 0.8s 171.6s
Stormbringer: Windstrike 2.8 0.0 11.0 58.6s 0.8s 193.8s
Maelstrom Weapon: Windstrike 5.4 0.0 15.0 40.5s 0.8s 192.3s
Windfury: Windstrike 19.0 10.0 33.0 13.8s 0.8s 177.8s
Flametongue: Windstrike Off-Hand 26.9 17.0 43.0 10.0s 0.8s 171.6s
Stormbringer: Windstrike Off-Hand 2.8 0.0 11.0 59.2s 0.8s 193.9s
Maelstrom Weapon: Windstrike Off-Hand 5.4 0.0 15.0 40.7s 0.8s 193.3s
Flametongue: Lava Lash 19.1 13.0 26.0 15.0s 8.9s 55.8s
Stormbringer: Lava Lash 2.0 0.0 9.0 74.2s 9.0s 323.8s
Maelstrom Weapon: Lava Lash 3.8 0.0 13.0 56.4s 9.0s 306.2s
Flametongue: Ice Strike 21.2 13.0 28.0 14.1s 8.4s 63.2s
Stormbringer: Ice Strike 2.2 0.0 9.0 75.6s 8.6s 345.3s
Maelstrom Weapon: Ice Strike 4.2 0.0 12.0 54.9s 8.9s 303.9s
Windfury: Ice Strike 8.1 2.0 17.0 36.3s 8.4s 294.6s
Flametongue: Stormstrike 118.2 70.0 176.0 3.2s 0.9s 27.2s
Stormbringer: Stormstrike 12.5 1.0 31.0 21.8s 0.9s 222.4s
Maelstrom Weapon: Stormstrike 23.6 7.0 46.0 12.5s 0.9s 143.6s
Windfury: Stormstrike 41.4 16.0 77.0 7.7s 0.9s 107.5s
Flametongue: Stormstrike Off-Hand 118.2 70.0 176.0 3.2s 0.9s 27.2s
Stormbringer: Stormstrike Off-Hand 12.5 2.0 34.0 21.7s 0.9s 239.4s
Maelstrom Weapon: Stormstrike Off-Hand 23.6 8.0 45.0 12.5s 0.9s 141.4s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 24.10% 16.66% 30.65% 0.7s 0.0s 18.5s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7960.0011.4819.2512.99815.540
Ascendance0.5550.0012.3720.4330.0002.372
Doom Winds0.5830.0012.6061.2870.2085.035
Sundering7.1770.001100.89037.5231.033126.207
Windstrike0.8960.0013.73917.7458.35925.150
Lava Lash3.2180.00143.50056.40717.399117.635
Flame Shock16.6770.001161.132211.06885.717303.915
Ice Strike2.5660.00151.20449.5638.394111.287
Frost Shock9.4000.001113.445172.53973.571251.659
Elemental Blast3.4740.00220.9562.1580.00020.956
Stormstrike1.0480.0014.95588.49246.378143.746
Earth Elemental6.7580.00137.2900.8890.00037.290

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Phys
mana_regenMana674.93253776.83100.00%376.01225614.1647.06%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 845.93 848.83 225612.2 49130.2 44841.6 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Phys
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 24.7434015.161375.001375.0058.88
Flame ShockMana 13.8010352.82750.00314.7545.00
Frost ShockMana 20.0010000.47500.00500.0036.79
Ice StrikeMana 21.2034972.921650.001650.0112.87
Lava LashMana 19.097635.36400.00400.0055.00
Lightning BoltMana 18.119054.46500.00499.99100.67
StormstrikeMana 118.25118248.501000.001333.9518.27
SunderingMana 6.5419616.983000.002999.9315.82

