SimulationCraft has not been built with PTR data.  The 'ptr=' option is ignored.

SimulationCraft 1002-01

for World of Warcraft 10.0.2.46924 Live (hotfix 2022-12-05/46924, git build 4a8b330f0e)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 45108 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45107.8 45107.8 52.5 / 0.116% 9071.9 / 20.1% 3516.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.5 12.8 Runic Power 7.17% 49.8 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 45108
Abomination Limb 0 (582) 0.0% (1.3%) 3.0 120.55sec 57768 46551

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2412 0.0000 0.00 0.00 0.00% 46550.63 46550.63

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [Z]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [a]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 582 1.3% 38.2 6.91sec 4520 0 Direct 38.2 3580 7185 4520 26.1% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.24 38.24 0.00 0.00 0.00 0.0000 0.0000 172842.48 172842.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.94% 28.28 14 36 3580.08 2324 6864 3579.80 2914 4281 101230 101230 0.00%
crit 26.06% 9.97 1 20 7184.87 4647 13328 7184.67 5066 9840 71612 71612 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2706 6.0% 189.4 1.85sec 4281 2331 Direct 189.4 3885 7782 4281 26.5% 16.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.40 189.40 0.00 0.00 0.00 1.8371 0.0000 810924.99 1158493.80 30.00% 2330.59 2330.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.07% 108.10 69 155 3884.55 2482 7599 3885.15 3605 4246 419903 599877 30.00%
crit 26.53% 50.25 22 85 7781.61 4964 15198 7781.64 6916 8775 391022 558617 30.00%
miss 16.40% 31.06 12 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1318 2.9% 185.1 1.85sec 2135 1162 Direct 185.1 1942 3891 2135 26.6% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 185.06 185.06 0.00 0.00 0.00 1.8369 0.0000 395111.87 564459.92 30.00% 1162.32 1162.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.68% 104.89 65 150 1941.93 1241 3800 1942.21 1801 2145 203694 290999 30.00%
crit 26.58% 49.19 25 78 3891.36 2482 7599 3891.62 3435 4357 191418 273461 30.00%
miss 16.74% 30.98 12 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Breath of Sindragosa 0 (11724) 0.0% (26.0%) 2.9 120.66sec 1193865 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [d]:2.94
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 11724 26.0% 196.8 1.43sec 17858 0 Direct 196.8 14106 28198 17858 26.6% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 196.78 196.78 0.00 0.00 0.00 0.0000 0.0000 3514093.81 3514093.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.37% 144.38 67 225 14105.68 8053 29733 14121.23 12818 15424 2036517 2036517 0.00%
crit 26.63% 52.40 22 91 28198.06 16079 58784 28223.14 24328 32060 1477577 1477577 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 687 1.5% 2.9 119.57sec 69892 0 Direct 2.8 58189 117676 74116 26.8% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.78 0.00 0.00 0.00 0.0000 0.0000 205911.08 205911.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.23% 2.03 0 3 58189.21 22015 66044 56375.45 0 66044 118396 118396 0.00%
crit 26.77% 0.74 0 3 117675.62 44029 132088 67869.35 0 132088 87515 87515 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 21 0.0% 1.1 113.11sec 6059 4552 Direct 11.4 444 887 559 26.0% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.05 11.38 0.00 0.00 0.00 1.3312 0.0000 6368.83 6368.83 0.00% 4552.42 4552.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.97% 8.42 0 31 443.98 317 728 324.85 0 646 3739 3739 0.00%
crit 26.03% 2.96 0 17 887.48 635 1421 632.29 0 1291 2630 2630 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [R]:1.05
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 777 1.7% 5.5 47.08sec 42098 0 Direct 5.5 33171 66341 42119 27.0% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 5.54 0.00 0.00 0.00 0.0000 0.0000 233207.85 333162.57 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.03% 4.04 0 6 33170.70 33171 33171 33126.47 0 33171 134125 191612 29.96%
crit 26.97% 1.49 0 5 66341.40 66341 66341 54106.42 0 66341 99083 141551 24.47%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 1986 4.4% 66.3 4.50sec 8986 0 Periodic 98.7 4765 9543 6036 26.6% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.32 0.00 98.74 98.74 65.31 0.0000 2.9999 595943.28 595943.28 0.00% 2011.95 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 73.41% 72.48 48 100 4764.93 304 10356 4764.94 4397 5146 345353 345353 0.00%
crit 26.59% 26.26 10 47 9542.80 673 21193 9542.87 8317 11193 250591 250591 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 884 (1326) 2.0% (3.0%) 24.6 7.12sec 16256 12101 Direct 24.6 (49.2) 8555 17101 10840 26.7% (26.7%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.58 24.58 0.00 0.00 0.00 1.3434 0.0000 266425.39 266425.39 0.00% 12101.01 12101.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.26% 18.01 2 44 8554.72 5441 14773 8530.69 6878 10540 154041 154041 0.00%
crit 26.74% 6.57 0 23 17100.60 11250 28780 16938.83 0 23076 112384 112384 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:25.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [C]:14.23
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [i]:3.18
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [m]:7.16
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 442 1.0% 24.6 7.12sec 5416 0 Direct 24.6 4277 8555 5416 26.6% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.58 24.58 0.00 0.00 0.00 0.0000 0.0000 133125.87 133125.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.36% 18.03 0 47 4276.53 2766 7387 4263.93 0 5163 77107 77107 0.00%
crit 26.64% 6.55 0 22 8554.86 5441 14582 8490.70 0 11589 56018 56018 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 6888 (8331) 15.3% (18.5%) 66.3 4.50sec 37629 30598 Direct 66.3 (132.5) 24574 49217 31110 26.5% (26.5%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.32 66.32 0.00 0.00 0.00 1.2298 0.0000 2063122.44 2063122.44 0.00% 30597.76 30597.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.48% 48.73 23 74 24573.98 4294 52952 24576.81 22073 27439 1197456 1197456 0.00%
crit 26.52% 17.59 4 36 49217.48 8588 103993 49230.27 39862 63397 865666 865666 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [N]:49.41
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [S]:0.55
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [U]:0.73
  • if_expr:buff.rime.react
    single_target
    [h]:15.63
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1443 3.2% 66.2 4.52sec 6533 0 Direct 66.2 5163 10327 6533 26.5% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.17 66.17 0.00 0.00 0.00 0.0000 0.0000 432308.15 432308.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.46% 48.60 23 75 5162.79 2773 11126 5163.68 4565 5819 250935 250935 0.00%
crit 26.54% 17.56 5 36 10326.67 5547 21359 10330.32 8604 12858 181374 181374 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1657 (8671) 3.7% (19.2%) 64.5 4.60sec 40283 19841 Direct 64.5 (212.5) 6077 12175 7699 26.6% (55.4%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.52 64.52 0.00 0.00 0.00 2.0303 0.0000 496721.86 709620.75 30.00% 19841.31 19841.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.40% 47.36 25 73 6076.52 3943 12103 6079.55 5562 6901 287761 411098 30.00%
crit 26.60% 17.16 4 35 12175.41 7886 24206 12178.16 9817 15388 208960 298523 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [P]:23.83
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Q]:47.12
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [T]:9.30
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [g]:11.40
  • if_expr:!variable.pooling_runes&buff.killing_machine.react
    single_target
    [j]:14.61
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 828 1.8% 64.5 4.60sec 3845 0 Direct 64.5 3040 6080 3845 26.5% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.52 64.52 0.00 0.00 0.00 0.0000 0.0000 248095.26 354430.84 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.50% 47.42 23 74 3039.59 1971 6051 3041.15 2731 3403 144146 205929 30.00%
crit 26.50% 17.10 4 32 6080.35 3943 11967 6081.38 5038 7640 103949 148502 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 4124 9.1% 41.7 7.08sec 29611 0 Direct 41.7 0 29611 29611 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.75 41.75 0.00 0.00 0.00 0.0000 0.0000 1236130.84 1236130.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 41.75 21 62 29610.73 16073 62599 29598.39 26116 33141 1236131 1236131 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2062 4.6% 41.7 7.08sec 14805 0 Direct 41.7 0 14805 14805 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.75 41.75 0.00 0.00 0.00 0.0000 0.0000 618065.42 618065.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 41.75 21 62 14805.37 8036 31299 14799.20 13058 16571 618065 618065 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (5528) 0.0% (12.3%) 15.0 20.59sec 110349 87487

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.02 0.00 0.00 0.00 0.00 1.2613 0.0000 0.00 0.00 0.00% 87487.42 87487.42

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [M]:9.44
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [f]:5.58
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5528 12.3% 243.4 1.23sec 6808 0 Direct 243.4 5373 10781 6808 26.5% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 243.42 243.42 0.00 0.00 0.00 0.0000 0.0000 1657099.18 1657099.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.47% 178.84 123 245 5373.15 1112 14711 5371.59 4658 6282 960929 960929 0.00%
crit 26.53% 64.58 35 100 10780.80 2224 29092 10777.32 7812 13232 696170 696170 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 195 0.4% 20.1 14.49sec 2907 0 Direct 20.1 2296 4593 2907 26.6% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.08 20.08 0.00 0.00 0.00 0.0000 0.0000 58374.54 83394.33 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.41% 14.74 4 29 2296.31 2296 2296 2296.31 2296 2296 33853 48362 30.00%
crit 26.59% 5.34 0 15 4592.63 4593 4593 4575.48 0 4593 24522 35032 29.89%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 195 0.4% 20.1 14.50sec 2907 0 Direct 20.1 2296 4593 2907 26.6% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.08 20.08 0.00 0.00 0.00 0.0000 0.0000 58367.81 83384.71 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.40% 14.74 4 32 2296.31 2296 2296 2296.31 2296 2296 33842 48347 30.00%
crit 26.60% 5.34 0 15 4592.63 4593 4593 4566.90 0 4593 24526 35038 29.83%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 1946 / 1062
Claw 641 0.8% 52.3 5.39sec 2004 2004 Direct 52.3 1583 3168 2004 26.6% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.27 52.27 0.00 0.00 0.00 1.0000 0.0000 104747.74 149643.45 30.00% 2004.13 2004.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.41% 38.37 20 52 1582.68 999 3011 1584.49 1400 1761 60726 86754 30.00%
crit 26.59% 13.90 3 27 3167.75 1998 6023 3171.44 2599 4008 44022 62890 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.27
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.70sec 72 72 Direct 2.9 57 114 72 26.2% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 0.00 1.0000 0.0000 211.36 301.95 30.00% 72.28 72.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.81% 2.16 0 3 57.37 35 79 56.08 0 76 124 177 29.30%
crit 26.19% 0.77 0 3 114.33 73 155 66.75 0 150 88 125 17.50%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.92
main_hand 1303 1.6% 94.6 2.93sec 2253 1445 Direct 94.6 1777 3554 2253 26.8% 0.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.59 94.59 0.00 0.00 0.00 1.5584 0.0000 213058.31 304376.77 30.00% 1445.45 1445.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.22% 69.25 41 93 1776.58 1110 3308 1779.09 1612 2010 123037 175772 30.00%
crit 26.78% 25.33 8 47 3553.80 2220 6541 3558.22 3025 4162 90021 128605 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 2.1 138.57sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.00 1.2956 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [V]:1.44
  • if_expr:runic_power<60
    single_target
    [l]:0.62
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 85.48sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [X]:0.37
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [Y]:3.58
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.8 62.56sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.83 0.00 0.00 0.00 0.00 1.2305 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [O]:4.45
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [k]:0.39
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 7.9 40.09sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.86 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [b]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [c]:7.54
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.4 307.32sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [W]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.70sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [e]:2.98
Unholy Strength 20.1 14.49sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.15 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5sec 120.5sec 11.8sec 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 125.1s
  • trigger_min/max:120.0s / 125.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 12.1 29.6 25.1sec 7.1sec 19.2sec 77.78% 0.00% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 80.6s
  • trigger_min/max:0.9s / 54.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.9s

Stack Uptimes

  • bonegrinder_crit_1:25.44%
  • bonegrinder_crit_2:18.85%
  • bonegrinder_crit_3:14.16%
  • bonegrinder_crit_4:10.81%
  • bonegrinder_crit_5:8.53%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 3.6 0.0 70.1sec 70.1sec 9.8sec 11.73% 37.36% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 293.3s
  • trigger_min/max:13.1s / 293.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • bonegrinder_frost_1:11.73%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.9 13.7 120.4sec 15.9sec 19.4sec 19.17% 0.00% 1.4 (1.4) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 132.9s
  • trigger_min/max:0.0s / 114.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:1.45%
  • bound_by_fire_and_blaze_2:4.41%
  • bound_by_fire_and_blaze_3:4.31%
  • bound_by_fire_and_blaze_4:3.72%
  • bound_by_fire_and_blaze_5:2.66%
  • bound_by_fire_and_blaze_6:2.63%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.7sec 120.7sec 66.8sec 65.52% 0.00% 196.2 (196.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 195.6s
  • trigger_min/max:120.0s / 195.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 190.0s

Stack Uptimes

  • breath_of_sindragosa_1:65.52%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.7sec 120.7sec 0.6sec 0.59% 0.00% 5.5 (5.5) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.70
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 131.7s
  • trigger_min/max:120.0s / 131.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.7s

Stack Uptimes

  • dragon_games_equipment_1:0.59%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 307.2sec 307.2sec 26.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 332.3s
  • trigger_min/max:300.0s / 332.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.72%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 85.5sec 85.5sec 19.5sec 25.89% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 231.0s
  • trigger_min/max:0.0s / 231.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:25.89%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 7.5 0.0 40.1sec 40.1sec 12.0sec 30.20% 0.00% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.2s / 57.8s
  • trigger_min/max:28.2s / 57.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • enduring_strength_1:30.20%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 7.7 16.4 40.5sec 12.0sec 9.6sec 24.65% 98.38% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.2s / 126.7s
  • trigger_min/max:0.9s / 121.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:9.89%
  • enduring_strength_builder_2:7.73%
  • enduring_strength_builder_3:4.47%
  • enduring_strength_builder_4:1.84%
  • enduring_strength_builder_5:0.56%
  • enduring_strength_builder_6:0.14%
  • enduring_strength_builder_7:0.03%
  • enduring_strength_builder_8:0.00%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gathering Storm 13.4 127.3 23.1sec 2.1sec 15.2sec 68.26% 86.91% 67.4 (105.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.7s / 83.5s
  • trigger_min/max:0.9s / 36.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.1s

Stack Uptimes

  • gathering_storm_1:2.30%
  • gathering_storm_2:4.98%
  • gathering_storm_3:5.39%
  • gathering_storm_4:3.26%
  • gathering_storm_5:5.48%
  • gathering_storm_6:3.94%
  • gathering_storm_7:3.51%
  • gathering_storm_8:3.75%
  • gathering_storm_9:3.03%
  • gathering_storm_10:32.61%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 7.1 213.7 41.8sec 1.3sec 39.7sec 94.35% 76.73% 199.9 (199.9) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 292.9s
  • trigger_min/max:1.0s / 18.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 292.2s

Stack Uptimes

  • icy_talons_1:4.00%
  • icy_talons_2:3.40%
  • icy_talons_3:86.95%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 42.0 7.3 7.1sec 6.0sec 1.7sec 24.03% 27.46% 7.3 (7.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.6s
  • trigger_min/max:0.0s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.1s

Stack Uptimes

  • killing_machine_1:24.03%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 7.9 0.0 40.1sec 40.1sec 11.8sec 30.84% 30.44% 0.0 (0.0) 7.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.2s / 57.8s
  • trigger_min/max:28.2s / 57.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:30.84%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 7.9 57.0 40.1sec 4.4sec 11.6sec 30.36% 51.06% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:22.9s / 57.8s
  • trigger_min/max:0.9s / 47.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:2.06%
  • pillar_of_frost_bonus_2:2.37%
  • pillar_of_frost_bonus_3:2.88%
  • pillar_of_frost_bonus_4:2.40%
  • pillar_of_frost_bonus_5:2.54%
  • pillar_of_frost_bonus_6:2.90%
  • pillar_of_frost_bonus_7:2.38%
  • pillar_of_frost_bonus_8:2.33%
  • pillar_of_frost_bonus_9:2.14%
  • pillar_of_frost_bonus_10:1.81%
  • pillar_of_frost_bonus_11:1.67%
  • pillar_of_frost_bonus_12:1.45%
  • pillar_of_frost_bonus_13:1.12%
  • pillar_of_frost_bonus_14:0.79%
  • pillar_of_frost_bonus_15:0.47%
  • pillar_of_frost_bonus_16:0.29%
  • pillar_of_frost_bonus_17:0.23%
  • pillar_of_frost_bonus_18:0.19%
  • pillar_of_frost_bonus_19:0.17%
  • pillar_of_frost_bonus_20:0.11%
  • pillar_of_frost_bonus_21:0.04%
  • pillar_of_frost_bonus_22:0.01%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.5 1.5 23.0sec 20.6sec 16.8sec 75.91% 0.00% 222.4 (222.4) 12.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 83.1s
  • trigger_min/max:20.0s / 27.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.1s

Stack Uptimes

  • remorseless_winter_1:75.91%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 66.5 6.1 4.5sec 4.2sec 1.5sec 33.38% 99.78% 6.1 (6.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 45.2s
  • trigger_min/max:0.0s / 45.2s
  • trigger_pct:63.10%
  • duration_min/max:0.0s / 16.2s

Stack Uptimes

  • rime_1:33.38%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.8 14.5 21.8sec 10.3sec 11.7sec 53.91% 0.00% 14.5 (14.5) 13.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 132.9s
  • trigger_min/max:0.9s / 132.9s
  • trigger_pct:15.02%
  • duration_min/max:0.0s / 80.3s

Stack Uptimes

  • rune_mastery_1:53.91%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.4 23.3sec 14.5sec 10.2sec 43.40% 42.52% 7.4 (7.4) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 81.8s
  • trigger_min/max:0.0s / 64.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.2s

Stack Uptimes

  • rune_of_hysteria_1:43.40%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Strength 8.4 11.7 35.9sec 14.4sec 23.6sec 66.27% 0.00% 11.7 (11.7) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 171.0s
  • trigger_min/max:0.0s / 61.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 161.6s

Stack Uptimes

  • unholy_strength_1:66.27%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 7.1 213.7 41.8sec 1.3sec 39.7sec 94.35% 89.51% 199.9 (199.9) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 292.9s
  • trigger_min/max:1.0s / 18.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 292.2s

Stack Uptimes

  • unleashed_frenzy_1:4.00%
  • unleashed_frenzy_2:3.40%
  • unleashed_frenzy_3:86.95%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=6 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.5 7.0 46.0 11.0s 1.3s 121.8s
windfury_totem_extra_attack_oh 22.1 6.0 45.0 13.1s 1.3s 140.3s
Killing Machine spent on Obliterate 41.7 21.0 62.0 7.1s 0.9s 54.5s
Killing Machine: Critical auto attacks 42.0 21.0 63.0 7.1s 1.3s 56.6s
Killing Machine wasted: Critical auto attacks 7.3 0.0 22.0 35.6s 1.3s 325.7s
Rune ready 224.7 158.0 292.0 1.5s 0.0s 13.1s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.97% 0.03% 11.78% 0.7s 0.0s 6.6s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=357314)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0671.244 / 0.9853.10916.655
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
13.56831.67059.273 / 57.62891.871141.127

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Remorseless Winter0.7340.0017.8118.3281.04625.877
Horn of Winter19.1160.001129.56467.1280.000183.670
Death and Decay86.5370.055241.14327.6140.000241.143
Empower Rune Weapon14.7305.38127.0490.0060.00027.049
Abomination Limb0.7890.0015.0820.9320.0005.373
Pillar of Frost1.8730.00115.35411.1940.60930.697
Breath of Sindragosa0.8230.00175.6131.2740.00075.613
Raise Dead0.7750.0015.0801.3760.3055.680

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Breath of SindragosaRune10.6810.594.71%0.990.080.78%
Empower Rune WeaponRunic Power19.1288.272.29%4.627.347.67%
Empower Rune WeaponRune19.1219.068.48%1.000.060.32%
Frost FeverRunic Power32.33154.034.00%4.767.604.70%
Horn of WinterRunic Power4.84120.883.14%25.000.000.00%
Horn of WinterRune9.679.674.30%1.000.000.00%
Murderous EfficiencyRune20.8720.879.29%1.000.000.00%
Rage of the Frozen ChampionRunic Power66.17514.1913.36%7.7715.142.86%
Rune RegenerationRune89.7789.7739.95%1.000.000.00%
Rune of HysteriaRunic Power163.24334.118.68%2.0528.587.88%
Runic AttenuationRunic Power71.08342.878.91%4.8212.523.52%
Runic EmpowermentRune75.0674.7533.27%1.000.310.41%
Arcane TorrentRunic Power2.0641.181.07%20.000.000.00%
Death and DecayRunic Power1.0510.510.27%10.000.000.00%
Howling BlastRunic Power66.321.490.04%0.020.000.00%
ObliterateRunic Power106.272094.7854.43%19.7130.541.44%
Remorseless WinterRunic Power15.02146.513.81%9.763.662.44%
pet - ghoul
energy_regenEnergy1114.631917.07100.00%1.72169.838.14%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 196.233139.7516.0015.961119.23
Death and DecayRune 1.051.051.001.006057.90
Frost StrikeRunic Power 24.58614.4025.0025.00650.31
Howling BlastRune 66.320.150.000.0016727636.17
ObliterateRune 106.27212.532.003.2912228.78
Remorseless WinterRune 15.0215.021.001.00110348.72
pet - ghoul
ClawEnergy 52.272090.6940.0040.0050.10
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 12.83 12.51 105.4 94.7 0.2 144.0
Rune 6.0 0.75 0.76 0.0 2.0 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 45107.80
Minimum 36088.54
Maximum 55322.37
Spread ( max - min ) 19233.83
Range [ ( max - min ) / 2 * 100% ] 21.32%
Standard Deviation 2317.7494
5th Percentile 41321.14
95th Percentile 48826.45
( 95th Percentile - 5th Percentile ) 7505.31
Mean Distribution
Standard Deviation 26.7648
95.00% Confidence Interval ( 45055.34 - 45160.26 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 102
0.1% Error 10143
0.1 Scale Factor Error with Delta=300 45859
0.05 Scale Factor Error with Delta=300 183433
0.01 Scale Factor Error with Delta=300 4585816
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 45107.80
Minimum 36088.54
Maximum 55322.37
Spread ( max - min ) 19233.83
Range [ ( max - min ) / 2 * 100% ] 21.32%
Standard Deviation 2317.7494
5th Percentile 41321.14
95th Percentile 48826.45
( 95th Percentile - 5th Percentile ) 7505.31
Mean Distribution
Standard Deviation 26.7648
95.00% Confidence Interval ( 45055.34 - 45160.26 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 102
0.1% Error 10143
0.1 Scale Factor Error with Delta=300 45859
0.05 Scale Factor Error with Delta=300 183433
0.01 Scale Factor Error with Delta=300 4585816
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 45107.80
Minimum 36088.54
Maximum 55322.37
Spread ( max - min ) 19233.83
Range [ ( max - min ) / 2 * 100% ] 21.32%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 13202240.96
Minimum 8628720.24
Maximum 17096293.13
Spread ( max - min ) 8467572.90
Range [ ( max - min ) / 2 * 100% ] 32.07%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
5 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
6 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
7 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
8 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
9 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
A 0.00 variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
C 14.23 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
D 0.00 call_action_list,name=trinkets
Choose Action list to run
E 0.00 call_action_list,name=cooldowns
F 0.00 call_action_list,name=racials
G 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
H 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
I 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
J 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
L 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
M 9.44 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
N 49.41 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
O 4.45 horn_of_winter,if=rune<2&runic_power.deficit>25
P 23.83 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
Q 47.12 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
R 1.05 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
S 0.55 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
T 9.30 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
U 0.73 howling_blast,if=buff.rime.react
V 1.44 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
W 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
X 0.37 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
Y 3.58 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
Z 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
a 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
b 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
c 7.54 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
d 2.94 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
e 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
f 5.58 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
0.00 frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
g 11.40 obliterate,if=!variable.pooling_runes&buff.killing_machine.react
h 15.63 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
i 3.18 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
j 14.61 obliterate,if=!variable.pooling_runes
k 0.39 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
l 0.62 arcane_torrent,if=runic_power.deficit>20
m 7.16 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
n 2.85 use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
o 2.76 use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
p 0.09 use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
q 0.01 use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABaefghgdnYcWNQNPQNPQNQQNOPNTNMPPNoTTTNPQTPcQNQMQNPNQQYQQVQNQQMNPNPNQQNPOcQNQNPMQNQRjmjhmjmmfjhCCgCjjjhgaefChdncQQNQQPNQOTNQMNPoYQNPQNPNQQQNQNMQQcNQQNQVQQOMQQNQQUjjmmjhCCfjCcjhmgmmjmgCfCghCjghaehjCdnNNMPcQONQNQQYQNoQQMPQQNPNQNQNPNQQMPNbRSjh

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 4 trinket_1_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 5 trinket_2_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 6 trinket_1_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 7 trinket_2_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 8 trinket_priority Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 9 rw_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat A 2h_check Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default B auto_attack Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 cooldowns a abomination_limb Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, killing_machine, static_empowerment
0:01.034 cooldowns e raise_dead Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, killing_machine, rime, static_empowerment(2)
0:01.034 single_target f remorseless_winter Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, killing_machine, rime, static_empowerment(2)
0:02.070 single_target g obliterate Fluffy_Pillow 10.0/144: 7% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, killing_machine, remorseless_winter, rime, rune_of_hysteria, static_empowerment(3)
0:03.106 single_target h howling_blast Fluffy_Pillow 34.8/144: 24% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, rune_of_hysteria, static_empowerment(4)
0:04.144 single_target g obliterate Fluffy_Pillow 44.7/144: 31% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit, rune_of_hysteria, static_empowerment(5)
0:05.179 cooldowns d breath_of_sindragosa Fluffy_Pillow 69.5/144: 48% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), rune_of_hysteria, static_empowerment(5)
0:05.179 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 69.5/144: 48% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), rune_of_hysteria, static_empowerment(5)
0:05.179 cooldowns Y empower_rune_weapon Fluffy_Pillow 69.5/144: 48% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
0:05.179 cooldowns c pillar_of_frost Fluffy_Pillow 75.7/144: 53% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit(2), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
0:05.179 cooldowns W potion Fluffy_Pillow 75.7/144: 53% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
0:05.179 breath N howling_blast Fluffy_Pillow 75.7/144: 53% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(2), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.080 breath Q obliterate Fluffy_Pillow 91.8/144: 64% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, bonegrinder_crit(2), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.980 breath N howling_blast Fluffy_Pillow 106.8/144: 74% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons, killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy, bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.880 breath P obliterate Fluffy_Pillow 100.8/144: 70% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(2), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.781 breath Q obliterate Fluffy_Pillow 109.6/144: 76% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.683 breath N howling_blast Fluffy_Pillow 124.6/144: 87% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.584 breath P obliterate Fluffy_Pillow 123.5/144: 86% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:11.486 breath Q obliterate Fluffy_Pillow 127.5/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:12.387 breath N howling_blast Fluffy_Pillow 133.0/144: 92% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:13.288 breath Q obliterate Fluffy_Pillow 125.0/144: 87% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:14.187 breath Q obliterate Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:15.087 breath N howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:15.987 Waiting     0.201 sec 128.0/144: 89% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(19), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:16.188 breath O horn_of_winter Fluffy_Pillow 117.0/144: 81% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(19), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:17.089 breath P obliterate Fluffy_Pillow 142.0/144: 99% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(19), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(6), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:17.991 Waiting     0.109 sec 133.0/144: 92% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:18.100 breath N howling_blast Fluffy_Pillow 133.0/144: 92% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:19.000 Waiting     0.194 sec 130.0/144: 90% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:19.194 breath T obliterate Fluffy_Pillow 114.0/144: 79% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:20.096 breath N howling_blast Fluffy_Pillow 134.0/144: 93% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:20.996 breath M remorseless_winter Fluffy_Pillow 128.0/144: 89% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:21.935 breath P obliterate Fluffy_Pillow 122.0/144: 85% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:22.834 Waiting     0.398 sec 126.0/144: 88% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:23.232 breath P obliterate Fluffy_Pillow 110.0/144: 76% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:24.131 breath N howling_blast Fluffy_Pillow 130.0/144: 90% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:25.033 Waiting     0.225 sec 122.0/144: 85% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:25.258 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 111.0/144: 77% runic_power
6.0/6: 100% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:25.258 breath T obliterate Fluffy_Pillow 111.0/144: 77% runic_power
6.0/6: 100% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.292 Waiting     0.896 sec 120.0/144: 83% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:27.188 breath T obliterate Fluffy_Pillow 104.0/144: 72% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:28.224 breath T obliterate Fluffy_Pillow 108.0/144: 75% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:29.259 breath N howling_blast Fluffy_Pillow 112.0/144: 78% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:30.296 breath P obliterate Fluffy_Pillow 109.0/144: 76% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:31.334 Waiting     0.886 sec 113.0/144: 78% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:32.220 breath Q obliterate Fluffy_Pillow 102.0/144: 71% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.258 Waiting     0.813 sec 110.8/144: 77% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:34.071 breath T obliterate Fluffy_Pillow 110.8/144: 77% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:35.108 Waiting     0.085 sec 119.6/144: 83% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:35.193 breath P obliterate Fluffy_Pillow 103.6/144: 72% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:36.228 cooldowns c pillar_of_frost Fluffy_Pillow 118.6/144: 82% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:36.228 breath Q obliterate Fluffy_Pillow 118.6/144: 82% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:37.262 breath N howling_blast Fluffy_Pillow 127.4/144: 88% runic_power
1.0/6: 17% rune
bloodlust, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:38.296 Waiting     0.784 sec 121.3/144: 84% runic_power
1.0/6: 17% rune
bloodlust, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:39.080 breath Q obliterate Fluffy_Pillow 127.5/144: 89% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:40.116 Waiting     0.706 sec 128.0/144: 89% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:40.822 breath M remorseless_winter Fluffy_Pillow 112.0/144: 78% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:42.379 breath Q obliterate Fluffy_Pillow 92.4/144: 64% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:43.725 breath N howling_blast Fluffy_Pillow 101.2/144: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
0:45.068 breath P obliterate Fluffy_Pillow 93.2/144: 65% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
0:46.414 breath N howling_blast Fluffy_Pillow 81.2/144: 56% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
0:47.759 breath Q obliterate Fluffy_Pillow 73.2/144: 51% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
0:49.104 Waiting     1.114 sec 87.2/144: 61% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:50.218 breath Q obliterate Fluffy_Pillow 55.2/144: 38% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:51.217 cooldowns Y empower_rune_weapon Fluffy_Pillow 59.2/144: 41% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:51.562 breath Q obliterate Fluffy_Pillow 64.2/144: 45% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:52.734 Waiting     0.521 sec 68.2/144: 47% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:53.255 breath Q obliterate Fluffy_Pillow 52.2/144: 36% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:54.426 Waiting     0.804 sec 61.0/144: 42% runic_power
0.0/6: 0% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:55.230 breath V arcane_torrent Fluffy_Pillow 45.0/144: 31% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:56.400 breath Q obliterate Fluffy_Pillow 66.2/144: 46% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:57.570 breath N howling_blast Fluffy_Pillow 81.2/144: 56% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:58.741 breath Q obliterate Fluffy_Pillow 75.1/144: 52% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:59.910 breath Q obliterate Fluffy_Pillow 90.1/144: 63% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:01.081 breath M remorseless_winter Fluffy_Pillow 105.1/144: 73% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:02.252 breath N howling_blast Fluffy_Pillow 91.7/144: 64% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:03.422 breath P obliterate Fluffy_Pillow 85.6/144: 59% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:04.591 breath N howling_blast Fluffy_Pillow 94.4/144: 66% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:05.764 breath P obliterate Fluffy_Pillow 86.4/144: 60% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:06.933 breath N howling_blast Fluffy_Pillow 100.4/144: 70% runic_power
4.0/6: 67% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
1:08.106 breath Q obliterate Fluffy_Pillow 92.4/144: 64% runic_power
5.0/6: 83% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
1:09.275 breath Q obliterate Fluffy_Pillow 80.4/144: 56% runic_power
4.0/6: 67% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
1:10.446 breath N howling_blast Fluffy_Pillow 89.4/144: 62% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
1:11.616 breath P obliterate Fluffy_Pillow 86.4/144: 60% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
1:12.960 breath O horn_of_winter Fluffy_Pillow 90.4/144: 63% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:14.306 cooldowns c pillar_of_frost Fluffy_Pillow 88.4/144: 61% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:14.306 breath Q obliterate Fluffy_Pillow 88.4/144: 61% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:15.649 breath N howling_blast Fluffy_Pillow 92.4/144: 64% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:16.994 breath Q obliterate Fluffy_Pillow 84.4/144: 59% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:18.338 breath N howling_blast Fluffy_Pillow 72.4/144: 50% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:19.683 breath P obliterate Fluffy_Pillow 64.4/144: 45% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
1:21.030 breath M remorseless_winter Fluffy_Pillow 73.4/144: 51% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
1:22.425 Waiting     0.903 sec 56.4/144: 39% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
1:23.328 breath Q obliterate Fluffy_Pillow 45.4/144: 32% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
1:24.674 breath N howling_blast Fluffy_Pillow 54.4/144: 38% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
1:26.018 breath Q obliterate Fluffy_Pillow 46.4/144: 32% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
1:27.363 Waiting     0.898 sec 34.4/144: 24% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:28.261 breath R death_and_decay Fluffy_Pillow 18.4/144: 13% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:29.605 single_target j obliterate Fluffy_Pillow 12.4/144: 9% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:30.949 single_target m frost_strike Fluffy_Pillow 37.2/144: 26% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(8), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:32.295 single_target j obliterate Fluffy_Pillow 12.2/144: 9% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(8), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:33.640 single_target h howling_blast Fluffy_Pillow 43.2/144: 30% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:34.984 single_target m frost_strike Fluffy_Pillow 59.4/144: 41% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:36.329 single_target j obliterate Fluffy_Pillow 34.4/144: 24% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:37.673 single_target m frost_strike Fluffy_Pillow 65.4/144: 45% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
1:39.017 single_target m frost_strike Fluffy_Pillow 40.4/144: 28% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
1:40.361 Waiting     0.530 sec 15.4/144: 11% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
1:40.891 single_target f remorseless_winter Fluffy_Pillow 20.4/144: 14% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
1:42.426 single_target j obliterate Fluffy_Pillow 30.4/144: 21% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
1:43.773 single_target h howling_blast Fluffy_Pillow 50.4/144: 35% runic_power
0.0/6: 0% rune
rune_mastery, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, rime, unleashed_frenzy(3), static_empowerment(5)
1:45.118 default C frost_strike Fluffy_Pillow 58.4/144: 41% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(3), killing_machine, remorseless_winter, static_empowerment(5)
1:46.462 default C frost_strike Fluffy_Pillow 33.4/144: 23% runic_power
2.0/6: 33% rune
rune_mastery, gathering_storm(3), icy_talons, killing_machine, remorseless_winter, unleashed_frenzy, static_empowerment(5)
1:47.807 single_target g obliterate Fluffy_Pillow 8.4/144: 6% runic_power
3.0/6: 50% rune
rune_mastery, gathering_storm(3), icy_talons(2), killing_machine, remorseless_winter, unleashed_frenzy(2), static_empowerment(5)
1:49.152 default C frost_strike Fluffy_Pillow 33.4/144: 23% runic_power
2.0/6: 33% rune
rune_mastery, gathering_storm(5), icy_talons(2), remorseless_winter, bonegrinder_crit, unleashed_frenzy(2), static_empowerment(5)
1:50.497 single_target j obliterate Fluffy_Pillow 8.4/144: 6% runic_power
5.0/6: 83% rune
rune_mastery, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:51.843 single_target j obliterate Fluffy_Pillow 33.4/144: 23% runic_power
3.0/6: 50% rune
gathering_storm(7), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:53.188 single_target j obliterate Fluffy_Pillow 53.4/144: 37% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(9), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:54.532 single_target h howling_blast Fluffy_Pillow 78.2/144: 54% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:55.877 Waiting     3.587 sec 88.1/144: 61% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, bonegrinder_crit(2), rune_of_hysteria, static_empowerment(5)
1:59.464 single_target g obliterate Fluffy_Pillow 94.3/144: 65% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, killing_machine, bonegrinder_crit(2), rune_of_hysteria, static_empowerment(5)
2:00.809 cooldowns a abomination_limb Fluffy_Pillow 119.1/144: 83% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, bonegrinder_crit(3), rune_of_hysteria, static_empowerment(5)
2:02.155 cooldowns e raise_dead Fluffy_Pillow 125.3/144: 87% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, abomination_limb, rime, bonegrinder_crit(3), rune_of_hysteria, static_empowerment(5)
2:02.155 single_target f remorseless_winter Fluffy_Pillow 125.3/144: 87% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, abomination_limb, rime, bonegrinder_crit(3), rune_of_hysteria, static_empowerment(5)
2:03.500 default C frost_strike Fluffy_Pillow 137.7/144: 96% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, remorseless_winter, rime, bonegrinder_crit(3), rune_of_hysteria, static_empowerment(5)
2:04.845 single_target h howling_blast Fluffy_Pillow 118.9/144: 83% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, icy_talons, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
2:06.191 cooldowns d breath_of_sindragosa Fluffy_Pillow 128.8/144: 89% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, gathering_storm, icy_talons, killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
2:06.191 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 128.8/144: 89% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons, killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
2:06.191 cooldowns c pillar_of_frost Fluffy_Pillow 128.8/144: 89% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons, killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
2:06.191 breath Q obliterate Fluffy_Pillow 128.8/144: 89% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons, killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
2:07.535 breath Q obliterate Fluffy_Pillow 128.0/144: 89% runic_power
5.0/6: 83% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(2), bound_by_fire_and_blaze(2), static_empowerment(5)
2:08.880 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
5.0/6: 83% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:10.222 breath Q obliterate Fluffy_Pillow 109.0/144: 76% runic_power
6.0/6: 100% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:11.566 breath Q obliterate Fluffy_Pillow 113.0/144: 78% runic_power
5.0/6: 83% rune
rune_mastery, abomination_limb, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:12.911 breath P obliterate Fluffy_Pillow 117.0/144: 81% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:14.256 breath N howling_blast Fluffy_Pillow 110.0/144: 76% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:15.601 breath Q obliterate Fluffy_Pillow 102.0/144: 71% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:16.946 breath O horn_of_winter Fluffy_Pillow 111.0/144: 77% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
2:18.291 breath T obliterate Fluffy_Pillow 104.0/144: 72% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:19.634 breath N howling_blast Fluffy_Pillow 108.0/144: 75% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:20.978 breath Q obliterate Fluffy_Pillow 100.0/144: 69% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:22.323 breath M remorseless_winter Fluffy_Pillow 98.0/144: 68% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:23.666 breath N howling_blast Fluffy_Pillow 92.0/144: 64% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:25.011 breath P obliterate Fluffy_Pillow 89.0/144: 62% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:26.356 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 77.0/144: 53% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:26.356 Waiting     0.882 sec 77.0/144: 53% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5)
2:27.238 cooldowns Y empower_rune_weapon Fluffy_Pillow 61.0/144: 42% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:27.238 breath Q obliterate Fluffy_Pillow 66.0/144: 46% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:28.410 breath N howling_blast Fluffy_Pillow 70.0/144: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:29.582 breath P obliterate Fluffy_Pillow 62.0/144: 43% runic_power
4.0/6: 67% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:30.752 breath Q obliterate Fluffy_Pillow 71.0/144: 49% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:31.923 breath N howling_blast Fluffy_Pillow 80.0/144: 56% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:33.095 breath P obliterate Fluffy_Pillow 82.0/144: 57% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:34.264 breath N howling_blast Fluffy_Pillow 75.0/144: 52% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
2:35.434 breath Q obliterate Fluffy_Pillow 67.0/144: 47% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
2:36.604 Waiting     0.665 sec 71.0/144: 49% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:37.269 breath Q obliterate Fluffy_Pillow 61.2/144: 43% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:38.441 breath Q obliterate Fluffy_Pillow 76.2/144: 53% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:39.614 breath N howling_blast Fluffy_Pillow 91.2/144: 63% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:40.784 breath Q obliterate Fluffy_Pillow 91.3/144: 63% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:41.953 breath N howling_blast Fluffy_Pillow 100.1/144: 70% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:43.121 breath M remorseless_winter Fluffy_Pillow 106.4/144: 74% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:44.292 breath Q obliterate Fluffy_Pillow 86.8/144: 60% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:45.461 breath Q obliterate Fluffy_Pillow 95.6/144: 66% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
2:46.629 cooldowns c pillar_of_frost Fluffy_Pillow 99.6/144: 69% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:46.629 breath N howling_blast Fluffy_Pillow 99.6/144: 69% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:47.798 breath Q obliterate Fluffy_Pillow 101.6/144: 71% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:49.142 Waiting     2.866 sec 105.6/144: 73% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:52.008 breath Q obliterate Fluffy_Pillow 57.6/144: 40% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:53.353 breath N howling_blast Fluffy_Pillow 50.4/144: 35% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:54.698 breath Q obliterate Fluffy_Pillow 56.8/144: 39% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:56.044 Waiting     0.190 sec 65.6/144: 46% runic_power
0.0/6: 0% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:56.234 breath V arcane_torrent Fluffy_Pillow 49.6/144: 34% runic_power
0.0/6: 0% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:57.576 Waiting     0.674 sec 58.4/144: 41% runic_power
1.0/6: 17% rune
breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:58.250 breath Q obliterate Fluffy_Pillow 42.4/144: 29% runic_power
2.0/6: 33% rune
breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:59.594 Waiting     1.301 sec 51.2/144: 36% runic_power
1.0/6: 17% rune
breath_of_sindragosa, icy_talons(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:00.895 breath Q obliterate Fluffy_Pillow 35.2/144: 24% runic_power
2.0/6: 33% rune
breath_of_sindragosa, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:02.239 breath O horn_of_winter Fluffy_Pillow 28.0/144: 19% runic_power
1.0/6: 17% rune
breath_of_sindragosa, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:03.585 breath M remorseless_winter Fluffy_Pillow 43.0/144: 30% runic_power
5.0/6: 83% rune
breath_of_sindragosa, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:04.930 breath Q obliterate Fluffy_Pillow 45.6/144: 32% runic_power
4.0/6: 67% rune
breath_of_sindragosa, icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:06.274 breath Q obliterate Fluffy_Pillow 38.4/144: 27% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:07.618 breath N howling_blast Fluffy_Pillow 47.4/144: 33% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:08.964 breath Q obliterate Fluffy_Pillow 44.4/144: 31% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:10.310 breath Q obliterate Fluffy_Pillow 32.4/144: 22% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:11.656 breath U howling_blast Fluffy_Pillow 36.4/144: 25% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), remorseless_winter, rime, unleashed_frenzy(3), static_empowerment(5)
3:13.001 Waiting     0.213 sec 28.4/144: 20% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:13.214 single_target j obliterate Fluffy_Pillow 12.4/144: 9% runic_power
3.0/6: 50% rune
unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:14.559 single_target j obliterate Fluffy_Pillow 32.4/144: 22% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:15.903 single_target m frost_strike Fluffy_Pillow 57.4/144: 40% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:17.247 single_target m frost_strike Fluffy_Pillow 32.4/144: 22% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:18.591 Waiting     2.912 sec 17.4/144: 12% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:21.503 single_target j obliterate Fluffy_Pillow 22.4/144: 16% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:22.847 single_target h howling_blast Fluffy_Pillow 42.4/144: 29% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:24.192 default C frost_strike Fluffy_Pillow 55.4/144: 38% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, bonegrinder_crit, static_empowerment(5)
3:25.536 default C frost_strike Fluffy_Pillow 30.4/144: 21% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons, unleashed_frenzy, static_empowerment(5)
3:26.880 single_target f remorseless_winter Fluffy_Pillow 5.4/144: 4% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(2), unleashed_frenzy(2), static_empowerment(5)
3:28.224 single_target j obliterate Fluffy_Pillow 20.4/144: 14% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(2), remorseless_winter, unleashed_frenzy(2), static_empowerment(5)
3:29.568 default C frost_strike Fluffy_Pillow 40.4/144: 28% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(2), icy_talons(2), remorseless_winter, unleashed_frenzy(2), static_empowerment(5)
3:30.912 cooldowns c pillar_of_frost Fluffy_Pillow 21.6/144: 15% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(2), icy_talons(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:30.912 single_target j obliterate Fluffy_Pillow 21.6/144: 15% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(2), icy_talons(3), pillar_of_frost, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:32.257 single_target h howling_blast Fluffy_Pillow 46.4/144: 32% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:33.602 single_target m frost_strike Fluffy_Pillow 62.5/144: 43% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:34.946 single_target g obliterate Fluffy_Pillow 37.5/144: 26% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:36.291 single_target m frost_strike Fluffy_Pillow 62.3/144: 43% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:37.634 single_target m frost_strike Fluffy_Pillow 43.5/144: 30% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:38.979 Waiting     0.445 sec 18.5/144: 13% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:39.424 single_target j obliterate Fluffy_Pillow 18.5/144: 13% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:40.768 single_target m frost_strike Fluffy_Pillow 38.5/144: 27% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:42.112 Waiting     3.452 sec 13.5/144: 9% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:45.564 single_target g obliterate Fluffy_Pillow 23.5/144: 16% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:46.909 default C frost_strike Fluffy_Pillow 43.5/144: 30% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, bonegrinder_crit, enduring_strength, static_empowerment(5)
3:48.254 single_target f remorseless_winter Fluffy_Pillow 18.5/144: 13% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons, bonegrinder_crit, enduring_strength, unleashed_frenzy, static_empowerment(5)
3:49.598 default C frost_strike Fluffy_Pillow 28.5/144: 20% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy, static_empowerment(5)
3:50.943 single_target g obliterate Fluffy_Pillow 3.5/144: 2% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(2), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(2), static_empowerment(5)
3:52.287 single_target h howling_blast Fluffy_Pillow 23.5/144: 16% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(2), icy_talons(2), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(2), rune_of_hysteria, static_empowerment(5)
3:53.632 default C frost_strike Fluffy_Pillow 39.6/144: 28% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(3), icy_talons(2), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(2), rune_of_hysteria, static_empowerment(5)
3:54.977 single_target j obliterate Fluffy_Pillow 14.6/144: 10% runic_power
3.0/6: 50% rune
unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:56.321 Waiting     0.938 sec 39.4/144: 27% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:57.259 single_target g obliterate Fluffy_Pillow 51.8/144: 36% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:58.606 single_target h howling_blast Fluffy_Pillow 82.8/144: 58% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:59.949 Waiting     0.690 sec 92.7/144: 64% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(8), remorseless_winter, bonegrinder_crit(3), rune_of_hysteria, static_empowerment(5)
4:00.639 cooldowns a abomination_limb Fluffy_Pillow 92.7/144: 64% runic_power
1.0/6: 17% rune
unholy_strength, bonegrinder_crit(3), rune_of_hysteria, static_empowerment(5)
4:02.155 cooldowns e raise_dead Fluffy_Pillow 92.7/144: 64% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, rime, bonegrinder_crit(3), rune_of_hysteria, static_empowerment(5)
4:02.155 single_target h howling_blast Fluffy_Pillow 92.7/144: 64% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, rime, bonegrinder_crit(3), rune_of_hysteria, static_empowerment(5)
4:03.499 single_target j obliterate Fluffy_Pillow 115.0/144: 80% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, bonegrinder_crit(3), rune_of_hysteria, static_empowerment(5)
4:04.843 default C frost_strike Fluffy_Pillow 139.8/144: 97% runic_power
0.0/6: 0% rune
unholy_strength, abomination_limb, rime, bonegrinder_crit(3), rune_of_hysteria, static_empowerment(5)
4:06.188 cooldowns d breath_of_sindragosa Fluffy_Pillow 114.8/144: 80% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, icy_talons, rime, bonegrinder_crit(3), unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
4:06.191 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 114.8/144: 80% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons, rime, bonegrinder_crit(3), unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
4:06.191 breath N howling_blast Fluffy_Pillow 114.8/144: 80% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons, rime, bonegrinder_crit(3), unleashed_frenzy, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
4:07.536 breath N howling_blast Fluffy_Pillow 115.0/144: 80% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(2), killing_machine, rime, unleashed_frenzy(2), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
4:08.882 breath M remorseless_winter Fluffy_Pillow 108.9/144: 76% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(3), killing_machine, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5)
4:10.226 breath P obliterate Fluffy_Pillow 95.5/144: 66% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, static_empowerment(5)
4:11.571 cooldowns c pillar_of_frost Fluffy_Pillow 109.3/144: 76% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
4:11.571 breath Q obliterate Fluffy_Pillow 109.3/144: 76% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
4:12.917 breath O horn_of_winter Fluffy_Pillow 113.3/144: 79% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
4:14.262 breath N howling_blast Fluffy_Pillow 106.3/144: 74% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
4:15.606 breath Q obliterate Fluffy_Pillow 98.3/144: 68% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:16.952 breath N howling_blast Fluffy_Pillow 102.3/144: 71% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:18.296 breath Q obliterate Fluffy_Pillow 88.3/144: 61% runic_power
4.0/6: 67% rune
breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:19.640 breath Q obliterate Fluffy_Pillow 97.3/144: 68% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:20.984 Waiting     2.325 sec 101.3/144: 70% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:23.309 cooldowns Y empower_rune_weapon Fluffy_Pillow 58.3/144: 40% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:23.309 breath Q obliterate Fluffy_Pillow 63.3/144: 44% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:24.480 breath N howling_blast Fluffy_Pillow 67.3/144: 47% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:25.651 Waiting     0.604 sec 59.3/144: 41% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:26.255 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 43.3/144: 30% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:26.356 Waiting     0.424 sec 43.3/144: 30% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5)
4:26.780 breath Q obliterate Fluffy_Pillow 48.3/144: 34% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5)
4:27.952 Waiting     0.301 sec 57.3/144: 40% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:28.253 breath Q obliterate Fluffy_Pillow 41.3/144: 29% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:29.423 breath M remorseless_winter Fluffy_Pillow 50.3/144: 35% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:30.592 Waiting     1.622 sec 49.3/144: 34% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:32.214 breath P obliterate Fluffy_Pillow 22.3/144: 15% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
4:33.383 breath Q obliterate Fluffy_Pillow 31.3/144: 22% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
4:34.554 breath Q obliterate Fluffy_Pillow 35.3/144: 25% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:35.724 breath N howling_blast Fluffy_Pillow 50.3/144: 35% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:36.894 breath P obliterate Fluffy_Pillow 50.4/144: 35% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:38.065 breath N howling_blast Fluffy_Pillow 59.2/144: 41% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:39.237 breath Q obliterate Fluffy_Pillow 43.3/144: 30% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:40.406 breath N howling_blast Fluffy_Pillow 52.1/144: 36% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:41.577 breath Q obliterate Fluffy_Pillow 46.0/144: 32% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:42.747 breath N howling_blast Fluffy_Pillow 54.8/144: 38% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:43.917 breath P obliterate Fluffy_Pillow 61.2/144: 42% runic_power
4.0/6: 67% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:45.262 breath N howling_blast Fluffy_Pillow 54.0/144: 37% runic_power
4.0/6: 67% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:46.607 breath Q obliterate Fluffy_Pillow 54.1/144: 38% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:47.952 breath Q obliterate Fluffy_Pillow 69.1/144: 48% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:49.296 breath M remorseless_winter Fluffy_Pillow 61.9/144: 43% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:50.766 Waiting     1.209 sec 58.3/144: 40% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:51.975 breath P obliterate Fluffy_Pillow 48.5/144: 34% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:53.319 breath N howling_blast Fluffy_Pillow 41.3/144: 29% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:54.663 cooldowns b pillar_of_frost Fluffy_Pillow 41.4/144: 29% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:54.663 Waiting     0.888 sec 41.4/144: 29% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:55.551 breath R death_and_decay Fluffy_Pillow 25.4/144: 18% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:56.896 breath S howling_blast Fluffy_Pillow 21.8/144: 15% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:58.242 single_target j obliterate Fluffy_Pillow 8.4/144: 6% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:59.586 single_target h howling_blast Fluffy_Pillow 33.2/144: 23% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5903 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3463 0 13076 12453 6915
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 261520 249060 0
Runic Power 144 144 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 24.64% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 6198 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +687 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +89 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +386 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets=use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=6915
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 43857 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
43857.2 43857.2 43.6 / 0.099% 7310.7 / 16.7% 2622.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.5 7.7 Runic Power 2.55% 52.0 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 43857
Apocalypse 224 0.5% 7.0 45.49sec 9628 7537 Direct 7.0 8341 16670 9628 15.4%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 1.2774 0.0000 67177.38 67177.38 0.00% 7537.01 7537.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.55% 5.90 1 8 8340.70 6617 11523 8335.08 7279 9321 49207 49207 0.00%
crit 15.45% 1.08 0 6 16670.22 13235 22319 11381.56 0 21955 17971 17971 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=15 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [O]:5.98
  • if_expr:active_enemies<=3&cooldown.dark_transformation.remains
  • target_if_expr:debuff.festering_wound.stack
    opener
    [Z]:1.00
  • if_expr:buff.commander_of_the_dead_window.up
auto_attack_mh 2860 6.5% 148.1 2.44sec 5793 2404 Direct 148.1 5020 10046 5793 15.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.07 148.07 0.00 0.00 0.00 2.4094 0.0000 857778.83 1225429.57 30.00% 2404.47 2404.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.62% 125.29 85 166 5020.05 3791 7013 5019.05 4793 5234 628949 898521 30.00%
crit 15.38% 22.78 7 45 10045.92 7582 13835 10044.18 8863 11006 228830 326908 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Dark Transformation 199 0.5% 7.0 45.61sec 8522 6670 Direct 7.0 7381 14768 8521 15.4%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.00 1.2777 0.0000 59667.93 59667.93 0.00% 6669.79 6669.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.56% 5.92 2 8 7381.04 5823 10309 7374.97 6340 8460 43701 43701 0.00%
crit 15.44% 1.08 0 6 14768.03 11646 19967 10158.78 0 19967 15967 15967 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [M]:5.82
  • if_expr:variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
    cooldowns
    [N]:0.18
  • if_expr:variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
    opener
    [a]:1.00
  • if_expr:debuff.festering_wound.stack>=4
Death Coil 4194 (5435) 9.6% (12.4%) 95.7 3.09sec 16997 14602 Direct 95.7 (227.9) 11376 22754 13121 15.3% (15.3%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.74 95.70 0.00 0.00 0.00 1.1641 0.0000 1255591.84 1255591.84 0.00% 14601.51 14601.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.66% 81.02 55 108 11375.67 7356 18286 11384.30 10731 12066 921674 921674 0.00%
crit 15.34% 14.68 2 29 22754.08 14712 36052 22774.54 18826 28520 333918 333918 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    generic
    [T]:93.61
  • if_expr:!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
    opener
    [Y]:2.13
  • if_expr:pet.gargoyle.active&!prev_gcd.1.death_coil
    Coil of Devastation 1241 2.8% 0.0 0.00sec 0 0 Periodic 132.2 2811 0 2811 0.0% 88.1%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 132.19 132.19 81.04 0.0000 2.0000 371629.89 371629.89 0.00% 1405.71 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 132.19 100 165 2811.42 1103 12288 2818.19 2424 3392 371630 371630 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 700 1.6% 5.5 46.83sec 38524 0 Direct 5.5 33373 66746 38550 15.5%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.47 5.46 0.00 0.00 0.00 0.0000 0.0000 210603.30 300869.53 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.48% 4.62 1 6 33373.08 33373 33373 33373.08 33373 33373 154022 220037 30.00%
crit 15.52% 0.85 0 5 66746.15 66746 66746 39972.93 0 66746 56582 80833 17.97%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1168 2.7% 26.2 11.53sec 13408 10914 Direct 26.2 11611 23212 13408 15.5%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.17 26.17 0.00 0.00 0.00 1.2285 0.0000 350856.28 501236.03 30.00% 10914.12 10914.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.51% 22.12 11 34 11611.49 8646 18054 11599.80 10638 12583 256794 366858 30.00%
crit 15.49% 4.05 0 13 23212.11 17293 36107 22901.10 0 32621 94062 134378 29.63%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    generic
    [V]:24.35
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
    opener
    [b]:1.82
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1869 4.3% 104.0 3.51sec 5393 0 Direct 104.0 4675 9344 5393 15.4%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.96 103.96 0.00 0.00 0.00 0.0000 0.0000 560633.69 560633.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.64% 88.00 59 117 4675.48 3287 7872 4676.20 4371 4949 411419 411419 0.00%
crit 15.36% 15.97 3 38 9343.82 6575 15964 9344.95 7879 11655 149215 149215 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 84 0.2% 11.9 26.31sec 2114 1755 Direct 11.9 1836 3674 2114 15.1%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.86 11.86 0.00 0.00 0.00 1.2049 0.0000 25080.05 25080.05 0.00% 1754.59 1754.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.86% 10.07 3 14 1835.64 1259 3096 1835.68 1564 2156 18482 18482 0.00%
crit 15.14% 1.80 0 8 3674.37 2517 6161 3144.79 0 6105 6598 6598 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    default
    [E]:11.86
  • target_if_expr:(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
Scourge Strike 970 (2247) 2.2% (5.1%) 77.2 3.74sec 8736 7608 Direct 77.2 (154.3) 3272 6542 3774 15.3% (15.4%)