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Phys Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Phys Damage Per Second
Count 7499
Mean 46586.36
Minimum 39977.94
Maximum 56700.84
Spread ( max - min ) 16722.90
Range [ ( max - min ) / 2 * 100% ] 17.95%
Standard Deviation 2315.6087
5th Percentile 43000.33
95th Percentile 50608.18
( 95th Percentile - 5th Percentile ) 7607.86
Mean Distribution
Standard Deviation 26.7401
95.00% Confidence Interval ( 46533.95 - 46638.77 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9491
0.1 Scale Factor Error with Delta=300 45774
0.05 Scale Factor Error with Delta=300 183094
0.01 Scale Factor Error with Delta=300 4577349
Priority Target DPS
PR_Shaman_Enhancement_Phys Priority Target Damage Per Second
Count 7499
Mean 46586.36
Minimum 39977.94
Maximum 56700.84
Spread ( max - min ) 16722.90
Range [ ( max - min ) / 2 * 100% ] 17.95%
Standard Deviation 2315.6087
5th Percentile 43000.33
95th Percentile 50608.18
( 95th Percentile - 5th Percentile ) 7607.86
Mean Distribution
Standard Deviation 26.7401
95.00% Confidence Interval ( 46533.95 - 46638.77 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9491
0.1 Scale Factor Error with Delta=300 45774
0.05 Scale Factor Error with Delta=300 183094
0.01 Scale Factor Error with Delta=300 4577349
DPS(e)
PR_Shaman_Enhancement_Phys Damage Per Second (Effective)
Count 7499
Mean 46586.36
Minimum 39977.94
Maximum 56700.84
Spread ( max - min ) 16722.90
Range [ ( max - min ) / 2 * 100% ] 17.95%
Damage
PR_Shaman_Enhancement_Phys Damage
Count 7499
Mean 13103753.08
Minimum 9510904.77
Maximum 17117442.01
Spread ( max - min ) 7606537.24
Range [ ( max - min ) / 2 * 100% ] 29.02%
DTPS
PR_Shaman_Enhancement_Phys Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Phys Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Phys Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Phys Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Phys Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Phys Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_PhysTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Phys Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.50 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 13.51 feral_spirit
G 2.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
H 3.72 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
K 20.24 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
L 5.66 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
M 2.38 ice_strike,if=buff.doom_winds_talent.up
N 0.79 sundering,if=buff.doom_winds_talent.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
O 1.16 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 frost_shock,if=buff.hailstorm.up
P 2.55 lava_lash,if=dot.flame_shock.refreshable
Q 0.01 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 70.30 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
S 24.74 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
T 4.05 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
U 12.69 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
V 18.82 ice_strike
W 16.54 lava_lash
0.00 bag_of_tricks
X 14.06 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 5.75 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
Z 20.00 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
a 1.14 earth_elemental
b 12.65 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ABCDFGEHKMKKKKKKFKOKKSKKRSRVWYFRRRTRZSVWRXRRRXRRSVWZUFaZXRbVRSWZbRUXRRRSRFVRWXRRRSRYRRTRVRFPRHSLLXLLSVWUUTRZbUFRSRVSRWRXRYZXVUZWbUSRFVSRWZbXRZXRVZWbUSZbYUVZSRWZbDFGEHKMKKKKFKKKKKPRSRVZbFRRSRWYSVRXRRXRWZbVUFSZbRSRWVXZRbZUSRVRWXRRFSYZRVWXRRHLSLLMWXRZbUZFVWRSRRZ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 2 augmentation PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
0:00.000 default B potion Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_air
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_air, elemental_potion_of_ultimate_power
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), forceful_winds, elemental_chaos_air, elemental_potion_of_ultimate_power
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), forceful_winds, crumbling_power(20), elemental_chaos_air, elemental_potion_of_ultimate_power
0:00.926 default G ascendance Fluffy_Pillow 40731.6/50000: 81% mana bloodlust, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_air, elemental_potion_of_ultimate_power
0:01.850 default E berserking Fluffy_Pillow 42210.0/50000: 84% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), static_accumulation, crumbling_power(18), elemental_chaos_air, elemental_potion_of_ultimate_power
0:01.850 default H doom_winds Fluffy_Pillow 42210.0/50000: 84% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), static_accumulation, crumbling_power(18), elemental_chaos_air, elemental_potion_of_ultimate_power
0:02.692 single K windstrike Fluffy_Pillow 43557.2/50000: 87% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, doom_winds_talent, crumbling_power(18), elemental_chaos_air, elemental_potion_of_ultimate_power
0:03.532 single M ice_strike Fluffy_Pillow 44901.2/50000: 90% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, doom_winds_talent, crumbling_power(17), elemental_chaos_air, elemental_potion_of_ultimate_power
0:04.373 single K windstrike Fluffy_Pillow 44596.8/50000: 89% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, crumbling_power(16), elemental_chaos_air, elemental_potion_of_ultimate_power
0:05.214 single K windstrike Fluffy_Pillow 45942.4/50000: 92% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), elemental_chaos_air, elemental_potion_of_ultimate_power
0:06.055 single K windstrike Fluffy_Pillow 47288.0/50000: 95% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_air, elemental_potion_of_ultimate_power
0:06.897 single K windstrike Fluffy_Pillow 48635.2/50000: 97% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), spiraling_winds, elemental_chaos_air, elemental_potion_of_ultimate_power
0:07.736 single K windstrike Fluffy_Pillow 49977.6/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), spiraling_winds, elemental_chaos_air, elemental_potion_of_ultimate_power
0:08.577 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds(2), elemental_chaos_air, elemental_potion_of_ultimate_power
0:09.417 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(2), elemental_chaos_air, elemental_potion_of_ultimate_power
0:10.256 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(2), elemental_chaos_air, elemental_potion_of_ultimate_power
0:11.096 single O flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(3), elemental_chaos_air, elemental_potion_of_ultimate_power
0:11.938 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(3), elemental_chaos_air, elemental_potion_of_ultimate_power
0:12.779 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(4), elemental_chaos_air, elemental_potion_of_ultimate_power
0:13.618 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(4), elemental_chaos_air, elemental_potion_of_ultimate_power
0:14.457 single K windstrike Fluffy_Pillow 49967.4/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(4), elemental_chaos_air, elemental_potion_of_ultimate_power
0:15.355 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(5), elemental_chaos_air, elemental_potion_of_ultimate_power
0:16.252 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, crumbling_power(2), spiraling_winds(5), elemental_chaos_air, elemental_potion_of_ultimate_power
0:17.148 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power, spiraling_winds(6), elemental_chaos_air, elemental_potion_of_ultimate_power
0:18.045 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_air, elemental_potion_of_ultimate_power
0:18.943 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_air, elemental_potion_of_ultimate_power
0:19.841 single W lava_lash Fluffy_Pillow 49786.8/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_air, elemental_potion_of_ultimate_power
0:20.740 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air, elemental_potion_of_ultimate_power
0:21.637 default F feral_spirit Fluffy_Pillow 48435.2/50000: 97% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_air, elemental_potion_of_ultimate_power
0:22.535 single R stormstrike Fluffy_Pillow 49872.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(4), maelstrom_weapon(6), ice_strike, spiraling_winds(9), elemental_chaos_air, elemental_potion_of_ultimate_power
0:23.432 single R stormstrike Fluffy_Pillow 49307.2/50000: 99% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(4), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(9), elemental_chaos_air, elemental_potion_of_ultimate_power
0:24.331 single R stormstrike Fluffy_Pillow 48745.6/50000: 97% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(4), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(9), elemental_chaos_air, elemental_potion_of_ultimate_power
0:25.228 single T lightning_bolt Fluffy_Pillow 49180.8/50000: 98% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_air, elemental_potion_of_ultimate_power
0:26.125 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air, elemental_potion_of_ultimate_power
0:27.022 single Z frost_shock Fluffy_Pillow 48435.2/50000: 97% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air, elemental_potion_of_ultimate_power
0:27.920 single S elemental_blast Fluffy_Pillow 49372.0/50000: 99% mana bloodlust, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air, elemental_potion_of_ultimate_power
0:28.844 single V ice_strike Fluffy_Pillow 49475.4/50000: 99% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air, elemental_potion_of_ultimate_power
0:29.769 single W lava_lash Fluffy_Pillow 49305.4/50000: 99% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air, elemental_potion_of_ultimate_power
0:30.694 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_air
0:31.618 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, elemental_chaos_air