Stats Details: Scourge Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.17 77.17 0.00 0.00 0.00 1.1483 0.0000 291206.06 416019.26 30.00% 7607.71 7607.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.65% 65.33 42 89 3271.85 2446 5013 3271.10 3049 3442 213739 305349 30.00%
crit 15.35% 11.84 2 25 6541.76 4892 9880 6539.15 5515 7753 77467 110670 30.00%

Action Details: Scourge Strike

  • id:55090
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:
  • description:An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.

Action Priority List

    generic
    [U]:77.17
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    Scourge Strike (_shadow) 1277 2.9% 0.0 0.00sec 0 0 Direct 77.2 4300 8595 4963 15.4%

Stats Details: Scourge Strike Shadow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 77.17 0.00 0.00 0.00 0.0000 0.0000 382951.02 382951.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.58% 65.27 42 89 4300.47 2777 6902 4302.58 4017 4615 280698 280698 0.00%
crit 15.42% 11.90 2 28 8594.87 5553 13608 8596.99 6813 11411 102253 102253 0.00%

Action Details: Scourge Strike Shadow

  • id:70890
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:70890
  • name:Scourge Strike
  • school:shadow
  • tooltip:
  • description:{$@spelldesc55090=An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.}
Soul Reaper 443 (2575) 1.0% (5.9%) 15.7 6.86sec 49270 39750 Direct 15.7 (31.4) 7355 14697 8486 15.4% (15.4%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.68 15.68 0.00 0.00 0.00 1.2395 0.0000 133084.14 133084.14 0.00% 39750.35 39750.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.59% 13.27 6 20 7355.35 4815 11186 7362.73 6616 8288 97578 97578 0.00%
crit 15.41% 2.42 0 9 14696.77 9899 22054 13536.54 0 21735 35506 35506 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [S]:15.68
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
    Soul Reaper (_execute) 2131 4.9% 15.7 6.86sec 40808 0 Direct 15.7 35332 70744 40809 15.5%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.67 15.67 0.00 0.00 0.00 0.0000 0.0000 639583.21 639583.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.54% 13.25 6 20 35332.05 26079 51688 35363.00 31704 39090 468126 468126 0.00%
crit 15.46% 2.42 0 8 70743.55 52680 101931 65191.42 0 100485 171457 171457 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 212 0.5% 3.7 90.73sec 17324 14935 Direct 3.7 14978 29954 17323 15.7%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.66 3.66 0.00 0.00 0.00 1.1602 0.0000 63487.19 63487.19 0.00% 14934.65 14934.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.34% 3.09 0 4 14978.41 12322 17822 14969.41 0 17822 46295 46295 0.00%
crit 15.66% 0.57 0 4 29954.28 24644 35644 13851.30 0 35644 17192 17192 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [R]:3.66
  • if_expr:variable.st_planning
Unholy Pact 1337 3.1% 123.1 2.63sec 3256 0 Direct 123.1 2822 5651 3256 15.3%

Stats Details: Unholy Pact

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 123.13 123.13 0.00 0.00 0.00 0.0000 0.0000 400971.53 400971.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.65% 104.24 76 136 2822.23 1948 4501 2822.16 2593 3007 294181 294181 0.00%
crit 15.35% 18.90 4 40 5651.24 3896 9002 5649.47 4726 6634 106791 106791 0.00%

Action Details: Unholy Pact

  • id:319236
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:319236
  • name:Unholy Pact
  • school:shadow
  • tooltip:Deals {$s1=0} Shadow damage.
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
Virulent Plague 882 2.0% 11.9 26.31sec 22293 0 Periodic 99.2 2311 4624 2667 15.4% 99.2%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.86 0.00 99.16 99.16 10.86 0.0000 3.0000 264486.69 264486.69 0.00% 889.09 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 84.61% 83.90 56 109 2311.44 1654 4017 2311.60 2202 2442 193940 193940 0.00%
crit 15.39% 15.26 1 33 4624.25 3309 8033 4624.83 3992 5823 70547 70547 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 6007 / 6007
Claw 312 0.7% 37.9 7.86sec 2476 2465 Direct 37.9 2145 4293 2476 15.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.91 37.91 0.00 0.00 0.00 1.0045 0.0000 93872.97 134107.66 30.00% 2465.02 2465.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.60% 32.07 18 46 2145.43 1713 6206 2143.60 1978 2320 68811 98303 30.00%
crit 15.40% 5.84 0 15 4292.56 3425 13156 4278.18 0 5827 25062 35804 29.93%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:37.91
  • if_expr:energy>70
Gnaw 1 0.0% 2.6 90.04sec 85 84 Direct 2.6 73 146 85 15.9%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.58 2.58 0.00 0.00 0.00 1.0045 0.0000 218.26 311.80 30.00% 84.30 84.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.10% 2.17 0 4 73.08 63 91 50.60 0 88 158 226 20.78%
crit 15.90% 0.41 0 4 146.03 125 180 47.82 0 180 60 86 9.83%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.58
main_hand 4309 9.8% 191.8 1.55sec 6723 4332 Direct 191.8 5824 11654 6723 15.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 191.85 191.85 0.00 0.00 0.00 1.5517 0.0000 1289708.31 1842487.42 30.00% 4332.45 4332.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.59% 162.29 108 205 5824.32 1936 13433 5834.53 5221 6484 945214 1350340 30.00%
crit 15.41% 29.56 12 57 11653.67 3871 26501 11673.13 7422 17206 344494 492147 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Monstrous Blow 11 0.0% 1.1 91.09sec 2825 2813 Direct 1.1 2453 4917 2825 15.1%

Stats Details: Monstrous Blow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.13 1.13 0.00 0.00 0.00 1.0045 0.0000 3186.71 4552.55 30.00% 2812.63 2812.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.91% 0.96 0 4 2452.79 2006 3075 760.35 0 2922 2349 3356 9.29%
crit 15.09% 0.17 0 4 4916.78 4012 6151 685.01 0 6151 837 1196 4.18%

Action Details: Monstrous Blow

  • id:91797
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91797
  • name:Monstrous Blow
  • school:physical
  • tooltip:Stunned.
  • description:Strike an enemy with a smashing attack, dealing {$s2=0} Physical damage and stunning for {$d=2 seconds}.

Action Priority List

    default
    [ ]:1.13
Sweeping Claws 1375 3.1% 68.0 4.29sec 6045 6018 Direct 68.0 5244 10479 6045 15.3%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.01 68.01 0.00 0.00 0.00 1.0045 0.0000 411144.32 411144.32 0.00% 6017.92 6017.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.71% 57.61 39 76 5244.40 3796 8401 5246.74 4904 5586 302145 302145 0.00%
crit 15.29% 10.40 1 23 10478.76 7592 16801 10483.55 8385 14209 108999 108999 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:68.01
pet - gargoyle 31102 / 5247
Gargoyle Strike 31102 11.9% 39.8 5.31sec 39105 36064 Direct 39.8 33909 67870 39106 15.3%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.76 39.76 0.00 0.00 0.00 1.0843 0.0000 1554841.66 1554841.66 0.00% 36064.33 36064.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.70% 33.68 23 40 33908.78 6177 70837 33906.15 28289 40179 1141940 1141940 0.00%
crit 15.30% 6.08 0 16 67869.51 12354 137855 67759.93 0 122369 412902 412902 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.

Action Priority List

    default
    [ ]:41.76
pet - risen_skulker 1182 / 1182
Skulker Shot 1182 2.7% 153.8 1.94sec 2304 1185 Direct 153.7 1998 3997 2305 15.4%

Stats Details: Skulker Shot

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.80 153.75 0.00 0.00 0.00 1.9439 0.0000 354380.10 506270.20 30.00% 1185.29 1185.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.64% 130.12 95 166 1997.86 1469 3351 1998.49 1902 2102 259968 371393 30.00%
crit 15.36% 23.62 8 45 3996.61 2937 6610 3998.79 3508 4612 94412 134877 30.00%

Action Details: Skulker Shot

  • id:212423
  • school:physical
  • range:35.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:212423
  • name:Skulker Shot
  • school:physical
  • tooltip:
  • description:A ranged shot that causes Physical damage.

Action Priority List

    default
    [ ]:154.80
pet - magus_of_the_dead 7626 / 3386
Frostbolt 2269 2.3% 34.5 8.53sec 8718 6186 Direct 34.4 7554 15098 8720 15.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.46 34.45 0.00 0.00 0.00 1.4094 0.0000 300397.75 300397.75 0.00% 6185.73 6185.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.54% 29.12 18 39 7554.18 3824 11817 7555.05 6716 8285 220004 220004 0.00%
crit 15.46% 5.32 0 16 15098.16 7648 23633 15045.70 0 22973 80393 80393 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:18.44
    default
    [ ]:19.85
Shadow Bolt 5357 5.4% 82.3 3.51sec 8612 6639 Direct 82.2 7468 14932 8613 15.4%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.25 82.23 0.00 0.00 0.00 1.2971 0.0000 708311.93 708311.93 0.00% 6639.10 6639.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.65% 69.61 50 85 7467.52 3658 11424 7467.65 6679 8044 519823 519823 0.00%
crit 15.35% 12.62 3 28 14932.06 7316 22226 14934.04 11561 18952 188489 188489 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:42.23
    default
    [ ]:45.17
pet - army_ghoul 24473 / 5530
Claw 4009 2.0% 212.0 1.02sec 1266 1266 Direct 212.0 1097 2193 1266 15.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 212.00 212.00 0.00 0.00 0.00 1.0000 0.0000 268324.00 383329.77 30.00% 1265.70 1265.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.62% 179.40 146 200 1097.15 525 1586 1096.57 923 1193 196827 281189 30.00%
crit 15.38% 32.60 14 54 2193.45 1050 3129 2192.35 1675 2518 71497 102141 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:26.42
    default
    [ ]:26.47
    default
    [ ]:26.46
    default
    [ ]:26.52
    default
    [ ]:26.53
    default
    [ ]:26.51
    default
    [ ]:26.56
    default
    [ ]:26.53
main_hand 20464 10.5% 347.5 0.62sec 3942 3484 Direct 347.5 3417 6835 3942 15.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 347.46 347.46 0.00 0.00 0.00 1.1313 0.0000 1369558.97 1956562.71 30.00% 3484.01 3484.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.64% 294.09 236 320 3416.57 1571 4746 3414.59 2843 3679 1004759 1435406 30.00%
crit 15.36% 53.38 30 81 6834.55 3142 9364 6829.81 5469 7568 364800 521156 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - apoc_ghoul 7934 / 2712
Claw 1695 1.3% 153.1 1.83sec 1134 1134 Direct 153.1 983 1966 1134 15.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.09 153.09 0.00 0.00 0.00 1.0000 0.0000 173568.49 247961.30 30.00% 1133.80 1133.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.66% 129.60 86 170 982.92 568 1521 983.29 868 1067 127383 181980 30.00%
crit 15.34% 23.49 7 46 1966.24 1171 2999 1967.24 1660 2280 46186 65981 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:37.94
    default
    [ ]:38.48
    default
    [ ]:38.58
    default
    [ ]:38.08
main_hand 6239 4.9% 182.0 1.53sec 3509 2542 Direct 182.0 3043 6085 3509 15.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 182.03 182.03 0.00 0.00 0.00 1.3808 0.0000 638804.19 912600.68 30.00% 2541.60 2541.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.66% 154.11 95 202 3042.64 1701 4488 3044.72 2701 3328 468894 669865 30.00%
crit 15.34% 27.92 7 51 6084.95 3506 8976 6089.05 5041 7130 169910 242735 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Army of the Dead 2.0 0.00sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 1.1678 0.5000 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    default
    [D]:2.00
  • if_expr:talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 182.73sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [c]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 166.18sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.41 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [P]:2.41
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 306.44sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [L]:0.46
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
    opener
    [X]:1.00
  • if_expr:pet.gargoyle.active|!talent.summon_gargoyle&pet.army_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Algeth'ar Puzzle (solved_the_puzzle) 2.0 182.76sec

Stats Details: Solved The Puzzle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Solved The Puzzle

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
Summon Gargoyle 2.0 185.74sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [Q]:1.00
  • if_expr:buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
    opener
    [W]:1.00
  • if_expr:buff.commander_of_the_dead_window.up
Unholy Strength 21.4 13.68sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 2.0 182.8sec 60.9sec 20.0sec 13.51% 0.00% 2.0 (2.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3273.11
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3273.11

Trigger Details

  • interval_min/max:181.2s / 233.0s
  • trigger_min/max:0.0s / 233.0s
  • trigger_pct:100.00%
  • duration_min/max:12.8s / 20.0s

Stack Uptimes

  • algethar_puzzle_1:13.51%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.8sec 182.8sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 233.0s
  • trigger_min/max:180.0s / 233.0s
  • trigger_pct:100.00%
  • duration_min/max:8.7s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
commander_of_the_dead_window 7.0 0.0 45.6sec 45.6sec 4.0sec 9.30% 44.46% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead_window
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 51.4s
  • trigger_min/max:45.0s / 51.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s

Stack Uptimes

  • commander_of_the_dead_window_1:9.30%
Dark Transformation 7.0 0.0 45.6sec 45.6sec 22.1sec 51.68% 58.12% 0.0 (0.0) 6.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 51.4s
  • trigger_min/max:45.0s / 51.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.0s

Stack Uptimes

  • dark_transformation_1:51.68%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.5sec 120.5sec 0.7sec 0.64% 0.00% 5.5 (5.5) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.71
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 124.9s
  • trigger_min/max:120.0s / 124.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.7s

Stack Uptimes

  • dragon_games_equipment_1:0.64%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.4sec 306.4sec 27.3sec 13.03% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.8s
  • trigger_min/max:300.0s / 326.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.03%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 166.3sec 166.3sec 19.3sec 15.47% 0.00% 7.0 (7.0) 2.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 232.1s
  • trigger_min/max:120.0s / 232.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.47%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Festermight 13.3 70.9 23.1sec 3.5sec 19.3sec 85.33% 0.00% 0.0 (0.0) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 45.1s
  • trigger_min/max:0.8s / 25.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:8.83%
  • festermight_2:9.47%
  • festermight_3:10.41%
  • festermight_4:15.57%
  • festermight_5:9.93%
  • festermight_6:8.28%
  • festermight_7:6.90%
  • festermight_8:5.71%
  • festermight_9:4.09%
  • festermight_10:2.90%
  • festermight_11:1.73%
  • festermight_12:0.96%
  • festermight_13:0.42%
  • festermight_14:0.11%
  • festermight_15:0.01%
  • festermight_16:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 8.1 87.6 38.8sec 3.1sec 34.4sec 93.14% 75.49% 72.8 (72.8) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 188.8s
  • trigger_min/max:0.8s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 186.4s

Stack Uptimes

  • icy_talons_1:6.56%
  • icy_talons_2:7.01%
  • icy_talons_3:79.57%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 11.9 8.0 25.0sec 14.5sec 10.6sec 42.15% 0.00% 8.0 (8.0) 11.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 159.9s
  • trigger_min/max:0.8s / 159.9s
  • trigger_pct:14.98%
  • duration_min/max:0.0s / 68.7s

Stack Uptimes

  • rune_mastery_1:42.15%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 40.8 5.2 7.2sec 6.4sec 2.6sec 35.19% 0.00% 5.2 (5.2) 40.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 79.5s
  • trigger_min/max:0.8s / 79.5s
  • trigger_pct:48.03%
  • duration_min/max:0.0s / 17.8s

Stack Uptimes

  • runic_corruption_1:35.19%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 20.4 0.2 14.4sec 14.2sec 1.0sec 7.11% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.4s / 58.8s
  • trigger_min/max:1.4s / 58.8s
  • trigger_pct:14.33%
  • duration_min/max:0.0s / 11.6s

Stack Uptimes

  • sudden_doom_1:7.11%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.7 0.0 90.7sec 90.7sec 19.5sec 23.86% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 94.1s
  • trigger_min/max:90.0s / 94.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • unholy_assault_1:23.86%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Pact 7.0 0.0 45.6sec 45.6sec 14.7sec 34.33% 37.62% 96.1 (96.1) 6.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_pact
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:45.0s / 51.4s
  • trigger_min/max:45.0s / 51.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • unholy_pact_1:34.33%

Spelldata

  • id:319233
  • name:Unholy Pact
  • tooltip:
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 13.0 36.3sec 13.6sec 24.6sec 68.81% 0.00% 13.0 (13.0) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 187.4s
  • trigger_min/max:0.0s / 57.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 164.2s

Stack Uptimes

  • unholy_strength_1:68.81%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.7 0.0 47.6sec 47.6sec 14.7sec 99.95% 99.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 182.4s
  • trigger_min/max:45.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.95%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.7 0.0 46.9sec 46.9sec 14.7sec 99.95% 99.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 185.3s
  • trigger_min/max:45.0s / 185.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.95%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.7 0.0 47.0sec 47.0sec 14.7sec 99.95% 99.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 226.7s
  • trigger_min/max:45.0s / 226.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.95%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.6 0.0 47.7sec 47.7sec 14.7sec 99.95% 99.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 183.0s
  • trigger_min/max:45.0s / 183.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.95%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.7sec 186.7sec 28.6sec 92.68% 97.52% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 231.1s
  • trigger_min/max:180.8s / 231.1s
  • trigger_pct:100.00%
  • duration_min/max:8.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.68%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 186.6sec 186.6sec 28.5sec 92.65% 97.83% 0.0 (0.0) 0.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 231.0s
  • trigger_min/max:180.0s / 231.0s
  • trigger_pct:100.00%
  • duration_min/max:8.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.65%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 186.6sec 186.6sec 28.5sec 92.91% 97.83% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 230.6s
  • trigger_min/max:180.5s / 230.6s
  • trigger_pct:100.00%
  • duration_min/max:8.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.91%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.7sec 186.7sec 28.6sec 92.38% 97.22% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 230.6s
  • trigger_min/max:180.9s / 230.6s
  • trigger_pct:100.00%
  • duration_min/max:8.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.38%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.8sec 186.8sec 28.6sec 92.56% 97.49% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 231.6s
  • trigger_min/max:180.8s / 231.6s
  • trigger_pct:100.00%
  • duration_min/max:8.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.56%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.9sec 186.9sec 28.5sec 91.76% 96.91% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 231.2s
  • trigger_min/max:180.8s / 231.2s
  • trigger_pct:100.00%
  • duration_min/max:8.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.76%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.9sec 186.9sec 28.4sec 91.83% 97.18% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 231.7s
  • trigger_min/max:180.5s / 231.7s
  • trigger_pct:100.00%
  • duration_min/max:8.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.83%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 187.0sec 187.0sec 28.4sec 91.56% 97.20% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 232.2s
  • trigger_min/max:180.0s / 232.2s
  • trigger_pct:100.00%
  • duration_min/max:8.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.56%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Commander of the Dead 2.0 0.0 185.8sec 185.8sec 25.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:182.5s / 236.2s
  • trigger_min/max:182.5s / 236.2s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 25.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 187.3sec 187.3sec 23.2sec 92.95% 99.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.5s / 237.9s
  • trigger_min/max:181.5s / 237.9s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 25.0s

Stack Uptimes

  • dark_empowerment_1:92.95%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.3 0.0 68.2sec 68.2sec 17.3sec 97.42% 97.76% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:42.3s / 231.2s
  • trigger_min/max:42.3s / 231.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.42%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.6 0.0 63.7sec 63.7sec 17.4sec 97.07% 97.46% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:42.5s / 229.2s
  • trigger_min/max:42.5s / 229.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.07%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 24.7 8.0 49.0 11.8s 1.4s 160.0s
delayed_aa_cast 2.0 2.0 2.0 182.5s 181.0s 232.4s
Rune ready 155.3 115.0 197.0 2.0s 0.0s 12.8s
Runic Corruption from Runic Power Spent 46.0 24.0 68.0 6.4s 0.8s 79.5s
Festering Wound from Festering Strike 65.4 42.0 93.0 11.5s 1.0s 73.9s
Festering Wound from Infected Claws 31.8 12.0 53.0 9.3s 1.0s 128.8s
Festering Wound from Unholy Assault 14.7 12.0 16.0 90.7s 90.0s 94.1s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 4.16% 0.00% 18.06% 2.4s 0.0s 26.4s
ghoul - Energy Cap 0.40% 0.17% 1.38% 0.2s 0.0s 1.0s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=301286)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1002.072 / 1.1548.08729.734
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
42.71962.82383.230 / 82.651105.869139.491

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Army of the Dead5.7980.00142.1305.5680.00042.130
Dark Transformation0.6210.0016.3513.6550.86510.196
Apocalypse0.5050.0016.6962.9550.1489.310
Empower Rune Weapon46.8590.001112.14465.45857.449112.144
Summon Gargoyle5.7982.45156.2225.7992.45156.222
Unholy Assault0.7940.0014.1241.9350.0008.002
Soul Reaper0.9230.00112.58012.6104.88725.821

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
ApocalypseRune13.9613.928.96%1.000.030.25%
Empower Rune WeaponRunic Power11.5853.832.32%4.654.067.02%
Empower Rune WeaponRune11.5810.967.05%0.950.625.38%
Festering WoundRunic Power103.96299.0612.89%2.8812.844.12%
Rune RegenerationRune130.47130.4783.99%1.000.000.00%
Runic AttenuationRunic Power73.65352.3615.19%4.7815.874.31%
Army of the DeadRunic Power2.0019.740.85%9.870.261.30%
Festering StrikeRunic Power26.17502.6621.67%19.2120.693.95%
OutbreakRunic Power11.86114.264.93%9.634.393.70%
Scourge StrikeRunic Power77.17749.9932.33%9.7221.702.81%
Soul ReaperRunic Power15.68145.336.26%9.2711.497.33%
Summon GargoyleRunic Power2.0082.683.56%41.3417.3217.32%
pet - ghoul
Dark TransformationEnergy7.00362.228.68%51.73337.9748.27%
energy_regenEnergy1333.953809.4591.32%2.8654.641.41%
pet - army_ghoul
energy_regenEnergy892.626997.31100.00%7.841078.7113.36%
pet - apoc_ghoul
energy_regenEnergy466.693789.59100.00%8.121694.9130.90%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.001.000.00
Death CoilRunic Power 95.742263.0423.6423.64719.04
Festering StrikeRune 26.1752.342.002.006703.92
OutbreakRune 11.8611.861.001.002113.94
Scourge StrikeRune 77.1777.171.001.008736.14
Soul ReaperRune 15.6815.681.001.0049269.58
pet - ghoul
ClawEnergy 37.911516.4740.0040.0061.90
Sweeping ClawsEnergy 68.012720.5940.0040.00151.12
pet - army_ghoul
ClawEnergy 212.008479.8740.0040.0031.64
pet - apoc_ghoul
ClawEnergy 153.096123.5040.0040.0028.34
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 7.73 7.54 108.6 56.9 0.0 100.0
Rune 6.0 0.52 0.53 0.0 2.3 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 43857.23
Minimum 37803.82
Maximum 50327.39
Spread ( max - min ) 12523.58
Range [ ( max - min ) / 2 * 100% ] 14.28%
Standard Deviation 1925.7551
5th Percentile 41054.75
95th Percentile 47401.36
( 95th Percentile - 5th Percentile ) 6346.61
Mean Distribution
Standard Deviation 22.2382
95.00% Confidence Interval ( 43813.64 - 43900.81 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7407
0.1 Scale Factor Error with Delta=300 31659
0.05 Scale Factor Error with Delta=300 126633
0.01 Scale Factor Error with Delta=300 3165817
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 43857.23
Minimum 37803.82
Maximum 50327.39
Spread ( max - min ) 12523.58
Range [ ( max - min ) / 2 * 100% ] 14.28%
Standard Deviation 1925.7551
5th Percentile 41054.75
95th Percentile 47401.36
( 95th Percentile - 5th Percentile ) 6346.61
Mean Distribution
Standard Deviation 22.2382
95.00% Confidence Interval ( 43813.64 - 43900.81 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7407
0.1 Scale Factor Error with Delta=300 31659
0.05 Scale Factor Error with Delta=300 126633
0.01 Scale Factor Error with Delta=300 3165817
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 43857.23
Minimum 37803.82
Maximum 50327.39
Spread ( max - min ) 12523.58
Range [ ( max - min ) / 2 * 100% ] 14.28%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 5934789.03
Minimum 4546084.82
Maximum 7390976.28
Spread ( max - min ) 2844891.47
Range [ ( max - min ) / 2 * 100% ] 23.97%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 fleshcraft
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%45=0)
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%45=0)
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
B 0.00 variable,name=opener_done,op=setif,value=1,value_else=0,condition=active_enemies>=3
Default action list Executed every time the actor is available.
# count action,conditions
C 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
0.00 variable,name=apoc_timing,op=setif,value=8,value_else=4,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<4
Variables
0.00 variable,name=garg_pooling,op=setif,value=(((cooldown.summon_gargoyle.remains+1)%gcd)%((rune+1)*(runic_power+20)))*100,value_else=gcd,condition=cooldown.summon_gargoyle.remains<gcd*2
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(2-talent.infected_claws),condition=talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
0.00 variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4|fight_remains<debuff.festering_wound.stack*gcd)
0.00 variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=pooling_runes,value=talent.soul_reaper&rune<2&target.time_to_pct_35<5&fight_remains>5
0.00 variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion.
D 2.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
Prioritize Army, Outbreak and Maintaining Plaguebringer
E 11.86 outbreak,target_if=(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
0.00 wound_spender,if=cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
F 0.00 call_action_list,name=opener,if=variable.opener_done=0
Call Action Lists
G 0.00 call_action_list,name=cooldowns
H 0.00 call_action_list,name=trinkets
I 0.00 call_action_list,name=racials
J 0.00 run_action_list,name=aoe,if=active_enemies>=4
K 0.00 run_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
L 0.46 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Potion
0.00 vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
Cooldowns
0.00 abomination_limb,if=rune<2&variable.adds_remain
0.00 raise_dead,if=!pet.ghoul.active
M 5.82 dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
N 0.18 dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
O 5.98 apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&cooldown.dark_transformation.remains
0.00 apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
P 2.41 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
Q 1.00 summon_gargoyle,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
0.00 unholy_blight,if=variable.adds_remain|fight_remains<21
0.00 abomination_limb,if=rune<3&variable.st_planning
R 3.66 unholy_assault,if=variable.st_planning
S 15.68 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
0.00 sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd
actions.generic
# count action,conditions
T 93.61 death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
Generic
0.00 any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
U 77.17 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
V 24.35 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.opener
# count action,conditions
W 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up
Opener
X 1.00 potion,if=pet.gargoyle.active|!talent.summon_gargoyle&pet.army_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up
Y 2.13 death_coil,if=pet.gargoyle.active&!prev_gcd.1.death_coil
Z 1.00 apocalypse,if=buff.commander_of_the_dead_window.up
a 1.00 dark_transformation,if=debuff.festering_wound.stack>=4
b 1.82 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 variable,name=opener_done,op=setif,value=1,value_else=0,condition=cooldown.apocalypse.remains|!talent.apocalypse&(cooldown.dark_transformation.remains|cooldown.summon_gargoyle.remains)
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.blood_fury.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
c 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&15>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.fireblood.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
d 2.00 use_item,slot=trinket1,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets
0.00 use_item,slot=trinket2,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
e 2.74 use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

Sample Sequence

01246789ABCDEbbaWXYZYPRdcTTUTUTUUTUTUTTEUTUTTUVTUUTUeUUTVTUTUUTVETVMOTUUUVTTTUTUUVTTUETUUTVTTUUTVTTTVMORTEUUUTTUUUTTVTUTUUVTTUUTETTVTVTTVVMOUUTUTeUTTEUVTTTUTUVTUTUUTUVTVUTDEMOQPRSdcTTTTUSTTUTUUSTUTVTESTUUTSUTVTSUTVSTMOESTUUTSTVTTSUUTVSTTUUESTTUTSeTTVVMORSUUTTTSEUUTUUTUU