0:32.543 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:33.467 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:34.391 single R stormstrike Fluffy_Pillow 48478.4/50000: 97% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:35.316 single X lightning_bolt Fluffy_Pillow 48958.4/50000: 98% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:36.242 single R stormstrike Fluffy_Pillow 49940.0/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:37.167 single R stormstrike Fluffy_Pillow 49420.0/50000: 99% mana bloodlust, flurry(2), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:38.092 single S elemental_blast Fluffy_Pillow 49900.0/50000: 100% mana bloodlust, flurry(2), forceful_winds(4), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:39.018 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:39.942 single W lava_lash Fluffy_Pillow 49828.4/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:40.867 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon, ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_air
0:42.068 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon, sophic_devotion, forgestorm_ignited, elemental_chaos_air
0:43.501 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(3), sophic_devotion, forgestorm_ignited, elemental_chaos_air
0:44.701 single a earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_air
0:45.900 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, forgestorm_ignited, elemental_chaos_air
0:47.100 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), sophic_devotion, forgestorm_ignited, elemental_chaos_air
0:48.302 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
0:49.503 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
0:50.703 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
0:51.901 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
0:53.101 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, elemental_chaos_air
0:54.301 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, elemental_chaos_air
0:55.501 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, elemental_chaos_air
0:56.700 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_air
0:57.900 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_air
0:59.100 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(8), elemental_chaos_air
1:00.301 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(9), elemental_chaos_earth
1:01.540 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_earth
1:02.778 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_earth
1:04.017 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_earth
1:05.255 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_earth
1:06.493 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, elemental_chaos_earth
1:07.732 default F feral_spirit Fluffy_Pillow 48982.4/50000: 98% mana flurry, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth
1:08.971 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth
1:10.209 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth
1:11.449 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth
1:12.686 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth
1:13.924 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
1:15.162 single R stormstrike Fluffy_Pillow 46980.8/50000: 94% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_earth
1:16.400 single R stormstrike Fluffy_Pillow 47961.6/50000: 96% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth
1:17.639 single S elemental_blast Fluffy_Pillow 48944.0/50000: 98% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
1:18.877 single R stormstrike Fluffy_Pillow 49549.8/50000: 99% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:20.079 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:21.281 single R stormstrike Fluffy_Pillow 48923.2/50000: 98% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:22.482 single R stormstrike Fluffy_Pillow 47844.8/50000: 96% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:23.687 single T lightning_bolt Fluffy_Pillow 48772.8/50000: 98% mana flurry(2), elemental_blast_haste, maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_earth
1:24.890 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:26.093 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:27.294 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:28.498 default F feral_spirit Fluffy_Pillow 49926.4/50000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:29.737 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(10), elemental_chaos_earth
1:30.974 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(10), elemental_chaos_earth
1:32.213 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_earth
1:33.451 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, spiraling_winds(10), elemental_chaos_earth
1:34.689 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:35.929 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:37.169 single X lightning_bolt Fluffy_Pillow 49984.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:38.409 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), doom_winds_talent, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
1:39.647 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), doom_winds_talent, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
1:40.887 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
1:42.128 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
1:43.331 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:44.532 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:45.735 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(8), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:46.940 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(4), maelstrom_weapon(10), ice_strike, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:48.143 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:49.345 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:50.547 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:51.751 Waiting     2.298 sec 50000.0/50000: 100% mana forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:54.049 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(3), sophic_devotion, forgestorm_ignited, elemental_chaos_earth
1:55.470 default F feral_spirit Fluffy_Pillow 49980.8/50000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_earth
1:56.706 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_earth
1:57.943 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(9), forgestorm_ignited, elemental_chaos_earth
1:59.181 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_earth
2:00.419 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:01.657 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:02.894 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:04.132 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:05.372 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, forgestorm_ignited, elemental_chaos_fire
2:06.609 single X lightning_bolt Fluffy_Pillow 49979.2/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
2:07.849 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
2:09.088 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
2:10.326 single Z frost_shock Fluffy_Pillow 48980.8/50000: 98% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
2:11.566 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
2:12.805 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), sophic_devotion, elemental_chaos_fire
2:14.044 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), stormbringer, ice_strike, elemental_chaos_fire
2:15.283 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(4), ice_strike, elemental_chaos_fire
2:16.523 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(4), elemental_chaos_fire
2:17.761 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(4), elemental_chaos_fire
2:18.999 Waiting     1.022 sec 50000.0/50000: 100% mana flurry(2), maelstrom_weapon(4), elemental_chaos_fire
2:20.021 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(4), elemental_chaos_fire
2:21.454 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(6), elemental_chaos_fire
2:22.695 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
2:23.898 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:25.102 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:26.304 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:27.506 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:28.708 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:29.910 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:31.111 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
2:32.313 Waiting     0.612 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_fire
2:32.925 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
2:34.164 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
2:35.402 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(2), elemental_chaos_fire
2:36.639 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(3), elemental_chaos_fire
2:37.878 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_fire
2:39.115 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_fire
2:40.353 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_fire
2:41.591 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_fire
2:42.831 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(4), spiraling_winds(6), elemental_chaos_fire
2:44.068 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(4), spiraling_winds(6), elemental_chaos_fire
2:45.307 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(6), spiraling_winds(7), elemental_chaos_fire
2:46.546 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), spiraling_winds(8), elemental_chaos_fire
2:47.749 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), spiraling_winds(8), elemental_chaos_fire
2:48.949 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), spiraling_winds(9), elemental_chaos_fire
2:50.290 single U stormstrike Fluffy_Pillow 48923.2/50000: 98% mana elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon, spiraling_winds(10), elemental_chaos_fire
2:51.492 single V ice_strike Fluffy_Pillow 49846.4/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
2:52.694 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_fire