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 6 trinket_1_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 7 trinket_2_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 8 trinket_1_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 9 trinket_2_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat A trinket_priority Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat B opener_done Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default C auto_attack Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default D army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
bloodlust, static_empowerment
0:01.019 default E outbreak Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune
bloodlust, static_empowerment(2)
0:02.037 opener b festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
bloodlust, static_empowerment(3)
0:03.057 opener b festering_strike Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
bloodlust, sudden_doom, static_empowerment(4)
0:04.078 opener a dark_transformation Fluffy_Pillow 65.0/100: 65% runic_power
0.0/6: 0% rune
bloodlust, sudden_doom, static_empowerment(5)
0:04.078 opener W summon_gargoyle Fluffy_Pillow 65.0/100: 65% runic_power
0.0/6: 0% rune
bloodlust, dark_transformation, sudden_doom, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:05.099 opener X potion Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune
bloodlust, dark_transformation, sudden_doom, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:05.099 opener Y death_coil Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune
bloodlust, dark_transformation, sudden_doom, unholy_pact, commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.121 opener Z apocalypse Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune
bloodlust, icy_talons, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.141 opener Y death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
bloodlust, icy_talons, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.163 cooldowns P empower_rune_weapon Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune
bloodlust, icy_talons(2), dark_transformation, runic_corruption, unholy_pact, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:08.163 cooldowns R unholy_assault Fluffy_Pillow 80.0/100: 80% runic_power
6.0/6: 100% rune
bloodlust, empower_rune_weapon, icy_talons(2), dark_transformation, runic_corruption, unholy_pact, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:09.051 trinkets d use_item_algethar_puzzle_box Fluffy_Pillow 80.0/100: 80% runic_power
6.0/6: 100% rune
bloodlust, empower_rune_weapon, icy_talons(2), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:10.033 racials c berserking Fluffy_Pillow 80.0/100: 80% runic_power
6.0/6: 100% rune
bloodlust, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.033 generic T death_coil Fluffy_Pillow 80.0/100: 80% runic_power
6.0/6: 100% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.786 generic T death_coil Fluffy_Pillow 50.0/100: 50% runic_power
6.0/6: 100% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.540 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.294 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.048 generic U scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.802 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.556 generic U scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.310 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.064 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.818 generic U scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.571 generic T death_coil Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(9), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.326 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(9), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.080 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.835 generic T death_coil Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.590 default E outbreak Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.345 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.100 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.855 generic U scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.610 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.364 generic T death_coil Fluffy_Pillow 4.0/100: 4% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(12), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.120 generic U scourge_strike Fluffy_Pillow 4.0/100: 4% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(12), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.875 generic V festering_strike Fluffy_Pillow 17.0/100: 17% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.629 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.383 generic U scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.138 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.893 generic T death_coil Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(2), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.911 generic U scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(2), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.930 trinkets e use_item_dragon_games_equipment Fluffy_Pillow 26.0/100: 26% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:30.930 generic U scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(3), dragon_games_equipment, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.952 generic U scourge_strike Fluffy_Pillow 39.0/100: 39% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:32.973 generic T death_coil Fluffy_Pillow 57.0/100: 57% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:33.994 generic V festering_strike Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:35.015 generic T death_coil Fluffy_Pillow 47.0/100: 47% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:36.035 generic U scourge_strike Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, icy_talons(3), dark_transformation, festermight(5), static_empowerment(5)
0:37.056 generic T death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(6), static_empowerment(5)
0:38.076 generic U scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(6), static_empowerment(5)
0:39.097 generic U scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
0:40.118 Waiting     0.907 sec 26.0/100: 26% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(8), static_empowerment(5)
0:41.025 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(8), static_empowerment(5)
0:42.351 generic V festering_strike Fluffy_Pillow 1.0/100: 1% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(8), static_empowerment(5)
0:43.677 Waiting     3.270 sec 21.0/100: 21% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(8), static_empowerment(5)
0:46.947 default E outbreak Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(8), static_empowerment(5)
0:48.271 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
1.0/6: 17% rune
unholy_strength, static_empowerment(5)
0:49.596 generic V festering_strike Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, runic_corruption, static_empowerment(5)
0:50.922 cooldowns M dark_transformation Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons, static_empowerment(5)
0:52.248 cooldowns O apocalypse Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune
icy_talons, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:53.571 generic T death_coil Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune
icy_talons, dark_transformation, sudden_doom, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
0:54.896 generic U scourge_strike Fluffy_Pillow 43.0/100: 43% runic_power
4.0/6: 67% rune
icy_talons(2), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
0:56.220 generic U scourge_strike Fluffy_Pillow 61.0/100: 61% runic_power
3.0/6: 50% rune
icy_talons(2), dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
0:57.547 generic U scourge_strike Fluffy_Pillow 74.0/100: 74% runic_power
3.0/6: 50% rune
icy_talons(2), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
0:58.873 generic V festering_strike Fluffy_Pillow 92.0/100: 92% runic_power
3.0/6: 50% rune
icy_talons(2), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
1:00.197 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
1:01.523 generic T death_coil Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
1:02.849 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), dark_transformation, runic_corruption, unholy_pact, festermight(7), static_empowerment(5)
1:04.175 generic U scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_pact, festermight(7), static_empowerment(5)
1:05.502 generic T death_coil Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_pact, festermight(8), static_empowerment(5)
1:06.828 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(8), static_empowerment(5)
1:08.153 generic U scourge_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
1:09.479 generic V festering_strike Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(10), static_empowerment(5)
1:10.803 generic T death_coil Fluffy_Pillow 74.0/100: 74% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(10), static_empowerment(5)
1:12.129 generic T death_coil Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(10), static_empowerment(5)
1:13.457 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
1:14.783 default E outbreak Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, static_empowerment(5)
1:16.109 generic T death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, static_empowerment(5)
1:17.433 generic U scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
1:18.760 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
1:20.085 generic T death_coil Fluffy_Pillow 43.0/100: 43% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
1:21.411 generic V festering_strike Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
1:22.737 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(3), static_empowerment(5)
1:24.061 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(3), static_empowerment(5)
1:25.389 generic U scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
1:26.714 generic U scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
1:28.040 generic T death_coil Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
1:29.365 generic V festering_strike Fluffy_Pillow 9.0/100: 9% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
1:30.692 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(5), static_empowerment(5)
1:32.017 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
1:33.343 generic T death_coil Fluffy_Pillow 4.0/100: 4% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, sudden_doom, festermight(5), static_empowerment(5)
1:34.670 generic V festering_strike Fluffy_Pillow 4.0/100: 4% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, static_empowerment(5)
1:35.996 cooldowns M dark_transformation Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, static_empowerment(5)
1:37.321 cooldowns O apocalypse Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, sudden_doom, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
1:38.646 cooldowns R unholy_assault Fluffy_Pillow 36.0/100: 36% runic_power
5.0/6: 83% rune
icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
1:39.971 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
6.0/6: 100% rune
dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
1:41.077 default E outbreak Fluffy_Pillow 41.0/100: 41% runic_power
6.0/6: 100% rune
icy_talons, dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), static_empowerment(5)
1:42.184 generic U scourge_strike Fluffy_Pillow 56.0/100: 56% runic_power
5.0/6: 83% rune
icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(4), static_empowerment(5)
1:43.288 generic U scourge_strike Fluffy_Pillow 69.0/100: 69% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(5), static_empowerment(5)
1:44.394 generic U scourge_strike Fluffy_Pillow 87.0/100: 87% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
1:45.501 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
1:46.607 generic T death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
1:47.714 generic U scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
1:48.821 generic U scourge_strike Fluffy_Pillow 58.0/100: 58% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), static_empowerment(5)
1:49.925 generic U scourge_strike Fluffy_Pillow 71.0/100: 71% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), static_empowerment(5)
1:51.028 generic T death_coil Fluffy_Pillow 84.0/100: 84% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(10), static_empowerment(5)
1:52.134 generic T death_coil Fluffy_Pillow 54.0/100: 54% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(10), static_empowerment(5)
1:53.241 generic V festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(10), static_empowerment(5)
1:54.348 generic T death_coil Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(10), static_empowerment(5)
1:55.456 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), static_empowerment(5)
1:56.562 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(11), static_empowerment(5)
1:57.668 generic U scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, static_empowerment(5)
1:58.774 generic U scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
2:00.100 generic V festering_strike Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(2), static_empowerment(5)
2:01.425 generic T death_coil Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(2), static_empowerment(5)
2:02.750 generic T death_coil Fluffy_Pillow 58.0/100: 58% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
2:04.075 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
2:05.401 generic U scourge_strike Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3), static_empowerment(5)
2:06.728 generic T death_coil Fluffy_Pillow 59.0/100: 59% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(4), static_empowerment(5)
2:08.053 default E outbreak Fluffy_Pillow 64.0/100: 64% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:09.380 generic T death_coil Fluffy_Pillow 74.0/100: 74% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:10.705 generic T death_coil Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:12.031 generic V festering_strike Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:13.356 generic T death_coil Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(4), static_empowerment(5)
2:14.683 generic V festering_strike Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(4), static_empowerment(5)
2:16.010 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(4), static_empowerment(5)
2:17.335 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(4), static_empowerment(5)
2:18.660 generic V festering_strike Fluffy_Pillow 4.0/100: 4% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
2:19.987 Waiting     0.402 sec 24.0/100: 24% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
2:20.389 generic V festering_strike Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
2:21.713 cooldowns M dark_transformation Fluffy_Pillow 44.0/100: 44% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), static_empowerment(5)
2:23.039 cooldowns O apocalypse Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
2:24.363 generic U scourge_strike Fluffy_Pillow 61.0/100: 61% runic_power
4.0/6: 67% rune
unholy_strength, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
2:25.689 generic U scourge_strike Fluffy_Pillow 74.0/100: 74% runic_power
3.0/6: 50% rune
unholy_strength, dark_transformation, unholy_pact, festermight(5), commander_of_the_dead_window, static_empowerment(5)
2:27.013 generic T death_coil Fluffy_Pillow 87.0/100: 87% runic_power
2.0/6: 33% rune
unholy_strength, dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
2:28.339 generic U scourge_strike Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
2:29.664 generic T death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
2:30.988 trinkets e use_item_dragon_games_equipment Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
icy_talons(2), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
2:30.988 generic U scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
icy_talons(2), dark_transformation, unholy_pact, festermight(7), dragon_games_equipment, static_empowerment(5)
2:32.315 generic T death_coil Fluffy_Pillow 58.0/100: 58% runic_power
2.0/6: 33% rune
icy_talons(2), dark_transformation, unholy_pact, festermight(8), static_empowerment(5)
2:33.640 generic T death_coil Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(8), static_empowerment(5)
2:34.965 default E outbreak Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(8), static_empowerment(5)
2:36.290 generic U scourge_strike Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), static_empowerment(5)
2:37.615 generic V festering_strike Fluffy_Pillow 61.0/100: 61% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
2:38.941 generic T death_coil Fluffy_Pillow 86.0/100: 86% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(9), static_empowerment(5)
2:40.269 generic T death_coil Fluffy_Pillow 86.0/100: 86% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
2:41.594 generic T death_coil Fluffy_Pillow 56.0/100: 56% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
2:42.919 generic U scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
2:44.244 generic T death_coil Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
2:45.568 generic U scourge_strike Fluffy_Pillow 9.0/100: 9% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
2:46.894 generic V festering_strike Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
2:48.221 generic T death_coil Fluffy_Pillow 47.0/100: 47% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
2:49.546 generic U scourge_strike Fluffy_Pillow 17.0/100: 17% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
2:50.873 generic T death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), static_empowerment(5)
2:52.198 generic U scourge_strike Fluffy_Pillow 5.0/100: 5% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
2:53.525 generic U scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(3), static_empowerment(5)
2:54.851 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(4), static_empowerment(5)
2:56.175 generic U scourge_strike Fluffy_Pillow 1.0/100: 1% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight(4), static_empowerment(5)
2:57.501 generic V festering_strike Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
2:58.827 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:00.153 generic V festering_strike Fluffy_Pillow 9.0/100: 9% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:01.479 Waiting     0.288 sec 29.0/100: 29% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:01.767 generic U scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:03.093 generic T death_coil Fluffy_Pillow 47.0/100: 47% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(6), static_empowerment(5)
3:04.420 default D army_of_the_dead Fluffy_Pillow 17.0/100: 17% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(6), static_empowerment(5)
3:05.748 default E outbreak Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), static_empowerment(5)
3:07.075 cooldowns M dark_transformation Fluffy_Pillow 42.0/100: 42% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), static_empowerment(5)
3:08.400 cooldowns O apocalypse Fluffy_Pillow 47.0/100: 47% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:09.725 cooldowns Q summon_gargoyle Fluffy_Pillow 59.0/100: 59% runic_power
3.0/6: 50% rune
unholy_strength, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:09.725 cooldowns P empower_rune_weapon Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_strength, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:09.725 cooldowns R unholy_assault Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune
unholy_strength, empower_rune_weapon, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:10.878 cooldowns S soul_reaper Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, dark_transformation, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:11.838 trinkets d use_item_algethar_puzzle_box Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune
unholy_strength, empower_rune_weapon, dark_transformation, unholy_assault, unholy_pact, festermight(4), static_empowerment(5)
3:13.115 racials c berserking Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune
unholy_strength, empower_rune_weapon, dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:13.115 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:13.988 generic T death_coil Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, runic_corruption, sudden_doom, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:14.861 generic T death_coil Fluffy_Pillow 80.0/100: 80% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:15.736 generic T death_coil Fluffy_Pillow 50.0/100: 50% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:16.609 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:17.481 cooldowns S soul_reaper Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5)
3:18.354 generic T death_coil Fluffy_Pillow 48.0/100: 48% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5)
3:19.230 generic T death_coil Fluffy_Pillow 48.0/100: 48% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5)
3:20.104 generic U scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5)
3:20.980 generic T death_coil Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5)
3:21.854 generic U scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
4.0/6: 67% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5)
3:22.729 generic U scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(7), algethar_puzzle, static_empowerment(5)
3:23.603 cooldowns S soul_reaper Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), algethar_puzzle, static_empowerment(5)
3:24.477 generic T death_coil Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), algethar_puzzle, static_empowerment(5)
3:25.352 generic U scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), algethar_puzzle, static_empowerment(5)
3:26.313 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), algethar_puzzle, static_empowerment(5)
3:27.274 generic V festering_strike Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(9), algethar_puzzle, static_empowerment(5)
3:28.234 generic T death_coil Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), algethar_puzzle, static_empowerment(5)
3:29.194 default E outbreak Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, algethar_puzzle, static_empowerment(5)
3:30.153 cooldowns S soul_reaper Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, algethar_puzzle, static_empowerment(5)
3:31.477 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, algethar_puzzle, static_empowerment(5)
3:32.801 generic U scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, algethar_puzzle, static_empowerment(5)
3:34.127 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
icy_talons(3), festermight, static_empowerment(5)
3:35.452 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), static_empowerment(5)
3:36.775 cooldowns S soul_reaper Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
3:38.099 generic U scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
3.0/6: 50% rune
icy_talons(3), festermight(2), static_empowerment(5)
3:39.424 generic T death_coil Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(3), static_empowerment(5)
3:40.748 generic V festering_strike Fluffy_Pillow 9.0/100: 9% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(3), static_empowerment(5)
3:42.075 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(3), static_empowerment(5)
3:43.400 cooldowns S soul_reaper Fluffy_Pillow 4.0/100: 4% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(3), static_empowerment(5)
3:44.726 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(3), static_empowerment(5)
3:46.053 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(4), static_empowerment(5)
3:47.378 Waiting     1.525 sec 2.0/100: 2% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
3:48.903 generic V festering_strike Fluffy_Pillow 2.0/100: 2% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
3:50.230 Waiting     0.395 sec 27.0/100: 27% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
3:50.625 cooldowns S soul_reaper Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
3:51.949 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
3:53.276 cooldowns M dark_transformation Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
3:54.603 cooldowns O apocalypse Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:55.927 default E outbreak Fluffy_Pillow 29.0/100: 29% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:57.252 cooldowns S soul_reaper Fluffy_Pillow 39.0/100: 39% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:58.578 generic T death_coil Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune
unholy_strength, dark_transformation, sudden_doom, unholy_pact, festermight(4), static_empowerment(5)
3:59.901 generic U scourge_strike Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(4), static_empowerment(5)
4:01.227 generic U scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
4:02.556 generic T death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
4:03.882 cooldowns S soul_reaper Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
4:05.207 generic T death_coil Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
4:06.535 generic V festering_strike Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(6), static_empowerment(5)
4:07.859 generic T death_coil Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
4:09.184 generic T death_coil Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(6), static_empowerment(5)
4:10.510 cooldowns S soul_reaper Fluffy_Pillow 5.0/100: 5% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(6), static_empowerment(5)
4:11.836 generic U scourge_strike Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(6), static_empowerment(5)
4:13.161 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(7), static_empowerment(5)
4:14.488 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(8), static_empowerment(5)
4:15.812 generic V festering_strike Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
4:17.138 cooldowns S soul_reaper Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), static_empowerment(5)
4:18.464 generic T death_coil Fluffy_Pillow 46.0/100: 46% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), static_empowerment(5)
4:19.789 generic T death_coil Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, sudden_doom, static_empowerment(5)
4:21.115 generic U scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), static_empowerment(5)
4:22.440 generic U scourge_strike Fluffy_Pillow 39.0/100: 39% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, static_empowerment(5)
4:23.766 default E outbreak Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
4:25.092 cooldowns S soul_reaper Fluffy_Pillow 62.0/100: 62% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
4:26.417 generic T death_coil Fluffy_Pillow 77.0/100: 77% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, sudden_doom, festermight(2), static_empowerment(5)
4:27.744 generic T death_coil Fluffy_Pillow 77.0/100: 77% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons, runic_corruption, festermight(2), static_empowerment(5)
4:29.069 generic U scourge_strike Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(2), festermight(2), static_empowerment(5)
4:30.394 generic T death_coil Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), festermight(3), static_empowerment(5)
4:31.720 cooldowns S soul_reaper Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(3), static_empowerment(5)
4:33.046 trinkets e use_item_dragon_games_equipment Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(3), static_empowerment(5)
4:33.046 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(3), dragon_games_equipment, static_empowerment(5)
4:34.372 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(3), static_empowerment(5)
4:35.698 generic V festering_strike Fluffy_Pillow 45.0/100: 45% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
4:37.023 generic V festering_strike Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
4:38.350 cooldowns M dark_transformation Fluffy_Pillow 90.0/100: 90% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
4:39.675 cooldowns O apocalypse Fluffy_Pillow 90.0/100: 90% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(3), commander_of_the_dead_window, static_empowerment(5)
4:40.998 cooldowns R unholy_assault Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune
unholy_strength, dark_transformation, unholy_pact, festermight(7), commander_of_the_dead_window, static_empowerment(5)
4:42.324 cooldowns S soul_reaper Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune
unholy_strength, dark_transformation, unholy_assault, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
4:43.430 generic U scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
dark_transformation, unholy_assault, unholy_pact, static_empowerment(5)
4:44.534 generic U scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
dark_transformation, unholy_assault, unholy_pact, festermight, static_empowerment(5)
4:45.639 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
dark_transformation, unholy_assault, unholy_pact, festermight(2), static_empowerment(5)
4:46.745 generic T death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(2), static_empowerment(5)
4:47.850 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(2), static_empowerment(5)
4:48.955 cooldowns S soul_reaper Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(2), static_empowerment(5)
4:50.061 default E outbreak Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(2), static_empowerment(5)
4:51.168 generic U scourge_strike Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(2), static_empowerment(5)
4:52.274 generic U scourge_strike Fluffy_Pillow 78.0/100: 78% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(3), static_empowerment(5)
4:53.379 generic T death_coil Fluffy_Pillow 91.0/100: 91% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(4), static_empowerment(5)
4:54.484 generic U scourge_strike Fluffy_Pillow 66.0/100: 66% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(4), static_empowerment(5)
4:55.590 generic U scourge_strike Fluffy_Pillow 79.0/100: 79% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), static_empowerment(5)
4:56.696 generic T death_coil Fluffy_Pillow 92.0/100: 92% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(6), static_empowerment(5)
4:57.801 generic U scourge_strike Fluffy_Pillow 62.0/100: 62% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(6), static_empowerment(5)
4:58.906 generic U scourge_strike Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), unholy_assault, festermight(7), static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6227 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3463 0 12965 12348 6827
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 259300 246960 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 15.36% 15.36% 1504
Haste 13.49% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6538 5922 0
Mastery 44.26% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +687 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +687 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/fleshcraft
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=opener_done,op=setif,value=1,value_else=0,condition=active_enemies>=3

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
# Variables
actions+=/variable,name=apoc_timing,op=setif,value=8,value_else=4,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<4
actions+=/variable,name=garg_pooling,op=setif,value=(((cooldown.summon_gargoyle.remains+1)%gcd)%((rune+1)*(runic_power+20)))*100,value_else=gcd,condition=cooldown.summon_gargoyle.remains<gcd*2
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(2-talent.infected_claws),condition=talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
actions+=/variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4|fight_remains<debuff.festering_wound.stack*gcd)
actions+=/variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=pooling_runes,value=talent.soul_reaper&rune<2&target.time_to_pct_35<5&fight_remains>5
actions+=/variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
# Prioritize Army, Outbreak and Maintaining Plaguebringer
actions+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
actions+=/outbreak,target_if=(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
actions+=/wound_spender,if=cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
# Call Action Lists
actions+=/call_action_list,name=opener,if=variable.opener_done=0
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=aoe,if=active_enemies>=4
actions+=/run_action_list,name=generic,if=active_enemies<=3

# AoE Action List
actions.aoe=any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(talent.festermight&buff.festermight.remains<3|!talent.festermight)&(death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets=8|!talent.bursting_sores&!talent.vile_contagion|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5|(cooldown.vile_contagion.remains|!talent.vile_contagion)&buff.dark_transformation.up&talent.infected_claws&(buff.empower_rune_weapon.up|buff.unholy_assault.up))|fight_remains<10
actions.aoe+=/epidemic,if=!talent.bursting_sores&!variable.pooling_runic_power&active_enemies>=6
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!death_and_decay.ticking&debuff.festering_wound.stack<4&(cooldown.vile_contagion.remains<5|cooldown.apocalypse.ready&cooldown.any_dnd.remains)
actions.aoe+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!death_and_decay.ticking&(cooldown.vile_contagion.remains>5|!talent.vile_contagion)
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=death_and_decay.ticking
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe+=/epidemic,if=!variable.pooling_runic_power
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=cooldown.death_and_decay.remains>10

# Potion
actions.cooldowns=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
# Cooldowns
actions.cooldowns+=/vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.cooldowns+=/abomination_limb,if=rune<2&variable.adds_remain
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
actions.cooldowns+=/dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&cooldown.dark_transformation.remains
actions.cooldowns+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&(!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0)
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
actions.cooldowns+=/summon_gargoyle,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
actions.cooldowns+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
actions.cooldowns+=/unholy_blight,if=variable.adds_remain|fight_remains<21
actions.cooldowns+=/abomination_limb,if=rune<3&variable.st_planning
actions.cooldowns+=/unholy_assault,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.cooldowns+=/sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# Generic
actions.generic=death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
actions.generic+=/any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Opener
actions.opener=summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up
actions.opener+=/potion,if=pet.gargoyle.active|!talent.summon_gargoyle&pet.army_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up
actions.opener+=/death_coil,if=pet.gargoyle.active&!prev_gcd.1.death_coil
actions.opener+=/apocalypse,if=buff.commander_of_the_dead_window.up
actions.opener+=/dark_transformation,if=debuff.festering_wound.stack>=4
actions.opener+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.opener+=/variable,name=opener_done,op=setif,value=1,value_else=0,condition=cooldown.apocalypse.remains|!talent.apocalypse&(cooldown.dark_transformation.remains|cooldown.summon_gargoyle.remains)

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.blood_fury.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&15>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.fireblood.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,slot=trinket1,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=6827
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 41550 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41549.6 41549.6 33.1 / 0.080% 5739.6 / 13.8% 147.9
APS APS Error APS Range APR
513.9 2.0 / 0.396% 251.2 / 48.9% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
223.5 222.2 Mana 0.00% 45.3 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIk04ABAAAAAAAAAAAAQikkSESRLJRSJhEBpRSSiECSQIFpFSCA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 41550
Devouring Plague 9224 22.2% 50.7 5.90sec 54534 49213 Direct 50.7 19173 40989 23354 19.2%
Periodic 128.6 10369 21166 12302 17.9% 85.3%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.73 50.73 128.57 128.57 29.76 1.1081 1.9903 2766536.39 2766536.39 0.00% 8863.89 49213.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 41.01 23 60 19172.61 15379 30235 19162.67 17628 21388 786199 786199 0.00%
crit 19.17% 9.72 1 22 40989.23 30759 60469 41023.67 32111 53395 398563 398563 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.09% 105.55 70 144 10368.85 65 34810 10365.58 8901 12172 1094424 1094424 0.00%
crit 17.91% 23.02 7 42 21166.16 131 61263 21166.47 15068 28937 487350 487350 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.701215
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.75

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.582811
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 70.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [N]:50.73
  • if_expr:(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
Halo 0 (440) 0.0% (1.1%) 4.9 62.48sec 26636 24458

Stats Details: Halo

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.94 0.00 0.00 0.00 0.00 1.0892 0.0000 0.00 0.00 0.00% 24457.69 24457.69

Action Details: Halo

  • id:120644
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Shadow damage to enemies. Healing reduced beyond {$s1=6} targets.

Action Priority List

    main
    [V]:4.96
  • if_expr:raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
    Halo (_damage) 440 1.1% 4.9 62.48sec 26636 0 Direct 4.9 22007 47793 26776 18.5%

Stats Details: Halo Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.94 4.92 0.00 0.00 0.00 0.0000 0.0000 131704.66 131704.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.50% 4.01 0 7 22007.26 16818 35529 22015.77 0 35529 88228 88228 0.00%
crit 18.50% 0.91 0 5 47793.04 33636 71058 30297.96 0 71058 43476 43476 0.00%

Action Details: Halo Damage

  • id:390964
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.442000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390964
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Idol of C'Thun 0 (3224) 0.0% (7.8%) 0.0 0.00sec 0 0

Stats Details: Idol Of Cthun

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Idol Of Cthun

  • id:377349
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377349
  • name:Idol of C'Thun
  • school:physical
  • tooltip:
  • description:Mind Flay and Mind Sear have a chance to spawn a Void Tendril or Void Lasher that channels at your target for {$377355d=15 seconds}, generating {$s1=3} insanity every {$193473t1=1} sec.
    Mind Flay (void_tendril) 7307  / 3224 7.8% 22.1 12.60sec 43828 5854 Periodic 165.3 5010 10163 5854 16.4% 55.1%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.08 0.00 165.29 165.29 0.00 7.4875 1.0000 967544.41 967544.41 0.00% 5853.55 5853.55
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.63% 138.24 39 288 5010.11 4028 6701 5008.14 4708 5537 692577 692577 0.00%
crit 16.37% 27.06 5 65 10162.56 8705 13402 10151.42 9234 11686 274968 274968 0.00%

Action Details: Mind Flay

  • id:193473
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:1667.76
  • base_td_mult:1.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:{$?=}{$=}w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=30}%.