2:53.899 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(5), spiraling_winds(10), elemental_chaos_fire
2:55.102 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:56.303 single W lava_lash Fluffy_Pillow 49921.6/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:57.540 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:58.793 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
3:00.032 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_fire
3:00.032 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), crumbling_power(20), spiraling_winds(10), elemental_chaos_fire
3:01.272 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), crumbling_power(19), spiraling_winds(10), elemental_chaos_fire
3:02.509 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, crumbling_power(18), spiraling_winds(10), elemental_chaos_fire
3:02.509 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, crumbling_power(18), spiraling_winds(10), elemental_chaos_fire
3:03.635 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, crumbling_power(18), spiraling_winds(10), elemental_chaos_fire
3:04.761 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, doom_winds_talent, crumbling_power(17), spiraling_winds(10), elemental_chaos_fire
3:05.887 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, crumbling_power(16), spiraling_winds(10), elemental_chaos_fire
3:07.013 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), spiraling_winds(10), elemental_chaos_fire
3:08.138 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), spiraling_winds(10), elemental_chaos_fire
3:09.266 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), spiraling_winds(10), elemental_chaos_fire
3:10.393 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), spiraling_winds(10), elemental_chaos_fire
3:11.519 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds(10), elemental_chaos_fire
3:12.647 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, earthen_weapon(4), stormbringer, maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(10), elemental_chaos_fire
3:13.772 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds, earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(10), elemental_chaos_fire
3:14.899 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds, earthen_weapon(4), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(10), elemental_chaos_fire
3:16.139 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(10), elemental_chaos_fire
3:17.378 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_fire
3:18.615 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds, elemental_chaos_fire
3:19.853 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds, elemental_chaos_fire
3:21.092 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_fire
3:22.294 single V ice_strike Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_fire
3:23.497 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_fire
3:24.699 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_fire
3:25.901 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(4), maelstrom_weapon(4), spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
3:27.104 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire
3:28.306 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(9), spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
3:29.509 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(6), forgestorm_ignited, elemental_chaos_fire
3:30.711 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_fire
3:31.949 single W lava_lash Fluffy_Pillow 49980.8/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_fire
3:33.187 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_fire
3:34.425 single S elemental_blast Fluffy_Pillow 48980.8/50000: 98% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_fire
3:35.663 single V ice_strike Fluffy_Pillow 49586.6/50000: 99% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(9), forgestorm_ignited, elemental_chaos_fire
3:36.902 single R stormstrike Fluffy_Pillow 49919.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
3:38.140 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_fire
3:39.378 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
3:40.615 single R stormstrike Fluffy_Pillow 49979.2/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
3:41.852 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
3:43.093 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
3:44.331 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:45.570 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:46.808 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
3:48.045 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, maelstrom_weapon(2), elemental_chaos_fire
3:49.283 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(3), ice_strike, elemental_chaos_fire
3:50.522 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), maelstrom_weapon(5), ice_strike, elemental_chaos_fire
3:51.761 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, elemental_chaos_fire
3:53.000 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, elemental_chaos_fire
3:54.203 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_fire
3:55.407 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_fire
3:56.610 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_fire
3:57.812 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
3:59.014 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
4:00.217 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
4:01.384 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:02.550 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, elemental_chaos_air
4:03.749 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, elemental_chaos_air
4:04.948 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_air
4:06.149 Waiting     1.004 sec 50000.0/50000: 100% mana flurry, elemental_blast_mastery, maelstrom_weapon(4), elemental_chaos_air
4:07.153 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(4), elemental_chaos_air
4:08.535 Waiting     0.963 sec 50000.0/50000: 100% mana flurry, maelstrom_weapon(4), spiraling_winds, elemental_chaos_air
4:09.498 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(4), spiraling_winds, elemental_chaos_air
4:10.933 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(7), spiraling_winds(2), elemental_chaos_air
4:12.133 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_air
4:13.333 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, elemental_chaos_air
4:14.533 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, elemental_chaos_air
4:15.734 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, elemental_chaos_air
4:16.937 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(7), ice_strike, spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:18.140 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:19.340 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:20.539 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:21.742 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:22.944 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, spiraling_winds(8), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:24.110 single Z frost_shock Fluffy_Pillow 48865.6/50000: 98% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, spiraling_winds(9), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:25.276 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(9), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:26.442 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, forgestorm_ignited, elemental_chaos_air
4:27.606 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
4:28.772 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_air
4:29.938 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:31.102 single R stormstrike Fluffy_Pillow 47862.4/50000: 96% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:32.268 default H doom_winds Fluffy_Pillow 47728.0/50000: 95% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:33.709 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:34.909 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, spiraling_winds(10), elemental_chaos_air
4:36.110 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:37.310 single L stormstrike Fluffy_Pillow 49920.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(4), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:38.508 single M ice_strike Fluffy_Pillow 49836.8/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(7), doom_winds_talent, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:39.707 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(7), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:40.909 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_air
4:42.110 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:43.310 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:44.509 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:45.709 Waiting     2.152 sec 50000.0/50000: 100% mana maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_air
4:47.861 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon, spiraling_winds(10), elemental_chaos_air
4:49.293 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_air
4:50.495 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_air
4:51.739 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_air
4:52.940 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, elemental_chaos_air
4:54.141 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_air
4:55.342 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), ice_strike, elemental_chaos_air
4:56.541 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:57.741 single R stormstrike Fluffy_Pillow 49920.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
4:58.942 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.51% 21.51% 3656
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 59.31% 52.07% 3246
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Phys"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 312169211
Max Event Queue: 419
Sim Seconds: 2250297
CPU Seconds: 419.0979
Physical Seconds: 210.8956
Speed Up: 5369

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.53sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 172910 576 7.65 3577 7186 38.2 38.2 26.1% 0.0% 0.0% 0.0% 6.91sec 172910 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 138.50sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 810251 2701 37.85 3885 7781 189.3 189.3 26.5% 16.4% 0.0% 0.0% 1.85sec 1157531 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 394884 1316 37.01 1942 3888 185.1 185.1 26.5% 16.7% 0.0% 0.0% 1.85sec 564134 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.65sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 3507524 11692 39.25 14100 28201 196.3 196.3 26.8% 0.0% 0.0% 0.0% 1.43sec 3507524 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 205503 685 0.56 58396 116483 2.9 2.8 26.8% 0.0% 0.0% 0.0% 119.58sec 205503 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 6590 22 2.34 445 891 1.1 11.7 26.7% 0.0% 0.0% 0.0% 117.63sec 6590 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 349223 1164 1.66 33171 66341 8.3 8.3 26.8% 0.0% 0.0% 0.0% 29.30sec 498903 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 85.54sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 595294 1984 19.75 4765 9532 66.2 98.7 26.5% 0.0% 0.0% 0.0% 4.51sec 595294 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 267288 891 4.94 8560 17124 24.7 24.7 26.4% 0.0% 0.0% 0.0% 7.13sec 267288 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 133738 446 4.94 4280 8561 24.7 24.7 26.5% 0.0% 0.0% 0.0% 7.13sec 133738 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 62.46sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 2059975 6867 13.25 24574 49186 66.2 66.2 26.5% 0.0% 0.0% 0.0% 4.51sec 2059975 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 432255 1441 13.22 5164 10318 66.1 66.1 26.7% 0.0% 0.0% 0.0% 4.52sec 432255 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 495322 1651 12.88 6077 12164 64.4 64.4 26.5% 0.0% 0.0% 0.0% 4.60sec 707621 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 247725 826 12.88 3038 6084 64.4 64.4 26.5% 0.0% 0.0% 0.0% 4.60sec 353901 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1235441 4118 8.35 0 29602 41.7 41.7 100.0% 0.0% 0.0% 0.0% 7.08sec 1235441 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 617720 2059 8.35 0 14801 41.7 41.7 100.0% 0.0% 0.0% 0.0% 7.08sec 617720 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 7.9 0.0 0.0% 0.0% 0.0% 0.0% 40.10sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 307.15sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.68sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 20.59sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1653025 5510 48.63 5370 10762 243.2 243.2 26.5% 0.0% 0.0% 0.0% 1.23sec 1653025 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 58535 195 4.03 2296 4593 20.1 20.1 26.6% 0.0% 0.0% 0.0% 14.46sec 83623 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 58565 195 4.03 2296 4593 20.2 20.2 26.5% 0.0% 0.0% 0.0% 14.44sec 83667 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.1 0.0 0.0% 0.0% 0.0% 0.0% 14.48sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 104754 640 19.15 1582 3168 52.3 52.3 26.6% 0.0% 0.0% 0.0% 5.39sec 149652 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 210 1 1.07 57 115 2.9 2.9 25.5% 0.0% 0.0% 0.0% 120.68sec 300 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul main_hand 0 212853 1300 34.65 1776 3554 94.6 94.6 26.7% 0.0% 0.0% 0.0% 2.93sec 304083 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.68sec 0 163.79sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 67062 224 1.40 8337 16672 7.0 7.0 15.3% 0.0% 0.0% 0.0% 45.49sec 67062 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 857245 2857 29.61 5021 10038 148.1 148.1 15.3% 0.0% 0.0% 0.0% 2.44sec 1224667 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.80sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 59664 199 1.40 7381 14774 7.0 7.0 15.4% 0.0% 0.0% 0.0% 45.61sec 59664 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1257159 4191 19.15 11375 22748 95.8 95.8 15.4% 0.0% 0.0% 0.0% 3.09sec 1257159 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 372095 1240 26.43 2816 0 0.0 132.1 0.0% 0.0% 0.0% 0.0% 0.00sec 372095 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 262103 874 1.36 33373 66746 6.8 6.8 15.3% 0.0% 0.0% 0.0% 46.86sec 374442 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 166.10sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 350902 1170 5.23 11607 23248 26.2 26.2 15.5% 0.0% 0.0% 0.0% 11.53sec 501302 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 560201 1867 20.79 4675 9344 103.9 103.9 15.3% 0.0% 0.0% 0.0% 3.51sec 560201 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 25160 84 2.37 1837 3668 11.9 11.9 15.5% 0.0% 0.0% 0.0% 26.31sec 25160 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.35sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike 55090 291248 971 15.43 3272 6547 77.1 77.1 15.4% 0.0% 0.0% 0.0% 3.74sec 416080 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike_shadow 70890 382503 1275 15.43 4300 8602 0.0 77.1 15.3% 0.0% 0.0% 0.0% 0.00sec 382503 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy solved_the_puzzle 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.81sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 132811 443 3.14 7356 14719 15.7 15.7 15.0% 0.0% 0.0% 0.0% 6.86sec 132811 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 640043 2133 3.14 35338 70670 15.7 15.7 15.5% 0.0% 0.0% 0.0% 6.86sec 640043 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.83sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 63415 211 0.73 14994 29925 3.7 3.7 15.5% 0.0% 0.0% 0.0% 90.73sec 63415 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_pact 319236 400719 1336 24.63 2822 5647 123.1 123.1 15.3% 0.0% 0.0% 0.0% 2.63sec 400719 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 21.4 0.0 0.0% 0.0% 0.0% 0.0% 13.63sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 264243 881 19.83 2311 4622 11.9 99.2 15.3% 0.0% 0.0% 0.0% 26.31sec 264243 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 93849 313 7.58 2146 4290 37.9 37.9 15.4% 0.0% 0.0% 0.0% 7.86sec 134074 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 218 1 0.52 73 147 2.6 2.6 15.1% 0.0% 0.0% 0.0% 90.04sec 312 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul main_hand 0 1290228 4301 38.37 5827 11656 191.9 191.9 15.4% 0.0% 0.0% 0.0% 1.55sec 1843230 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul monstrous_blow 91797 3141 10 0.22 2453 4916 1.1 1.1 15.4% 0.0% 0.0% 0.0% 91.08sec 4488 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul spawn_travel 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 411517 1372 13.61 5243 10493 68.0 68.0 15.3% 0.0% 0.0% 0.0% 4.29sec 411517 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1556545 31140 47.73 33958 67815 39.8 39.8 15.3% 0.0% 0.0% 0.0% 5.31sec 1556545 49.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.84sec 0 49.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_risen_skulker skulker_shot 212423 354330 1181 30.75 1998 3996 153.8 153.7 15.4% 0.0% 0.0% 0.0% 1.94sec 506199 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 300093 3662 25.22 7558 15069 34.5 34.4 15.4% 0.0% 0.0% 0.0% 8.54sec 300093 81.95sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 708606 8647 60.24 7467 14945 82.3 82.3 15.3% 0.0% 0.0% 0.0% 3.51sec 708606 81.95sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 268556 4477 212.28 1097 2195 212.2 212.2 15.3% 0.0% 0.0% 0.0% 1.02sec 383661 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1371648 22869 347.94 3418 6833 347.8 347.8 15.4% 0.0% 0.0% 0.0% 0.62sec 1959546 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.79sec 0 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.57sec 0 59.97sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.34sec 0 59.96sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.12sec 0 59.95sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.64sec 0 59.95sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.24sec 0 59.94sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.88sec 0 59.93sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.48sec 0 59.92sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 173609 1774 93.85 983 1966 153.1 153.1 15.4% 0.0% 0.0% 0.0% 1.83sec 248019 97.87sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 638890 6528 111.61 3043 6087 182.0 182.0 15.3% 0.0% 0.0% 0.0% 1.53sec 912723 97.87sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 47.56sec 0 97.87sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 46.90sec 0 99.20sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 46.90sec 0 99.03sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 47.67sec 0 97.42sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.47sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow dark_ascension 391109 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.87sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 1185190 3951 10.15 19170 40982 50.7 50.7 19.2% 0.0% 0.0% 0.0% 5.90sec 2767399 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 1582209 5274 25.72 10371 21134 50.7 128.6 17.9% 0.0% 0.0% 0.0% 5.90sec 2767399 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 179.4 0.0 0.0% 0.0% 0.0% 0.0% 1.66sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo 120644 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 62.59sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_heal 390971 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 62.59sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_damage 390964 131043 437 0.98 21993 47793 4.9 4.9 18.3% 0.0% 0.0% 0.0% 62.59sec 131043 300.00sec