Action Priority List

    default
    [ ]:3.23
Mind Blast 4040 9.7% 62.9 4.77sec 19257 17424 Direct 62.9 15776 34570 19257 18.5%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.89 62.89 0.00 0.00 0.00 1.1052 0.0000 1211091.90 1211091.90 0.00% 17424.03 17424.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.48% 51.24 30 74 15775.68 10050 27600 15772.31 14099 17591 808375 808375 0.00%
crit 18.52% 11.65 1 25 34569.81 20100 55200 34599.88 21599 47781 402717 402717 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.{$?s137033=true}[ |cFFFFFFFFGenerates {$/100;s2=0} Insanity|r][]{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [M]:5.11
  • if_expr:(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
    main
    [Q]:56.74
  • if_expr:variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
    main
    [T]:1.22
  • if_expr:raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
Mind Flay 591 1.4% 6.8 39.02sec 25983 7735 Periodic 40.7 3752 7704 4355 15.2% 7.5%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.82 0.00 40.70 40.70 0.00 3.3594 0.5555 177241.51 177241.51 0.00% 7734.74 7734.74
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 84.75% 34.49 0 75 3752.27 3020 5614 3754.00 0 5234 129432 129432 0.00%
crit 15.25% 6.21 0 23 7704.04 6040 11229 7619.76 0 10818 47810 47810 0.00%

Action Details: Mind Flay

  • id:15407
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:2.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.235400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.50
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=4.500 seconds} and slowing their movement speed by {$s2=50}%. |cFFFFFFFFGenerates {$=}{{$s4=6}*{$s3=200}/100} Insanity over the duration.|r

Action Priority List

    main
    [U]:40.49
  • if_expr:buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
    main
    [X]:6.82
  • interrupt_if_expr:ticks>=2
Mind Flay: Insanity 5532 13.3% 40.5 7.30sec 40982 18680 Periodic 161.3 8693 17775 10290 17.6% 29.6%

Stats Details: Mind Flay Insanity

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.49 0.00 161.26 161.26 0.00 2.1939 0.5508 1659334.94 1659334.94 0.00% 18679.89 18679.89
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.42% 132.92 83 190 8693.18 6644 12351 8691.08 8259 9283 1155477 1155477 0.00%
crit 17.58% 28.35 9 57 17775.19 13288 24703 17773.06 16224 20197 503858 503858 0.00%

Action Details: Mind Flay Insanity

  • id:391403
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.517880
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:391403
  • name:Mind Flay: Insanity
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=70}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r
Mind Spike 857 2.1% 10.2 25.09sec 25181 23038 Direct 10.2 21206 45858 25182 16.1%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.19 10.19 0.00 0.00 0.00 1.0930 0.0000 256523.34 256523.34 0.00% 23037.57 23037.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.88% 8.54 0 23 21206.47 15395 42280 21296.38 0 37692 181203 181203 0.00%
crit 16.12% 1.64 0 8 45858.27 30791 84559 36543.91 0 84559 75320 75320 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.440000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage.{$?s391090=false}[ Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times.][] |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity|r{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [W]:10.19
  • if_expr:buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
Mindgames 1385 3.3% 7.8 40.39sec 53520 48213 Direct 7.8 (7.8) 43499 95533 53520 19.3% (19.3%)

Stats Details: Mindgames

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.75 7.75 0.00 0.00 0.00 1.1102 0.0000 415016.03 415016.03 0.00% 48212.83 48212.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 6.26 2 10 43499.48 32802 69296 43431.62 35248 59482 272350 272350 0.00%
crit 19.26% 1.49 0 6 95533.27 65605 138592 78081.21 0 138592 142666 142666 0.00%

Action Details: Mindgames

  • id:375901
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:375901
  • name:Mindgames
  • school:shadow
  • tooltip:The next {$=}w2 damage and {$=}w5 healing dealt will be reversed.
  • description:Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target.

Action Priority List

    main
    [R]:7.78
  • if_expr:spell_targets.mind_sear<5&variable.all_dots_up
Shadow Crash 0 (1191) 0.0% (2.9%) 8.6 32.91sec 41439 36551

Stats Details: Shadow Crash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.62 0.00 0.00 0.00 0.00 1.1337 0.0000 0.00 0.00 0.00% 36551.04 36551.04

Action Details: Shadow Crash

  • id:205385
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:15.0

Spelldata

  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r

Action Priority List

    main
    [S]:8.62
  • if_expr:raid_event.adds.in>10
    Shadow Crash (_damage) 1191 2.9% 9.6 32.84sec 37285 0 Direct 9.6 30824 65797 37284 18.5%

Stats Details: Shadow Crash Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 9.58 0.00 0.00 0.00 0.0000 0.0000 357359.47 357359.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.52% 7.81 3 12 30823.59 20814 49353 30734.79 24723 37870 240847 240847 0.00%
crit 18.48% 1.77 0 8 65796.63 41627 98706 56581.82 0 98706 116513 116513 0.00%

Action Details: Shadow Crash Damage

  • id:205386
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.103750
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadow Weaving 660 1.6% 131.3 2.23sec 1505 0 Direct 130.3 1516 0 1516 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.33 130.33 0.00 0.00 0.00 0.0000 0.0000 197604.37 197604.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 130.33 93 161 1516.15 353 4883 1516.91 1256 2030 197604 197604 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2371.42
  • base_dd_max:2371.42
  • base_dd_mult:1.00

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}
Shadow Word: Death 1242 3.0% 12.7 24.37sec 29176 25906 Direct 12.7 24259 50253 29176 18.9%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 0.00 0.00 0.00 1.1263 0.0000 371848.13 371848.13 0.00% 25905.54 25905.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.08% 10.33 4 17 24258.57 10905 54837 24225.73 15936 35663 250675 250675 0.00%
crit 18.92% 2.41 0 8 50253.37 21810 109674 46732.99 0 109674 121173 121173 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target. {$?=}A364675[Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]

Action Priority List

    main
    [L]:3.74
  • if_expr:pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
    main
    [O]:9.00
  • target_if_expr:(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
Shadow Word: Pain 2210 5.3% 9.6 32.84sec 69128 0 Periodic 201.4 2774 5676 3291 17.8% 99.2%

Stats Details: Shadow Word Pain

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.59 0.00 201.37 201.37 210.55 0.0000 1.4785 662629.42 662629.42 0.00% 2225.71 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.21% 165.55 118 213 2774.40 424 3962 2773.74 2652 2928 459289 459289 0.00%
crit 17.79% 35.82 14 63 5676.49 1032 7924 5676.34 5201 6271 203340 203340 0.00%

Action Details: Shadow Word Pain

  • id:589
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:3.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.095880
  • base_td:0.00
  • base_td_mult:1.73
  • dot_duration:21.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=2} sec.
  • description:A word of darkness that causes {$?a390707=false}[{$=}{{$s1=0}*(1+{$390707s1=15}/100)}][{$s1=0}] Shadow damage instantly, and an additional {$?a390707=false}[{$=}{{$=}o2*(1+{$390707s1=15}/100)}][{$=}o2] Shadow damage over {$d=16 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m3=300}/100} Insanity.|r][]
Shadowy Apparitions 0 (1215) 0.0% (2.9%) 113.6 2.63sec 3209 0

Stats Details: Shadowy Apparitions

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowy Apparitions

  • id:341491
  • school:physical
  • range:0.0
  • travel_speed:6.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:341491
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:Mind Blast, Devouring Plague, and Void Bolt have a {$s4=100}% chance to conjure Shadowy Apparitions and Mind Sear has a {$s3=50}% chance to conjure Shadowy Apparitions. Shadowy Apparitions float towards all targets afflicted by your Vampiric Touch for {$148859s1=0} Shadow damage. Critical strikes with Mind Blast, Devouring Plague, and Void Bolt increase the damage of the Shadowy Apparitions they conjure by {$s2=100}%.
    Shadowy Apparition 1215 2.9% 111.9 2.63sec 3259 0 Direct 110.1 3312 0 3312 0.0%

Stats Details: Shadowy Apparition

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 111.85 110.07 0.00 0.00 0.00 0.0000 0.0000 364571.35 364571.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 110.07 78 145 3312.10 2508 5299 3310.74 3131 3548 364571 364571 0.00%

Action Details: Shadowy Apparition

  • id:148859
  • school:shadow
  • range:100.0
  • travel_speed:6.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Spelldata

  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals $148859sw1 Shadow damage.}
Soulseeker Arrow 1150 2.8% 7.3 36.94sec 47002 0 Periodic 87.2 3958 0 3958 0.0% 39.2%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.34 0.00 87.16 87.16 2.53 0.0000 1.3481 345012.53 345012.53 0.00% 2936.03 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 87.16 15 178 3958.15 28 4452 3955.82 3844 4237 345013 345013 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3665.83
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1747}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 3342 8.0% 9.6 32.84sec 104549 1002161488 Periodic 167.1 5062 10355 5998 17.7% 99.2%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.59 0.00 167.07 167.07 210.55 0.0001 1.7804 1002161.49 1002161.49 0.00% 3369.03 1002161488.10
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.30% 137.50 96 182 5061.63 155 7225 5060.64 4818 5352 695996 695996 0.00%
crit 17.70% 29.57 9 52 10354.64 4937 14450 10355.92 9563 11448 306165 306165 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.201960
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [P]:0.00
  • target_if_expr:(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
pet - mindbender 11319 / 5247
Inescapable Torment 0 (2830) 0.0% (6.8%) 41.9 7.00sec 20232 0

Stats Details: Inescapable Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.87 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Inescapable Torment

  • id:373427
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:373427
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.
    Inescapable Torment (_damage) 6102 6.8% 41.9 7.00sec 20232 0 Direct 41.9 16155 33994 20232 22.9%

Stats Details: Inescapable Torment Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.87 41.87 0.00 0.00 0.00 0.0000 0.0000 847057.30 847057.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.15% 32.30 15 51 16154.79 10882 24138 16150.08 14202 18724 521787 521787 0.00%
crit 22.85% 9.57 1 22 33993.52 21764 48275 34004.75 26212 43655 325270 325270 0.00%

Action Details: Inescapable Torment Damage

  • id:373442
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.923780
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:373442
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:{$@spelldesc373427=Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.}
melee 5217 5.8% 131.3 2.23sec 5506 5321 Direct 131.3 4470 9088 5506 22.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.33 131.33 0.00 0.00 0.00 1.0348 0.0000 723108.81 723108.81 0.00% 5320.89 5320.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.56% 101.87 66 134 4469.87 3944 6103 4468.48 4224 4854 455331 455331 0.00%
crit 22.44% 29.47 10 51 9087.71 7887 12205 9089.42 8347 10176 267778 267778 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 0
Mental Fortitude 514 100.0% 335.9 0.88sec 458 0 Direct 347.7 442 0 442 0.0%

Stats Details: Mental Fortitude

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 335.95 347.72 0.00 0.00 0.00 0.0000 0.0000 153737.52 7076815.26 97.83% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 347.72 264 434 442.13 0 27823 443.19 218 687 153738 7076815 97.82%

Action Details: Mental Fortitude

  • id:377065
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21610.00
  • base_dd_max:21610.00
  • base_dd_mult:1.00

Spelldata

  • id:377065
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 2.9 123.47sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    default
    [D]:2.94
  • if_expr:buff.power_infusion.up|fight_remains<=15
Dark Ascension 5.3 61.88sec

Stats Details: Dark Ascension

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 0.00 102.74 0.00 0.00 1.1676 1.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Dark Ascension

  • id:391109
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:30.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:391109
  • name:Dark Ascension
  • school:shadow
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r

Action Priority List

    cds
    [G]:5.33
  • if_expr:pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
Desperate Prayer 0.3 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.28 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [J]:0.28
  • if_expr:health.pct<=75
Devouring Plague (_heal) 179.3 1.66sec

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 179.30 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 70.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Halo (_heal) 4.9 62.48sec

Stats Details: Halo Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 4.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Halo Heal

  • id:390971
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.610000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390971
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Mindbender 5.4 60.65sec

Stats Details: Mindbender

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.45 0.00 0.00 0.00 0.00 1.1689 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindbender

  • id:200174
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$=}{{$200010s1=300}/100} Insanity each time the Mindbender attacks.|r

Action Priority List

    cds
    [I]:5.45
  • if_expr:(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
Mindgames (_damage_reversal) 7.8 40.39sec

Stats Details: Mindgames Damage Reversal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 7.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindgames Damage Reversal

  • id:323706
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:323706
  • name:Mindgames
  • school:shadow
  • tooltip:
  • description:{$@spelldesc323673=Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. {$?=}c3[For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing generate up to {$=}{{$323706s2=10}*2} Insanity.|r] ][For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing restore up to {$=}{{$323706s3=2}*2}% mana.|r]}
Elemental Potion of Ultimate Power 1.4 309.47sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.40 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.40
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
Power Infusion 2.9 123.68sec

Stats Details: Power Infusion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Power Infusion

  • id:10060
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.

Action Priority List

    cds
    [F]:2.91
  • if_expr:(buff.voidform.up|buff.dark_ascension.up)
Shadow Crash (_dots) 8.6 32.91sec

Stats Details: Shadow Crash Dots

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.62 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadow Crash Dots

  • id:391286
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:391286
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 2.9 123.68sec

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 167.1 1.78sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 167.07 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2563.10
  • base_dd_max:2563.10
  • base_dd_mult:1.00

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ancient Madness 5.3 0.0 61.9sec 61.9sec 19.4sec 34.29% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_ancient_madness
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.2s / 71.5s
  • trigger_min/max:61.2s / 71.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • ancient_madness_1:1.66%
  • ancient_madness_2:1.67%
  • ancient_madness_3:1.67%
  • ancient_madness_4:1.68%
  • ancient_madness_5:1.68%
  • ancient_madness_6:1.69%
  • ancient_madness_7:1.69%
  • ancient_madness_8:1.70%
  • ancient_madness_9:1.71%
  • ancient_madness_10:1.71%
  • ancient_madness_11:1.72%
  • ancient_madness_12:1.72%
  • ancient_madness_13:1.73%
  • ancient_madness_14:1.74%
  • ancient_madness_15:1.74%
  • ancient_madness_16:1.75%
  • ancient_madness_17:1.75%
  • ancient_madness_18:1.76%
  • ancient_madness_19:1.76%
  • ancient_madness_20:1.77%

Spelldata

  • id:341240
  • name:Ancient Madness
  • tooltip:
  • description:Voidform and Dark Ascension increase your critical strike chance by {$s1=10}% for {$194249d=20 seconds}, reducing by {$=}{{$s3=5}/10}.1% every sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.9 0.0 123.5sec 123.5sec 14.7sec 14.46% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:120.0s / 131.7s
  • trigger_min/max:120.0s / 131.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.46%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Coalescing Shadows 56.2 146.5 5.3sec 1.5sec 3.4sec 63.88% 76.14% 70.7 (70.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 40.9s
  • trigger_min/max:0.0s / 36.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.5s

Stack Uptimes

  • coalescing_shadows_1:22.42%
  • coalescing_shadows_2:14.51%
  • coalescing_shadows_3:26.95%

Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Coalescing Shadows (_dot) 2.2 53.4 124.0sec 5.4sec 136.4sec 97.95% 98.68% 53.4 (53.4) 1.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows_dot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.1s / 354.5s
  • trigger_min/max:0.0s / 39.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.0s

Stack Uptimes

  • coalescing_shadows_dot_1:97.95%

Spelldata

  • id:391244
  • name:Coalescing Shadows
  • tooltip:Your periodic damage is increased by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Ascension 5.3 0.0 61.9sec 61.9sec 19.4sec 34.29% 42.12% 97.8 (97.8) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_ascension
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.2s / 71.5s
  • trigger_min/max:61.2s / 71.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • dark_ascension_1:34.29%

Spelldata

  • id:391109
  • name:Dark Ascension
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Dark Evangelism 1.0 201.0 207.0sec 1.4sec 292.7sec 97.69% 98.13% 197.0 (197.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_evangelism
  • max_stacks:5
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:73.7s / 330.6s
  • trigger_min/max:0.3s / 33.6s
  • trigger_pct:100.00%
  • duration_min/max:4.8s / 353.8s

Stack Uptimes

  • dark_evangelism_1:0.12%
  • dark_evangelism_2:0.12%
  • dark_evangelism_3:0.12%
  • dark_evangelism_4:0.80%
  • dark_evangelism_5:96.52%

Spelldata

  • id:391099
  • name:Dark Evangelism
  • tooltip:Periodic Shadow damage increased by {$=}w1%.
  • description:{$@spelldesc391095=Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391095
  • name:Dark Evangelism
  • tooltip:
  • description:Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Death and Madness (_insanity_gain) 0.4 0.0 0.0sec 0.0sec 0.0sec 0.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_insanity_gain
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s

Stack Uptimes

Spelldata

  • id:321973
  • name:Death and Madness
  • tooltip:{$=}{{$m1=750}/100} Insanity generated every {$t1=1} sec.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_reset) 2.8 0.0 22.4sec 22.4sec 16.9sec 15.51% 0.00% 0.0 (0.0) 1.9

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_reset
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.9s / 39.0s
  • trigger_min/max:20.9s / 39.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • death_and_madness_reset_1:15.51%

Spelldata

  • id:390628
  • name:Death and Madness
  • tooltip:
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:321291
  • name:Death and Madness
  • tooltip:
  • description:If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Desperate Prayer 0.3 0.0 0.0sec 0.0sec 9.2sec 0.87% 0.00% 2.4 (2.4) 0.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • desperate_prayer_1:0.87%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Devoured Pride 1.5 0.0 61.0sec 0.0sec 22.8sec 10.88% 12.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 63.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.0s / 34.0s

Stack Uptimes

  • devoured_pride_1:10.88%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=15}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=15}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 309.5sec 309.5sec 27.3sec 12.52% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:306.1s / 318.7s
  • trigger_min/max:306.1s / 318.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.52%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mental Fortitude 4.5 331.5 82.0sec 0.9sec 63.8sec 95.16% 100.00% 331.5 (331.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.1s / 337.5s
  • trigger_min/max:0.0s / 19.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 326.4s

Stack Uptimes

  • mental_fortitude_1:95.16%

Spelldata

  • id:377065
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Mind Devourer 6.2 0.2 41.8sec 40.6sec 2.1sec 4.24% 11.92% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_devourer
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 331.0s
  • trigger_min/max:0.8s / 331.0s
  • trigger_pct:10.04%
  • duration_min/max:0.0s / 11.2s

Stack Uptimes

  • mind_devourer_1:4.24%

Spelldata

  • id:373204
  • name:Mind Devourer
  • tooltip:Your next Devouring Plague or Mind Sear costs 0 insanity.
  • description:{$@spelldesc373202=Mind Blast has a {$s1=15}% chance to make your next Devouring Plague or Mind Sear cost no insanity.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373202
  • name:Mind Devourer
  • tooltip:
  • description:Mind Blast has a {$s1=15}% chance to make your next Devouring Plague or Mind Sear cost no insanity.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Mind Flay: Insanity 41.0 9.8 7.3sec 5.9sec 3.2sec 44.20% 0.00% 9.8 (9.8) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_flay_insanity
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 34.2s
  • trigger_min/max:0.8s / 23.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 31.7s

Stack Uptimes

  • mind_flay_insanity_1:44.20%

Spelldata

  • id:391401
  • name:Mind Flay: Insanity
  • tooltip:Mind Flay is temporarily empowered.
  • description:{$@spelldesc391399=Devouring Plague transforms your next Mind Flay into Mind Flay: Insanity. Lasts {$391401d=10 seconds}. {$@=}spellicon391403 {$@=}spellname391403 {$@spelldesc391403=Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Infusion 2.9 0.0 123.7sec 123.7sec 19.4sec 18.93% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:122.4s / 131.7s
  • trigger_min/max:122.4s / 131.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • power_infusion_1:18.93%

Spelldata

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 17.3 0.7 16.8sec 16.2sec 1.3sec 7.69% 27.16% 0.7 (0.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:2.40
  • modifier:1.00

Trigger Details

  • interval_min/max:0.9s / 69.7s
  • trigger_min/max:0.9s / 69.7s
  • trigger_pct:8.91%
  • duration_min/max:0.0s / 8.6s

Stack Uptimes

  • shadowy_insight_1:7.69%

Spelldata

  • id:375981
  • name:Shadowy Insight
  • tooltip:Your next Mind Blast is instant cast.
  • description:{$@spelldesc375888=Mind Blast gains an additional charge. Shadow Word: Pain periodic damage has a chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 60.8sec 45.7sec 16.5sec 23.84% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 205.8s
  • trigger_min/max:0.0s / 205.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.9s

Stack Uptimes

  • sophic_devotion_1:23.84%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.7 0.0 156.2sec 156.2sec 19.4sec 4.73% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 252.5s
  • trigger_min/max:122.4s / 252.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:4.73%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.7 0.0 154.3sec 154.3sec 19.5sec 4.77% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 253.9s
  • trigger_min/max:122.4s / 253.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:4.77%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.7 0.0 157.5sec 157.5sec 19.5sec 4.75% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 254.2s
  • trigger_min/max:122.4s / 254.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:4.75%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.7 0.0 155.6sec 155.6sec 19.4sec 4.68% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 252.7s
  • trigger_min/max:122.4s / 252.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:4.68%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Surge of Darkness 12.9 14.7 23.0sec 10.5sec 12.4sec 53.18% 100.00% 3.6 (3.6) 7.5

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_surge_of_darkness
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 148.8s
  • trigger_min/max:0.0s / 110.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 123.4s

Stack Uptimes

  • surge_of_darkness_1:25.79%
  • surge_of_darkness_2:14.48%
  • surge_of_darkness_3:12.91%