PR_Priest_Shadow PR_Priest_Shadow idol_of_cthun 377349 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_void_tendril mind_flay ticks -193473 965073 3217 32.94 5011 10161 22.0 164.7 16.5% 0.0% 0.0% 0.0% 12.68sec 965073 26.43sec
PR_Priest_Shadow PR_Priest_Shadow mental_fortitude 377065 153596 512 69.55 442 0 336.0 347.8 0.0% 0.0% 0.0% 0.0% 0.88sec 7077959 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 1211245 4037 12.57 15802 34578 62.9 62.9 18.4% 0.0% 0.0% 0.0% 4.77sec 1211245 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay ticks -15407 176699 589 8.12 3753 7698 6.8 40.6 15.3% 0.0% 0.0% 0.0% 39.20sec 176699 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay_insanity ticks -391403 1662491 5542 32.32 8693 17760 40.6 161.6 17.6% 0.0% 0.0% 0.0% 7.28sec 1662491 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 254217 847 2.03 21185 45874 10.1 10.1 15.9% 0.0% 0.0% 0.0% 25.28sec 254217 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.64sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames 375901 416110 1387 1.55 43562 95289 7.7 7.7 19.7% 0.0% 0.0% 0.0% 40.44sec 416110 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames_damage_reversal 323706 0 0 0.00 0 0 7.7 0.0 0.0% 0.0% 0.0% 0.0% 40.44sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 309.39sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow power_infusion 10060 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.68sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.93sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_damage 205386 356864 1190 1.92 30816 65825 9.6 9.6 18.4% 0.0% 0.0% 0.0% 32.85sec 356864 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_dots 391286 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.93sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 197176 657 26.06 1513 0 131.3 130.3 0.0% 0.0% 0.0% 0.0% 2.22sec 197176 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 371622 1239 2.55 24282 50063 12.7 12.7 18.9% 0.0% 0.0% 0.0% 24.34sec 371622 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 89124 297 2.53 4702 17470 12.7 12.7 18.3% 0.0% 0.0% 0.0% 24.34sec 250527 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain ticks -589 835045 2783 50.82 2774 5675 9.6 254.1 17.7% 0.0% 0.0% 0.0% 32.85sec 835045 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparitions 341491 0 0 0.00 0 0 113.6 0.0 0.0% 0.0% 0.0% 0.0% 2.63sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparition 148859 364427 1215 22.01 3311 0 111.8 110.1 0.0% 0.0% 0.0% 0.0% 2.63sec 364427 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 345839 1153 17.47 3959 0 7.3 87.4 0.0% 0.0% 0.0% 0.0% 37.02sec 345839 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.68sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 1002197 3341 33.41 5061 10356 9.6 167.1 17.7% 0.0% 0.0% 0.0% 32.85sec 1002197 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 167.1 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment 373427 0 0 0.00 0 0 41.8 0.0 0.0% 0.0% 0.0% 0.0% 6.99sec 0 138.63sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment_damage 373442 845505 6099 18.11 16157 33960 41.8 41.8 22.7% 0.0% 0.0% 0.0% 6.99sec 845505 138.63sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender melee 0 722661 5213 56.83 4470 9089 131.3 131.3 22.4% 0.0% 0.0% 0.0% 2.22sec 722661 138.63sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 309.97sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2430876 8103 4.42 90797 182824 22.1 22.1 21.0% 0.0% 0.0% 0.0% 13.50sec 2430876 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 30.03sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 612550 2042 16.43 6340 12742 82.2 82.2 17.4% 0.0% 0.0% 0.0% 3.65sec 1457593 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 845043 2817 38.45 3738 7515 82.2 192.3 17.4% 0.0% 0.0% 0.0% 3.65sec 1457593 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 284345 948 132.39 365 734 661.9 661.9 17.4% 0.0% 0.0% 0.0% 0.73sec 284345 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 327433 1091 5.67 9806 19715 28.4 28.4 17.6% 0.0% 0.0% 0.0% 7.75sec 327433 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 1664938 5550 8.64 32741 65744 43.2 43.2 17.5% 0.0% 0.0% 0.0% 6.91sec 1664938 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 596429 1988 4.94 20566 41268 24.7 24.7 17.3% 0.0% 0.0% 0.0% 12.26sec 596429 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 2857956 9527 13.29 36563 73551 66.4 66.4 17.4% 0.0% 0.0% 0.0% 4.46sec 2857956 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 1176544 3922 3.72 52214 104273 18.6 18.6 21.3% 0.0% 0.0% 0.0% 16.31sec 1176544 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 0 511073 1704 38.64 2612 5255 193.2 193.2 17.4% 16.3% 0.0% 0.0% 1.81sec 730122 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 1 255997 853 38.67 1308 2631 193.3 193.3 17.4% 16.3% 0.0% 0.0% 1.80sec 365719 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.75sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement primordial_wave 375982 49188 164 1.41 5983 12007 7.0 7.0 16.9% 0.0% 0.0% 0.0% 45.72sec 49188 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_pw 188196 841856 2806 1.40 99405 199932 7.0 7.0 20.9% 0.0% 0.0% 0.0% 45.91sec 841856 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 46.4 0.0 0.0% 0.0% 0.0% 0.0% 6.36sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 368399 1228 9.29 6739 13565 46.4 46.4 17.5% 0.0% 0.0% 0.0% 6.36sec 526298 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 184179 614 9.29 3370 6778 46.4 46.4 17.5% 0.0% 0.0% 0.0% 6.36sec 263120 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 241335 804 1.14 36134 72321 5.7 5.7 17.3% 0.0% 0.0% 0.0% 53.91sec 241335 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 220531 735 29.77 1259 2531 148.9 148.9 17.5% 0.0% 0.0% 0.0% 4.14sec 315053 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26415 427 38.74 564 1128 39.9 39.9 17.3% 0.0% 0.0% 0.0% 2.24sec 37737 61.81sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_lightning_wolf melee 0 210094 7848 200.15 2001 3998 89.3 89.3 17.6% 0.0% 0.0% 0.0% 3.41sec 300142 26.77sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_fiery_wolf melee 0 212925 7059 178.75 2015 4026 89.9 89.9 17.6% 0.0% 0.0% 0.0% 3.41sec 304186 30.16sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_frost_wolf melee 0 211263 4210 106.84 2012 4025 89.3 89.3 17.5% 0.0% 0.0% 0.0% 3.42sec 301813 50.18sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_dre 114051 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 30.64sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_damage_dre 344548 319181 1064 1.67 31945 64226 8.3 8.3 19.5% 0.0% 0.0% 0.0% 30.64sec 319181 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba doom_winds 384352 24938 83 0.75 6681 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.41sec 35627 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 308.99sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba elemental_blast 117014 2124221 7081 5.01 70139 140722 25.1 25.1 20.7% 0.0% 0.0% 0.0% 11.77sec 2124221 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba feral_spirit 51533 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 21.44sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock 188389 99140 330 6.02 2805 5631 30.1 30.1 17.4% 0.0% 0.0% 0.0% 9.83sec 464760 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock ticks -188389 365620 1219 37.37 1667 3346 30.1 186.9 17.3% 0.0% 0.0% 0.0% 9.83sec 464760 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_attack 10444 467426 1558 225.89 353 707 1129.5 1129.5 17.3% 0.0% 0.0% 0.0% 0.67sec 467426 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba forgestorm_ignited_damage 381700 333623 1112 5.79 9807 19718 29.0 29.0 17.3% 0.0% 0.0% 0.0% 7.58sec 333623 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba frost_shock 196840 316288 1054 3.35 16085 32228 16.7 16.7 17.4% 0.0% 0.0% 0.0% 16.78sec 316288 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ice_strike 342240 434296 1448 4.06 18187 36521 20.3 20.3 17.4% 0.0% 0.0% 0.0% 14.86sec 434296 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lava_lash 60103 413028 1377 3.72 18916 37938 18.6 18.6 17.4% 0.0% 0.0% 0.0% 15.75sec 413028 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt 188196 849441 2831 3.29 42388 85202 16.5 16.5 21.5% 0.0% 0.0% 0.0% 17.11sec 849441 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba main_hand 0 427367 1425 32.61 2592 5209 163.1 163.1 17.3% 16.4% 0.0% 0.0% 2.14sec 610539 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba offhand 1 218981 730 33.35 1298 2610 166.8 166.8 17.3% 16.4% 0.0% 0.0% 2.09sec 312837 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike 17364 0 0 0.00 0 0 91.9 0.0 0.0% 0.0% 0.0% 0.0% 3.25sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_mh 32175 1270193 4234 24.51 8813 17736 122.6 122.6 17.4% 0.0% 0.0% 0.0% 3.25sec 1814607 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_mh 390287 301538 1005 12.21 4938 0 61.1 61.1 0.0% 0.0% 0.0% 0.0% 5.47sec 301538 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_offhand 32176 634945 2116 24.51 4407 8861 122.6 122.6 17.4% 0.0% 0.0% 0.0% 3.25sec 907088 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_offhand 390287 150728 502 12.21 2468 0 61.1 61.1 0.0% 0.0% 0.0% 0.0% 5.47sec 150728 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba sundering 197214 314808 1049 1.28 41896 83991 6.4 6.4 17.2% 0.0% 0.0% 0.0% 49.21sec 314808 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_attack 25504 2137192 7124 83.46 4366 8751 417.3 417.3 17.2% 0.0% 0.0% 0.0% 2.40sec 3053210 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash 114089 151279 504 6.74 3700 7439 33.7 33.7 21.2% 0.0% 0.0% 0.0% 8.45sec 151279 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash_offhand 114093 87482 292 7.80 1851 3718 39.0 39.0 21.1% 0.0% 0.0% 0.0% 7.31sec 87482 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike 115356 0 0 0.00 0 0 27.5 0.0 0.0% 0.0% 0.0% 0.0% 8.59sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_mh 115357 574378 1915 7.32 13377 26883 36.6 36.6 17.1% 0.0% 0.0% 0.0% 8.59sec 574378 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_mh 390287 104133 347 2.50 8343 0 12.5 12.5 0.0% 0.0% 0.0% 0.0% 18.26sec 104133 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_offhand 115360 287314 958 7.32 6690 13426 36.6 36.6 17.2% 0.0% 0.0% 0.0% 8.59sec 287314 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_offhand 390287 52020 173 2.50 4168 0 12.5 12.5 0.0% 0.0% 0.0% 0.0% 18.26sec 52020 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt_ti 188196 1097411 3658 5.48 32995 66258 27.4 27.4 21.2% 0.0% 0.0% 0.0% 8.61sec 1097411 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_greater_earth_elemental melee 0 26525 425 39.40 552 1105 41.0 41.0 17.2% 0.0% 0.0% 0.0% 2.37sec 37894 62.39sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_spirit_wolf melee 0 841761 7890 205.65 1964 3922 365.7 365.7 17.3% 0.0% 0.0% 0.0% 1.63sec 1202546 106.69sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.44sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance_damage 344548 103741 346 0.40 43758 87874 2.0 2.0 18.4% 0.0% 0.0% 0.0% 180.44sec 103741 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.71sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys doom_winds 384352 24471 82 0.74 6575 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.47sec 34959 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 305.97sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys elemental_blast 117014 2002979 6677 4.95 66860 134648 24.7 24.7 20.9% 0.0% 0.0% 0.0% 11.69sec 2002979 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys feral_spirit 51533 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 24.03sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock 188389 107197 357 6.58 2776 5572 32.9 32.9 17.3% 0.0% 0.0% 0.0% 8.83sec 465926 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock ticks -188389 358729 1196 36.62 1667 3347 32.9 183.1 17.4% 0.0% 0.0% 0.0% 8.83sec 465926 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_attack 10444 456888 1523 216.83 359 720 1084.2 1084.2 17.3% 0.0% 0.0% 0.0% 0.69sec 456888 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys forgestorm_ignited_damage 381700 330180 1101 5.73 9805 19715 28.6 28.6 17.4% 0.0% 0.0% 0.0% 7.61sec 330180 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys frost_shock 196840 367933 1226 4.00 15665 31437 20.0 20.0 17.3% 0.0% 0.0% 0.0% 13.83sec 367933 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ice_strike 342240 450219 1501 4.24 18080 36220 21.2 21.2 17.4% 0.0% 0.0% 0.0% 14.16sec 450219 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lava_lash 60103 419953 1400 3.82 18725 37579 19.1 19.1 17.4% 0.0% 0.0% 0.0% 14.98sec 419953 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt 188196 911498 3038 3.62 41294 83061 18.1 18.1 21.6% 0.0% 0.0% 0.0% 15.43sec 911498 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys main_hand 0 440722 1469 34.40 2531 5090 172.0 172.0 17.4% 16.4% 0.0% 0.0% 1.93sec 629619 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys offhand 1 223416 745 34.77 1270 2553 173.9 173.9 17.4% 16.4% 0.0% 0.0% 2.01sec 319174 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike 17364 0 0 0.00 0 0 88.6 0.0 0.0% 0.0% 0.0% 0.0% 3.21sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_mh 32175 1168727 3896 23.65 8404 16913 118.2 118.2 17.4% 0.0% 0.0% 0.0% 3.21sec 1669653 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_mh 390287 271367 905 11.60 4679 0 58.0 58.0 0.0% 0.0% 0.0% 0.0% 5.44sec 271367 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_offhand 32176 584359 1948 23.65 4202 8456 118.2 118.2 17.4% 0.0% 0.0% 0.0% 3.21sec 834820 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_offhand 390287 135481 452 11.60 2336 0 58.0 58.0 0.0% 0.0% 0.0% 0.0% 5.44sec 135481 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys sundering 197214 310361 1035 1.31 40398 81132 6.5 6.5 17.3% 0.0% 0.0% 0.0% 46.80sec 310361 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_attack 25504 2164747 7216 81.72 4521 9041 408.6 408.6 17.2% 0.0% 0.0% 0.0% 2.46sec 3092574 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash 114089 134012 447 4.79 4625 9297 24.0 24.0 20.8% 0.0% 0.0% 0.0% 10.21sec 134012 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash_offhand 114093 70637 235 5.04 2318 4653 25.2 25.2 20.7% 0.0% 0.0% 0.0% 9.69sec 70637 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike 115356 0 0 0.00 0 0 20.2 0.0 0.0% 0.0% 0.0% 0.0% 10.02sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_mh 115357 569857 1900 5.38 18146 36330 26.9 26.9 16.6% 0.0% 0.0% 0.0% 10.02sec 569857 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_mh 390287 128258 428 2.33 11020 0 11.6 11.6 0.0% 0.0% 0.0% 0.0% 17.74sec 128258 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_offhand 115360 284974 950 5.38 9068 18211 26.9 26.9 16.6% 0.0% 0.0% 0.0% 10.02sec 284974 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_offhand 390287 64110 214 2.33 5509 0 11.6 11.6 0.0% 0.0% 0.0% 0.0% 17.74sec 64110 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt_ti 188196 1018936 3396 4.05 41674 83636 20.2 20.2 20.7% 0.0% 0.0% 0.0% 10.02sec 1018936 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_greater_earth_elemental melee 0 25604 414 38.22 554 1108 39.4 39.4 17.3% 0.0% 0.0% 0.0% 2.43sec 36577 61.85sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_spirit_wolf melee 0 810124 14534 368.43 2019 4028 342.3 342.3 17.3% 0.0% 0.0% 0.0% 1.73sec 1157350 55.74sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
270599.5 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.5 2.2 22.4sec 18.8sec 5.5sec 22.86% 23.13% 2.2 (2.2) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 192.0s
  • trigger_min/max:2.8s / 192.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.0s

Stack Uptimes

  • brittle_1:22.86%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.2sec 18.7sec 5.5sec 23.15% 23.41% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 180.0s
  • trigger_min/max:3.0s / 180.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.15%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_death_check) 10.1 2.7 31.4sec 24.4sec 7.2sec 24.21% 0.00% 2.7 (2.7) 9.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_death_check
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.6s / 67.8s
  • trigger_min/max:0.9s / 67.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.7s

Stack Uptimes

  • death_and_madness_death_check_1:24.21%

Spelldata

  • id:322098
  • name:Death and Madness
  • tooltip:If the target dies within {$d=7 seconds}, the Priest gains {$321291m2=20} Insanity.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 2.2 114.0 130.2sec 2.5sec 135.8sec 97.90% 0.00% 95.1 (95.1) 1.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.1s / 340.7s
  • trigger_min/max:0.0s / 17.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.7s

Stack Uptimes

  • death_rot_1:1.06%
  • death_rot_2:1.66%
  • death_rot_3:1.23%
  • death_rot_4:1.23%
  • death_rot_5:1.15%
  • death_rot_6:1.27%
  • death_rot_7:1.23%
  • death_rot_8:1.33%
  • death_rot_9:1.34%
  • death_rot_10:86.41%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 4.7 238.4 68.9sec 1.2sec 62.0sec 97.93% 98.03% 196.6 (196.6) 3.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 335.3s
  • trigger_min/max:0.0s / 16.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 336.2s

Stack Uptimes

  • everfrost_1:1.58%
  • everfrost_2:1.57%
  • everfrost_3:1.57%
  • everfrost_4:1.56%
  • everfrost_5:1.55%
  • everfrost_6:1.55%
  • everfrost_7:1.54%
  • everfrost_8:1.54%
  • everfrost_9:1.53%
  • everfrost_10:83.95%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 24.5 37.2 12.3sec 4.9sec 10.2sec 82.91% 100.00% 5.1 (5.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 84.3s
  • trigger_min/max:0.0s / 30.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 82.7s

Stack Uptimes

  • festering_wound_1:18.88%
  • festering_wound_2:23.66%
  • festering_wound_3:18.65%
  • festering_wound_4:8.40%
  • festering_wound_5:6.33%
  • festering_wound_6:7.00%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 65.4 5.9sec 4.5sec 295.0sec 98.32% 97.93% 65.4 (65.4) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 5.9s
  • trigger_min/max:0.8s / 15.5s
  • trigger_pct:100.00%
  • duration_min/max:231.9s / 358.9s

Stack Uptimes

  • lashing_flames_1:98.32%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 65.1 190.2sec 4.5sec 287.8sec 99.19% 0.00% 60.9 (60.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 355.1s
  • trigger_min/max:0.9s / 58.5s
  • trigger_pct:100.00%
  • duration_min/max:2.2s / 357.9s

Stack Uptimes

  • razorice_1:1.01%
  • razorice_2:0.83%
  • razorice_3:0.92%
  • razorice_4:0.86%
  • razorice_5:95.57%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 273479.47
Minimum 248785.74
Maximum 298622.78
Spread ( max - min ) 49837.04
Range [ ( max - min ) / 2 * 100% ] 9.11%
Standard Deviation 6997.7905
5th Percentile 262185.40
95th Percentile 285197.14
( 95th Percentile - 5th Percentile ) 23011.74
Mean Distribution
Standard Deviation 80.8089
95.00% Confidence Interval ( 273321.08 - 273637.85 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2516
0.1 Scale Factor Error with Delta=300 418029
0.05 Scale Factor Error with Delta=300 1672113
0.01 Scale Factor Error with Delta=300 41802816
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3799
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 97796440 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.