Spelldata

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike is instant cast, and deals {$s2=200}% additional damage.
  • description:{$@spelldesc162448=Your Vampiric Touch and Devouring Plague damage has a chance to cause your next Mind Spike to be instant cast and deal {$87160s2=200}% additional damage. Stacks up to {$87160u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Twist of Fate 1.0 205.1 0.0sec 0.5sec 104.4sec 34.79% 32.74% 205.1 (205.1) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 4.8s
  • trigger_pct:100.00%
  • duration_min/max:81.7s / 125.9s

Stack Uptimes

  • twist_of_fate_1:34.79%

Spelldata

  • id:390978
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$=}w1%.
  • description:{$@spelldesc390972=After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390972
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Shadowy Apparition from Devouring Plague 50.7 35.0 69.0 5.9s 0.8s 23.2s
Shadowy Apparition from Mind Blast 62.9 43.0 84.0 4.8s 0.0s 16.1s
Mind Devourer free Devouring Plague proc 6.3 0.0 16.0 40.6s 0.8s 331.0s
Void Tendril proc from Idol of C'Thun 11.3 3.0 24.0 25.0s 0.3s 114.5s
Shadowy Insight procs 17.3 7.0 31.0 16.8s 0.9s 69.7s
Shadowy Insight procs lost to overflow 0.7 0.0 7.0 90.1s 0.9s 318.7s
Coalescing Shadows from Mind Fay 50.4 23.0 87.0 5.8s 0.3s 82.2s
Coalescing Shadows from Shadow Word: Pain 12.1 1.0 28.0 23.0s 0.9s 270.8s
Coalescing Shadows from Shadowy Apparition 8.8 0.0 23.0 29.5s 0.0s 274.9s
Surge of Darkness from Vampiric Touch 13.3 2.0 30.0 21.1s 0.8s 238.1s
Surge of Darkness from Devouring Plague 14.3 2.0 32.0 19.7s 0.0s 212.7s
Mind Flay: Insanity casts that did not channel for full ticks 0.3 0.0 1.0 0.0s 0.0s 0.0s
Idol of Y'Shaarj Devoured Violence procs 4.0 3.0 5.0 60.7s 60.0s 63.4s
Mindgames casts without full Mastery value 0.5 0.0 4.0 103.3s 35.4s 291.2s
Inescapable Torment expired when Mind Blast was ready 3.1 0.0 8.0 95.8s 0.0s 336.4s
Inescapable Torment expired when Shadow Word: Death was ready 0.7 0.0 5.0 160.8s 0.0s 335.8s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 81.12% 71.44% 85.32% 10.4s 0.0s 49.6s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Auspicious SpiritsInsanity110.07109.784.82%1.000.290.27%
Insanity Gained from Idol of C'thun Mind Flay'sInsanity165.28328.5914.44%1.991.980.60%
MindbenderInsanity131.33391.9417.22%2.982.060.52%
Throes of PainInsanity1.004.950.22%4.950.050.95%
Dark AscensionInsanity5.31154.176.77%29.035.163.24%
mana_regenMana834.7366671.47100.00%79.87412662.7586.09%
Mind BlastInsanity62.89375.7016.51%5.971.650.44%
Mind FlayInsanity40.7081.093.56%1.990.310.38%
Mind Flay: InsanityInsanity161.27644.3628.31%4.000.710.11%
Mind SpikeInsanity10.1940.751.79%4.000.000.00%
Shadow CrashInsanity9.62144.366.34%15.000.000.00%
Vampiric TouchInsanity0.000.000.00%4.000.000.00%
Usage Type Count Total Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 50.732230.1443.9643.961240.52
HaloMana 4.9412362.022500.002500.0710.65
MindgamesMana 7.7538772.165000.005000.0410.70
Shadow Word: DeathMana 12.7415931.211250.001250.0123.34
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 216100.0 307.60 299.32 2160196.0 212789.6 44346.0 216100.0
Mana 49999.0 222.24 223.55 412663.7 49605.0 43755.4 49999.0
Insanity 15.0 7.59 7.43 12.2 45.5 5.0 100.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 41549.56
Minimum 36443.96
Maximum 47170.19
Spread ( max - min ) 10726.23
Range [ ( max - min ) / 2 * 100% ] 12.91%
Standard Deviation 1462.4045
5th Percentile 39246.52
95th Percentile 44045.00
( 95th Percentile - 5th Percentile ) 4798.47
Mean Distribution
Standard Deviation 16.8875
95.00% Confidence Interval ( 41516.46 - 41582.66 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4759
0.1 Scale Factor Error with Delta=300 18257
0.05 Scale Factor Error with Delta=300 73027
0.01 Scale Factor Error with Delta=300 1825655
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 41549.56
Minimum 36443.96
Maximum 47170.19
Spread ( max - min ) 10726.23
Range [ ( max - min ) / 2 * 100% ] 12.91%
Standard Deviation 1462.4045
5th Percentile 39246.52
95th Percentile 44045.00
( 95th Percentile - 5th Percentile ) 4798.47
Mean Distribution
Standard Deviation 16.8875
95.00% Confidence Interval ( 41516.46 - 41582.66 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4759
0.1 Scale Factor Error with Delta=300 18257
0.05 Scale Factor Error with Delta=300 73027
0.01 Scale Factor Error with Delta=300 1825655
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 41549.56
Minimum 36443.96
Maximum 47170.19
Spread ( max - min ) 10726.23
Range [ ( max - min ) / 2 * 100% ] 12.91%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 9918635.52
Minimum 7272378.87
Maximum 12282166.39
Spread ( max - min ) 5009787.52
Range [ ( max - min ) / 2 * 100% ] 25.25%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 299.66
Minimum 0.00
Maximum 1087.92
Spread ( max - min ) 1087.92
Range [ ( max - min ) / 2 * 100% ] 181.53%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 307.46
Minimum 0.00
Maximum 1078.42
Spread ( max - min ) 1078.42
Range [ ( max - min ) / 2 * 100% ] 175.37%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 arcane_torrent
7 0.00 use_item,name=shadowed_orb_of_torment
8 0.00 variable,name=mind_sear_cutoff,op=set,value=2
9 0.00 shadow_crash,if=talent.shadow_crash.enabled
A 0.00 mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
B 0.00 vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled
Default action list Executed every time the actor is available.
# count action,conditions
C 1.40 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
0.00 variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
0.00 variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
0.00 variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
0.00 variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
0.00 variable,name=is_vt_possible,op=set,value=0,default=1
0.00 variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
0.00 variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
0.00 variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
D 2.94 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 variable,name=pool_amount,op=set,value=60
E 0.00 run_action_list,name=main
actions.cds
# count action,conditions
F 2.91 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
G 5.33 dark_ascension,if=pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
H 0.00 call_action_list,name=trinkets
I 5.45 mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
J 0.28 desperate_prayer,if=health.pct<=75
actions.main
# count action,conditions
K 0.00 call_action_list,name=cds
0.00 mind_blast,if=cooldown.mind_blast.charges>=2&talent.mind_devourer&spell_targets.mind_sear>=3&spell_targets.mind_sear<=7&!buff.mind_devourer.up
Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
L 3.74 shadow_word_death,if=pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
M 5.11 mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
0.00 damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
0.00 void_bolt,if=variable.dots_up&insanity<=85
0.00 mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
0.00 mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
N 50.73 devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
O 9.00 shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
P 0.00 vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
0.00 shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
Q 56.74 mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
R 7.78 mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
S 8.62 shadow_crash,if=raid_event.adds.in>10
0.00 dark_void,if=raid_event.adds.in>20
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
0.00 void_torrent,if=insanity<=35,target_if=variable.dots_up
T 1.22 mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
0.00 vampiric_touch,if=buff.unfurling_darkness.up
U 40.49 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
V 4.96 halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
0.00 divine_star,if=spell_targets.divine_star>1
Use when it will hit at least 2 targets.
0.00 lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75
W 10.19 mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
X 6.82 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>30
Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain
Use Shadow Word: Pain while moving as a low-priority action
actions.trinkets
# count action,conditions
0.00 use_item,name=scars_of_fraternal_strife,if=(!buff.scars_of_fraternal_strife_4.up&time>1)|(buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10)
0.00 use_item,name=macabre_sheet_music,if=cooldown.void_eruption.remains>10|cooldown.dark_ascension.remains>10
0.00 use_item,name=soulletting_ruby,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10,target_if=min:target.health.pct
0.00 use_item,name=architects_ingenuity_core
Use this on CD for max CDR
Y 2.91 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10
Default fallback for usable items: Use on cooldown in order by trinket slot.

Sample Sequence

012589IMGCFDYNOQQRQUNUQQVWXNQUNQUNNUQWWNUQSQNNQQURNQUWWWNQUQWQQWINGOQNSUQNRUVQNUXQWNUQXQNQSUNUQWXNQRUIOGFDYNQUQVNSQUQNQQUQNNOMQNUWXNQQQNQRQSUNQQQQQUNUIOQGNMQUNQSNQQRNNOQUNNQUVWNQQUWWNQSUWQNURWQILLQGFDYMNQQUNQUVQNQSUNULLNQQQNRUWNQQUXNOOQQSNU

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 5 shadowform Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 8 mind_sear_cutoff Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 9 shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
0:00.000 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
bloodlust, static_empowerment
0:00.940 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
bloodlust, coalescing_shadows, static_empowerment
0:01.881 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
bloodlust, coalescing_shadows_dot, static_empowerment(2)
0:02.821 default C potion Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3)
0:02.821 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.821 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.821 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.821 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(3), elemental_potion_of_ultimate_power
0:03.574 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(4), elemental_potion_of_ultimate_power
0:04.328 main Q mind_blast Fluffy_Pillow 49955.4/49999: 100% mana
13.0/100: 13% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(19), mental_fortitude, coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.083 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
22.0/100: 22% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(18), mental_fortitude, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.838 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(17), mental_fortitude, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.593 main Q mind_blast Fluffy_Pillow 45010.2/49999: 90% mana
34.0/100: 34% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(17), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.348 main U mind_flay Fluffy_Pillow 46218.2/49999: 92% mana
43.0/100: 43% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(16), mental_fortitude, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.849 main N devouring_plague Fluffy_Pillow 48619.8/49999: 97% mana
65.0/100: 65% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.603 main U mind_flay Fluffy_Pillow 49826.2/49999: 100% mana
18.0/100: 18% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.103 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(12), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.859 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(11), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.614 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(11), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.368 main W mind_spike Fluffy_Pillow 47508.6/49999: 95% mana
63.0/100: 63% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(10), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.123 main X mind_flay Fluffy_Pillow 48716.6/49999: 97% mana
70.0/100: 70% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(9), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.372 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
95.0/100: 95% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(7), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.126 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(6), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.879 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
bloodlust, power_infusion, ancient_madness(5), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.379 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
87.0/100: 87% insanity
bloodlust, power_infusion, ancient_madness(4), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.134 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
bloodlust, power_infusion, ancient_madness(3), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.889 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
bloodlust, power_infusion, ancient_madness(2), surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.388 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
bloodlust, power_infusion, ancient_madness, surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.142 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.083 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.957 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.896 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
bloodlust, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.836 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.775 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.713 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.588 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.529 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.468 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
bloodlust, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:34.408 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity
bloodlust, surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:35.348 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:36.289 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:37.228 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:38.166 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:40.038 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:41.258 main N devouring_plague Fluffy_Pillow 45005.4/49999: 90% mana
60.0/100: 60% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:42.479 main Q mind_blast Fluffy_Pillow 46959.0/49999: 94% mana
10.0/100: 10% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:43.698 main U mind_flay Fluffy_Pillow 48909.4/49999: 98% mana
18.0/100: 18% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:46.134 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:47.355 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:48.576 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:49.798 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:51.019 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:52.239 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
7.0/100: 7% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:54.676 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:55.897 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:57.116 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:58.336 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:59.556 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:00.776 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:01.998 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:03.219 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:04.440 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:05.658 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
ancient_madness(19), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:06.878 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
ancient_madness(18), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:08.097 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
7.0/100: 7% insanity
ancient_madness(17), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:09.318 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
ancient_madness(16), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:11.755 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
ancient_madness(13), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:12.977 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:14.197 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity
ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:15.473 main U mind_flay Fluffy_Pillow 45003.8/49999: 90% mana
15.0/100: 15% insanity
ancient_madness(9), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:17.909 main V halo Fluffy_Pillow 48901.4/49999: 98% mana
39.0/100: 39% insanity
ancient_madness(7), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:19.130 main Q mind_blast Fluffy_Pillow 47507.0/49999: 95% mana
42.0/100: 42% insanity
ancient_madness(6), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:20.350 main N devouring_plague Fluffy_Pillow 49459.0/49999: 99% mana
51.0/100: 51% insanity
ancient_madness(5), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:21.571 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:24.008 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
ancient_madness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:27.662 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:28.883 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:30.104 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:31.324 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
2.0/100: 2% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:33.762 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:34.981 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:38.633 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
1:39.853 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:41.074 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:42.294 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:43.515 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:45.952 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:47.171 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:49.608 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:50.829 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:52.050 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:55.700 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:56.921 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:58.143 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:59.363 main U mind_flay Fluffy_Pillow 45005.4/49999: 90% mana
10.0/100: 10% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
2:01.799 cds I mindbender Fluffy_Pillow 48903.0/49999: 98% mana
27.0/100: 27% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:03.019 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
2:04.239 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
2:05.655 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
2:05.655 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
power_infusion, ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
2:05.655 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
blood_fury, power_infusion, ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
2:05.655 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
blood_fury, power_infusion, ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:06.632 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
blood_fury, power_infusion, ancient_madness(20), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:07.610 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
blood_fury, power_infusion, ancient_madness(19), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:09.558 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
blood_fury, power_infusion, ancient_madness(17), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:10.537 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
blood_fury, power_infusion, ancient_madness(16), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:11.515 main N devouring_plague Fluffy_Pillow 47507.0/49999: 95% mana
61.0/100: 61% insanity
blood_fury, power_infusion, ancient_madness(15), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:12.490 main S shadow_crash Fluffy_Pillow 49067.0/49999: 98% mana
14.0/100: 14% insanity
blood_fury, power_infusion, ancient_madness(14), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:13.466 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
blood_fury, power_infusion, ancient_madness(13), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:14.444 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
blood_fury, power_infusion, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:16.392 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
blood_fury, power_infusion, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:17.370 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
blood_fury, power_infusion, ancient_madness(9), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:18.348 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
blood_fury, power_infusion, ancient_madness(8), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:19.325 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
blood_fury, power_infusion, ancient_madness(7), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:20.301 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity
blood_fury, power_infusion, ancient_madness(6), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:22.248 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
power_infusion, ancient_madness(4), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:23.226 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
85.0/100: 85% insanity
power_infusion, ancient_madness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:24.204 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
91.0/100: 91% insanity
power_infusion, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:25.181 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
power_infusion, ancient_madness, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5)
2:26.157 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:27.379 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:28.599 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:29.821 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:32.256 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:33.478 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:37.131 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
87.0/100: 87% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
2:38.352 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:39.572 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:40.792 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:42.014 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:43.234 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:44.455 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:45.677 main Q mind_blast Fluffy_Pillow 45008.6/49999: 90% mana
14.0/100: 14% insanity
surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:46.899 main S shadow_crash Fluffy_Pillow 46963.8/49999: 94% mana
20.0/100: 20% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:48.119 main U mind_flay Fluffy_Pillow 48915.8/49999: 98% mana
36.0/100: 36% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:50.556 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
2:51.778 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:53.000 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:54.218 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
2:55.436 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
2:56.656 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
2:57.877 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:00.315 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:01.536 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
7.0/100: 7% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
3:03.971 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:05.190 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:06.411 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:07.632 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:08.853 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
3:10.073 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
ancient_madness(19), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:11.295 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
ancient_madness(18), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:12.516 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity
ancient_madness(17), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:14.951 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
98.0/100: 98% insanity
ancient_madness(14), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
3:16.170 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
twist_of_fate, ancient_madness(13), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:17.390 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
twist_of_fate, ancient_madness(12), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:18.610 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
twist_of_fate, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:19.830 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:21.051 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:22.270 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity
twist_of_fate, ancient_madness(7), surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:23.490 main N devouring_plague Fluffy_Pillow 45005.4/49999: 90% mana
76.0/100: 76% insanity
twist_of_fate, ancient_madness(6), surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:24.712 main N devouring_plague Fluffy_Pillow 46960.6/49999: 94% mana
81.0/100: 81% insanity
twist_of_fate, ancient_madness(5), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:25.935 main O shadow_word_death Fluffy_Pillow 48917.4/49999: 98% mana
37.0/100: 37% insanity
twist_of_fate, ancient_madness(3), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:27.158 main Q mind_blast Fluffy_Pillow 49624.2/49999: 99% mana
45.0/100: 45% insanity
twist_of_fate, ancient_madness(2), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:28.378 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, ancient_madness, surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:30.813 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
79.0/100: 79% insanity
twist_of_fate, surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:32.033 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:33.253 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:34.474 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:36.910 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:38.132 main W mind_spike Fluffy_Pillow 47508.6/49999: 95% mana
58.0/100: 58% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:39.352 main N devouring_plague Fluffy_Pillow 49460.6/49999: 99% mana
63.0/100: 63% insanity
twist_of_fate, surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:40.572 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
13.0/100: 13% insanity
twist_of_fate, surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:41.791 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:43.011 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:45.447 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:46.668 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:47.889 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:49.110 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
2.0/100: 2% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:50.330 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:51.550 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:53.987 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:55.206 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:56.427 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:57.648 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
2.0/100: 2% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:00.083 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:01.303 main W mind_spike Fluffy_Pillow 45005.4/49999: 90% mana
20.0/100: 20% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, static_empowerment(5)
4:02.525 main Q mind_blast Fluffy_Pillow 46960.6/49999: 94% mana
24.0/100: 24% insanity
twist_of_fate, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:03.748 cds I mindbender Fluffy_Pillow 48917.4/49999: 98% mana
30.0/100: 30% insanity
twist_of_fate, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:05.192 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
twist_of_fate, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
4:06.413 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
twist_of_fate, death_and_madness_reset, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:07.634 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
twist_of_fate, death_and_madness_reset, shadowy_insight, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:08.855 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:10.076 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity
twist_of_fate, death_and_madness_reset, ancient_madness(20), dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
4:10.076 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
4:10.076 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
4:10.076 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:10.967 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:11.860 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(19), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:12.751 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(18), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:13.643 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(17), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:15.417 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(15), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:16.308 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:17.200 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(13), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:18.978 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(12), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:19.870 main Q mind_blast Fluffy_Pillow 47507.0/49999: 95% mana
75.0/100: 75% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(11), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:20.763 main N devouring_plague Fluffy_Pillow 48935.8/49999: 98% mana
86.0/100: 86% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(10), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:21.655 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(9), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:22.547 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(8), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:23.439 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(7), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:25.214 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
power_infusion, twist_of_fate, ancient_madness(5), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:26.106 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
power_infusion, twist_of_fate, ancient_madness(4), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:27.883 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity
power_infusion, twist_of_fate, ancient_madness(3), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:28.775 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
88.0/100: 88% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(2), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:29.667 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
93.0/100: 93% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness, surge_of_darkness(2), shadowy_insight, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
4:30.559 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:31.779 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:33.000 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:34.295 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
82.0/100: 82% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:35.515 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:36.733 main U mind_flay Fluffy_Pillow 45002.2/49999: 90% mana
39.0/100: 39% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:39.169 main W mind_spike Fluffy_Pillow 48899.8/49999: 98% mana
58.0/100: 58% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:40.389 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:41.609 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
twist_of_fate, death_and_madness_reset, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:42.831 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:44.053 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:46.490 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:50.143 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
65.0/100: 65% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:51.365 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:52.586 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:53.808 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:55.028 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:56.248 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:57.469 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:58.689 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
13.0/100: 13% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3463 1 10805 10291 6827
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 216100 205820 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +687 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +515 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +687 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +687 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +89 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +515 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +386 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +386 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +687 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIk04ABAAAAAAAAAAAAQikkSESRLJRSJhEBpRSSiECSQIFpFSCA
class_talents=dispel_magic:1/improved_flash_heal:1/protective_light:1/angelic_feather:1/phantasm:1/death_and_madness:1/leap_of_faith:1/dominate_mind:1/mass_dispel:1/power_infusion:1/vampiric_embrace:1/tithe_evasion:1/improved_mass_dispel:1/body_and_soul:1/twins_of_the_sun_priestess:1/sanlayn:1/twist_of_fate:2/throes_of_pain:2/halo:1/translucent_image:1/mindgames:1/lights_inspiration:2/improved_fade:2/manipulation:2/angelic_bulwark:1/shattered_perceptions:1
spec_talents=devouring_plague:1/dispersion:1/shadowy_apparitions:1/silence:1/mental_fortitude:1/misery:1/coalescing_shadows:1/mind_spike:1/puppet_master:1/mental_decay:1/dark_ascension:1/surge_of_darkness:1/harnessed_shadows:1/shadowy_insight:1/ancient_madness:2/shadow_crash:1/dark_evangelism:2/auspicious_spirits:1/mindbender:1/mind_flay_insanity:1/encroaching_shadows:1/inescapable_torment:2/screams_of_the_void:2/mind_devourer:1/idol_of_yshaarj:1/idol_of_cthun:1

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/use_item,name=shadowed_orb_of_torment
actions.precombat+=/variable,name=mind_sear_cutoff,op=set,value=2
actions.precombat+=/shadow_crash,if=talent.shadow_crash.enabled
actions.precombat+=/mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
actions.precombat+=/vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled

# Executed every time the actor is available.
actions=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
actions+=/variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions+=/variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
actions+=/variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
actions+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
actions+=/variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
actions+=/variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
actions+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
actions+=/variable,name=pool_amount,op=set,value=60
actions+=/run_action_list,name=main

actions.cds=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
actions.cds+=/call_action_list,name=trinkets
actions.cds+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.main=call_action_list,name=cds
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
actions.main+=/mind_blast,if=cooldown.mind_blast.charges>=2&talent.mind_devourer&spell_targets.mind_sear>=3&spell_targets.mind_sear<=7&!buff.mind_devourer.up
actions.main+=/shadow_word_death,if=pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
actions.main+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
actions.main+=/damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
actions.main+=/void_bolt,if=variable.dots_up&insanity<=85
# Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
actions.main+=/mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
# Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
actions.main+=/mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.main+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
actions.main+=/shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
actions.main+=/vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
actions.main+=/shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
actions.main+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
actions.main+=/mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
actions.main+=/shadow_crash,if=raid_event.adds.in>10
actions.main+=/dark_void,if=raid_event.adds.in>20
actions.main+=/devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
actions.main+=/void_torrent,if=insanity<=35,target_if=variable.dots_up
actions.main+=/mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
actions.main+=/vampiric_touch,if=buff.unfurling_darkness.up
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
# Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
actions.main+=/halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
# Use when it will hit at least 2 targets.
actions.main+=/divine_star,if=spell_targets.divine_star>1
actions.main+=/lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75
actions.main+=/mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
actions.main+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
actions.main+=/shadow_crash,if=raid_event.adds.in>30
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.main+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.main+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.main+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.main+=/shadow_word_pain

actions.trinkets=use_item,name=scars_of_fraternal_strife,if=(!buff.scars_of_fraternal_strife_4.up&time>1)|(buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10)
actions.trinkets+=/use_item,name=macabre_sheet_music,if=cooldown.void_eruption.remains>10|cooldown.dark_ascension.remains>10
actions.trinkets+=/use_item,name=soulletting_ruby,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10,target_if=min:target.health.pct
# Use this on CD for max CDR
actions.trinkets+=/use_item,name=architects_ingenuity_core
# Default fallback for usable items: Use on cooldown in order by trinket slot.
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=6827
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 47147 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
47146.6 47146.6 42.5 / 0.090% 7532.9 / 16.0% 61.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
733.4 731.4 Mana 0.64% 52.5 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 47147
Elemental Blast 8125 17.2% 22.1 13.48sec 110131 95189 Direct 22.1 90852 182744 110182 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.11 22.10 0.00 0.00 0.00 1.1570 0.0000 2435501.91 2435501.91 0.00% 95188.85 95188.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.96% 17.45 8 27 90851.64 46980 207313 90885.14 73903 112429 1585797 1585797 0.00%
crit 21.04% 4.65 0 13 182744.34 93961 417532 181243.95 0 315867 849705 849705 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [N]:22.11
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 4858 10.3% 82.2 3.65sec 17715 138030 Direct 82.2 6334 12740 7445 17.3% 0.0%
Periodic 192.3 3736 7512 4392 17.4% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.21 82.21 192.25 192.25 81.21 0.1283 1.5505 1456352.03 1456352.03 0.00% 4718.67 138029.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 67.96 39 110 6334.03 3614 14834 6334.21 5598 7443 430440 430440 0.00%
crit 17.34% 14.25 2 31 12739.74 7228 28906 12741.15 9963 17117 181576 181576 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.64% 158.88 115 208 3736.35 1820 8470 3736.49 3374 4278 593620 593620 0.00%
crit 17.36% 33.38 13 57 7511.58 3713 16499 7511.34 6495 9076 250716 250716 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [V]:8.78
Flametongue Weapon 0 (948) 0.0% (2.0%) 1.0 0.00sec 284255 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 948 2.0% 661.5 0.73sec 430 0 Direct 661.5 366 734 430 17.4% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 661.50 661.50 0.00 0.00 0.00 0.0000 0.0000 284254.87 284254.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 546.28 387 715 365.50 303 639 365.53 337 400 199669 199669 0.00%
crit 17.42% 115.22 68 182 734.13 605 1262 734.21 674 811 84586 84586 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1085 2.3% 28.3 7.84sec 11516 0 Direct 28.3 9807 19717 11516 17.2% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.28 28.28 0.00 0.00 0.00 0.0000 0.0000 325670.84 325670.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 23.40 2 62 9807.00 9732 10030 9807.16 9732 10030 229502 229502 0.00%
crit 17.25% 4.88 0 20 19716.53 19463 20059 19294.66 0 20059 96169 96169 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 5553 11.8% 43.2 6.90sec 38508 33224 Direct 43.2 32807 65392 38508 17.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.22 43.22 0.00 0.00 0.00 1.1590 0.0000 1664434.57 1664434.57 0.00% 33224.24 33224.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 35.66 21 51 32807.09 7897 110849 32869.94 26210 42515 1169959 1169959 0.00%
crit 17.49% 7.56 0 19 65392.21 15795 231073 65436.36 0 137700 494476 494476 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [M]:38.79
  • if_expr:buff.hailstorm.up
    single
    [T]:4.43
Ice Strike 1993 4.2% 24.7 12.26sec 24181 20803 Direct 24.7 20576 41324 24181 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.70 24.70 0.00 0.00 0.00 1.1624 0.0000 597200.12 597200.12 0.00% 20803.29 20803.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 20.41 10 29 20575.56 15697 47051 20576.83 17892 25032 419861 419861 0.00%
crit 17.38% 4.29 0 12 41324.04 31393 87324 40940.38 0 87324 177339 177339 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:24.70
  • if_expr:talent.hailstorm.enabled
Lava Lash 9529 20.2% 66.5 4.45sec 42944 36880 Direct 66.5 (66.5) 36536 73461 42944 17.4% (17.4%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.50 66.50 0.00 0.00 0.00 1.1644 0.0000 2855559.71 2855559.71 0.00% 36880.19 36880.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 54.95 24 91 36535.58 18515 128419 36562.80 31484 44133 2007819 2007819 0.00%
crit 17.35% 11.54 1 28 73461.25 37029 224612 73534.38 47597 111263 847740 847740 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [I]:51.01
  • if_expr:buff.hot_hand.up|buff.ashen_catalyst.stack=8
    single
    [Q]:15.48
Lightning Bolt 3930 8.3% 18.6 16.27sec 63300 53170 Direct 18.6 52192 104477 63299 21.2% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.60 18.60 0.00 0.00 0.00 1.1906 0.0000 1177563.76 1177563.76 0.00% 53170.35 53170.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.75% 14.65 5 24 52191.74 29713 136607 52309.66 38365 69443 764641 764641 0.00%
crit 21.25% 3.95 0 11 104476.53 59426 248343 103162.81 0 222864 412923 412923 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [K]:6.99
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [O]:1.65
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [R]:9.96
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1706 3.6% 193.2 1.81sec 2647 1486 Direct 193.2 2613 5251 2647 17.5% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.17 193.17 0.00 0.00 0.00 1.7814 0.0000 511304.34 730453.39 30.00% 1485.84 1485.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.13% 127.75 85 178 2612.92 2204 4389 2613.14 2427 2855 333796 476863 30.00%
crit 17.50% 33.80 13 59 5251.27 4408 8778 5251.83 4628 6013 177509 253590 30.00%
miss 16.37% 31.62 14 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 854 1.8% 193.3 1.80sec 1324 743 Direct 193.3 1308 2630 1324 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.26 193.26 0.00 0.00 0.00 1.7814 0.0000 255857.59 365520.16 30.00% 743.19 743.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.25% 128.03 84 177 1308.05 1102 2223 1308.17 1211 1423 167466 239243 30.00%
crit 17.39% 33.61 9 65 2629.65 2204 4389 2629.77 2340 3061 88392 126278 30.00%
miss 16.36% 31.61 14 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 165 (2980) 0.3% (6.3%) 7.0 45.72sec 126896 106554 Direct 7.0 (14.0) 5981 12016 7016 17.2% (19.1%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.00 1.1909 0.0000 49327.54 49327.54 0.00% 106553.73 106553.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.84% 5.82 1 8 5981.28 4707 9556 5985.93 4707 7364 34835 34835 0.00%
crit 17.16% 1.21 0 6 12016.06 9413 18622 8845.16 0 18622 14492 14492 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:7.03
  • if_expr:buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
    Lightning Bolt (_pw) 2815 6.0% 7.0 45.91sec 120523 0 Direct 7.0 99443 199475 120523 21.1% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.99 6.99 0.00 0.00 0.00 0.0000 0.0000 842953.43 842953.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.92% 5.52 0 8 99442.67 69330 204911 99510.00 0 140209 548937 548937 0.00%
crit 21.08% 1.47 0 8 199475.45 138661 380678 159726.58 0 378704 294016 294016 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (1841) 0.0% (3.9%) 46.4 6.37sec 11899 10168

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.39 0.00 0.00 0.00 0.00 1.1703 0.0000 0.00 0.00 0.00% 10168.22 10168.22

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [P]:46.39
    Stormstrike (_mh) 1228 2.6% 46.4 6.37sec 7932 0 Direct 46.4 6743 13571 7932 17.4% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.39 46.39 0.00 0.00 0.00 0.0000 0.0000 367970.02 525684.86 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 38.31 21 61 6743.04 5715 11523 6743.11 6109 7569 258349 369080 30.00%
crit 17.41% 8.08 0 19 13570.90 11430 22809 13566.93 0 18021 109621 156605 29.99%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 614 1.3% 46.4 6.37sec 3967 0 Direct 46.4 3372 6780 3967 17.5% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.39 46.39 0.00 0.00 0.00 0.0000 0.0000 184052.69 262939.12 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.53% 38.29 18 59 3372.05 2858 5762 3372.06 3070 3804 129105 184441 30.00%
crit 17.47% 8.10 0 22 6780.05 5715 11523 6781.32 0 8730 54948 78499 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 805 1.7% 5.7 54.00sec 42364 36378 Direct 5.7 36121 72589 42365 17.1% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.70 5.70 0.00 0.00 0.00 1.1646 0.0000 241332.53 241332.53 0.00% 36378.13 36378.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.88% 4.72 1 8 36121.19 27905 73620 36132.99 27905 53656 170531 170531 0.00%
crit 17.12% 0.98 0 5 72589.40 55810 138955 47343.32 0 138955 70801 70801 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [S]:5.70
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (734) 0.0% (1.6%) 1.0 0.00sec 220182 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 734 1.6% 148.6 4.15sec 1481 0 Direct 148.6 1260 2532 1481 17.4% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.64 148.64 0.00 0.00 0.00 0.0000 0.0000 220182.04 314553.80 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 122.75 61 188 1259.67 1063 2143 1259.80 1150 1408 154629 220904 30.00%
crit 17.42% 25.89 8 50 2532.28 2125 4241 2532.69 2188 2950 65553 93650 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
pet - greater_earth_elemental 428 / 89
melee 428 0.2% 40.0 2.28sec 663 435 Direct 40.0 565 1129 663 17.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.95 39.95 0.00 0.00 0.00 1.5256 0.0000 26495.02 37850.99 30.00% 434.72 434.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 32.99 20 64 564.87 490 982 563.85 490 697 18635 26622 30.00%
crit 17.42% 6.96 0 20 1129.18 980 1765 1126.91 0 1513 7860 11229 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2422 / 707
melee 2422 1.5% 89.4 3.41sec 2366 2106 Direct 89.4 2015 4026 2366 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.42 89.42 0.00 0.00 0.00 1.1238 0.0000 211593.58 302284.25 30.00% 2105.51 2105.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.54% 73.81 0 168 2015.14 1660 3348 2012.78 0 2539 148733 212481 30.00%
crit 17.46% 15.61 0 43 4025.99 3321 6465 4018.48 0 5497 62861 89804 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2400 / 703
melee 2400 1.5% 89.5 3.40sec 2352 2088 Direct 89.5 2002 4000 2352 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.45 89.45 0.00 0.00 0.00 1.1262 0.0000 210371.97 300539.04 30.00% 2088.27 2088.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.47% 73.77 8 177 2001.52 1660 3306 2000.34 1671 2485 147655 210942 30.00%
crit 17.53% 15.68 0 49 3999.66 3321 6611 3994.52 0 5356 62716 89597 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2415 / 707
melee 2415 1.5% 89.7 3.40sec 2362 2100 Direct 89.7 2012 4019 2362 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.71 89.71 0.00 0.00 0.00 1.1250 0.0000 211898.60 302720.01 30.00% 2099.75 2099.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.54% 74.05 6 169 2011.79 1660 3306 2009.62 1660 2524 148967 212815 30.00%
crit 17.46% 15.66 0 43 4018.62 3321 6611 4013.59 0 5629 62932 89905 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 310.77sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.12 0.00 0.00 0.00 0.00 1.0260 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [U]:1.12
Feral Spirit 10.7 30.01sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.73 0.00 0.00 0.00 0.00 1.1812 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:10.73
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.58sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.47
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 66.1 126.1 4.5sec 1.6sec 3.7sec 81.80% 98.23% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.6s

Stack Uptimes

  • ashen_catalyst_1:30.82%
  • ashen_catalyst_2:16.20%
  • ashen_catalyst_3:11.76%
  • ashen_catalyst_4:9.74%
  • ashen_catalyst_5:6.55%
  • ashen_catalyst_6:3.82%
  • ashen_catalyst_7:2.25%
  • ashen_catalyst_8:0.66%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.0 0.0 48.3sec 48.3sec 14.7sec 29.28% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.2s / 273.0s
  • trigger_min/max:14.2s / 273.0s
  • trigger_pct:85.06%
  • duration_min/max:0.0s / 29.9s

Stack Uptimes

  • crackling_surge_1:23.47%
  • crackling_surge_2:5.80%
  • crackling_surge_3:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.5sec 12.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.9s
  • trigger_pct:100.00%
  • duration_min/max:16.1s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.35%
  • crumbling_power_3:0.59%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.67%
  • crumbling_power_7:0.66%
  • crumbling_power_8:0.66%
  • crumbling_power_9:0.65%
  • crumbling_power_10:0.63%
  • crumbling_power_11:0.63%
  • crumbling_power_12:0.63%
  • crumbling_power_13:0.63%
  • crumbling_power_14:0.64%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.73%
  • crumbling_power_17:0.79%
  • crumbling_power_18:0.82%
  • crumbling_power_19:1.00%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 6.3 1.1 44.1sec 37.0sec 10.8sec 22.90% 0.00% 1.1 (1.1) 6.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 307.6s
  • trigger_min/max:1.6s / 307.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.1s

Stack Uptimes

  • elemental_blast_critical_strike_1:22.90%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 6.3 1.1 44.5sec 37.3sec 10.8sec 22.69% 0.00% 1.1 (1.1) 6.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 280.8s
  • trigger_min/max:1.3s / 280.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.4s

Stack Uptimes

  • elemental_blast_haste_1:22.69%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 6.3 1.0 44.1sec 37.0sec 10.8sec 22.85% 0.00% 1.0 (1.0) 6.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 260.9s
  • trigger_min/max:1.6s / 252.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.1s

Stack Uptimes

  • elemental_blast_mastery_1:22.85%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 124.3sec 98.2sec 58.2sec 25.37% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:25.37%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.9sec 99.6sec 57.8sec 24.67% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:24.67%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.9sec 101.0sec 57.9sec 25.01% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:25.01%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.7sec 99.1sec 58.3sec 24.96% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:24.96%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.7sec 302.7sec 27.4sec 13.18% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.2s
  • trigger_min/max:300.0s / 329.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.18%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 0.0 29.2sec 30.0sec 14.7sec 52.60% 0.00% 42.0 (42.0) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 48.7s
  • trigger_min/max:16.2s / 46.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.9s

Stack Uptimes

  • feral_spirit_1:52.60%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 50.0 227.0 6.0sec 1.1sec 4.7sec 78.63% 87.72% 227.0 (489.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 53.4s
  • trigger_min/max:0.0s / 18.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.6s

Stack Uptimes

  • flurry_1:22.01%
  • flurry_2:33.81%
  • flurry_3:22.81%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.7sec 46.5sec 13.0sec 19.45% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 222.3s
  • trigger_min/max:0.3s / 222.3s
  • trigger_pct:98.87%
  • duration_min/max:0.0s / 54.8s

Stack Uptimes

  • forgestorm_ignited_1:19.45%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 39.1 1.6 7.7sec 7.4sec 2.4sec 30.86% 89.85% 1.6 (10.4) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 33.2s
  • trigger_min/max:1.2s / 33.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.3s

Stack Uptimes

  • hailstorm_5:9.80%
  • hailstorm_6:6.10%
  • hailstorm_7:3.69%
  • hailstorm_8:2.26%
  • hailstorm_9:1.38%
  • hailstorm_10:7.62%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.6 5.6 27.6sec 17.6sec 9.9sec 35.03% 89.12% 5.6 (5.6) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 224.2s
  • trigger_min/max:0.0s / 220.5s
  • trigger_pct:5.00%
  • duration_min/max:0.0s / 49.9s

Stack Uptimes

  • hot_hand_1:35.03%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.7 0.0 12.3sec 12.3sec 3.6sec 29.67% 56.09% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 27.0s
  • trigger_min/max:7.7s / 27.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.4s

Stack Uptimes

  • ice_strike_1:29.67%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 6.0 0.0 48.2sec 48.2sec 14.7sec 29.25% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 330.2s
  • trigger_min/max:13.5s / 330.2s
  • trigger_pct:85.01%
  • duration_min/max:0.0s / 29.9s

Stack Uptimes

  • icy_edge_1:23.42%
  • icy_edge_2:5.84%
  • icy_edge_3:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 41.6 224.4 7.3sec 2.3sec 6.2sec 85.89% 100.00% 17.1 (35.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 33.0s
  • trigger_min/max:0.0s / 16.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.8s

Stack Uptimes

  • maelstrom_weapon_1:12.26%
  • maelstrom_weapon_2:13.62%
  • maelstrom_weapon_3:14.05%
  • maelstrom_weapon_4:14.26%
  • maelstrom_weapon_5:9.91%
  • maelstrom_weapon_6:6.65%
  • maelstrom_weapon_7:4.36%
  • maelstrom_weapon_8:2.81%
  • maelstrom_weapon_9:1.73%
  • maelstrom_weapon_10:6.23%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 6.0 0.0 48.4sec 48.4sec 14.7sec 29.20% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.4s / 310.0s
  • trigger_min/max:12.4s / 310.0s
  • trigger_pct:84.95%
  • duration_min/max:0.0s / 29.7s

Stack Uptimes

  • molten_weapon_1:23.39%
  • molten_weapon_2:5.81%
  • molten_weapon_3:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Primordial Wave 7.0 0.0 45.7sec 45.7sec 2.0sec 4.59% 37.99% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 51.2s
  • trigger_min/max:45.0s / 51.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.7s

Stack Uptimes

  • primordial_wave_1:4.59%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.2 61.0sec 45.6sec 16.5sec 23.68% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 204.8s
  • trigger_min/max:0.0s / 194.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.9s

Stack Uptimes

  • sophic_devotion_1:23.68%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.2 60.6sec 45.5sec 16.5sec 23.90% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 213.0s
  • trigger_min/max:0.0s / 204.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.7s

Stack Uptimes

  • sophic_devotion_oh_1:23.90%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.5sec 45.5sec 32.3sec 38.23% 0.00% 25.8 (25.8) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 271.4s
  • trigger_min/max:0.0s / 205.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 193.5s

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.30%
  • spiraling_winds_4:2.27%
  • spiraling_winds_5:2.26%
  • spiraling_winds_6:2.24%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.21%
  • spiraling_winds_9:2.20%
  • spiraling_winds_10:17.87%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 7.0 0.0 45.9sec 45.9sec 11.8sec 27.59% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:38.6s / 53.8s
  • trigger_min/max:38.6s / 53.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • splintered_elements_1:27.59%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 28.4 9.5 10.3sec 7.7sec 3.5sec 33.09% 59.42% 9.5 (9.5) 0.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 120.7s
  • trigger_min/max:0.0s / 118.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.8s

Stack Uptimes

  • stormbringer_1:33.09%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.7 10.0 49.0 11.0s 1.1s 129.5s
windfury_totem_extra_attack_oh 26.7 10.0 48.0 10.9s 1.1s 121.0s
Maelstrom Weapon: Feral Spirit 63.0 48.0 79.0 4.8s 0.0s 31.7s
Maelstrom Weapon: Swirling Maelstrom 63.5 46.0 82.0 4.7s 0.8s 21.7s
Maelstrom Weapon: Primordial Wave 70.3 60.0 80.0 45.7s 45.0s 51.2s
Flametongue: Windfury Attack 148.6 78.0 234.0 4.2s 0.0s 51.9s
Stormbringer: Windfury Attack 16.7 2.0 35.0 18.2s 0.0s 234.4s
Maelstrom Weapon: Windfury Attack 29.7 9.0 55.0 11.1s 0.0s 148.0s
Flametongue: main_hand 161.6 106.0 218.0 2.2s 1.1s 16.0s
Hot Hand: main_hand 8.1 0.0 21.0 33.2s 1.1s 284.1s
Maelstrom Weapon: main_hand 32.4 12.0 59.0 9.4s 1.1s 102.2s
Windfury: main_hand 50.4 22.0 81.0 6.2s 1.1s 67.0s
Flametongue: offhand 161.6 112.0 211.0 2.2s 1.1s 17.5s
Hot Hand: offhand 8.1 0.0 22.0 32.9s 1.1s 294.9s
Maelstrom Weapon: offhand 32.3 11.0 58.0 9.4s 1.1s 111.8s
Flametongue: Sundering 5.7 2.0 8.0 53.9s 40.0s 179.7s
Stormbringer: Sundering 0.6 0.0 4.0 111.5s 40.0s 340.9s
Maelstrom Weapon: Sundering 1.1 0.0 6.0 106.7s 40.0s 340.6s
Windfury: Sundering 1.8 0.0 7.0 96.6s 40.0s 341.2s
Flametongue: Lava Lash 66.5 35.0 109.0 4.4s 0.8s 15.8s
Stormbringer: Lava Lash 7.4 0.0 18.0 34.9s 0.8s 309.7s
Maelstrom Weapon: Lava Lash 13.3 1.0 31.0 21.0s 0.8s 237.8s
Flametongue: Ice Strike 24.7 19.0 30.0 12.3s 7.7s 27.0s
Stormbringer: Ice Strike 2.7 0.0 10.0 69.5s 7.7s 326.3s
Maelstrom Weapon: Ice Strike 5.0 0.0 15.0 50.1s 7.7s 313.2s
Windfury: Ice Strike 7.7 0.0 18.0 35.7s 7.7s 285.7s
Flametongue: Stormstrike 46.4 27.0 67.0 6.4s 0.8s 46.2s
Stormbringer: Stormstrike 5.2 0.0 17.0 44.5s 0.8s 333.6s
Maelstrom Weapon: Stormstrike 9.3 0.0 20.0 29.1s 0.8s 295.2s
Windfury: Stormstrike 14.4 2.0 31.0 19.6s 0.8s 217.9s
Flametongue: Stormstrike Off-Hand 46.4 27.0 67.0 6.4s 0.8s 46.2s
Stormbringer: Stormstrike Off-Hand 5.2 0.0 16.0 45.1s 0.8s 307.7s
Maelstrom Weapon: Stormstrike Off-Hand 9.3 1.0 24.0 29.3s 0.8s 252.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 23.20% 13.17% 30.30% 0.5s 0.0s 4.8s
Hot Hand 35.03% 8.92% 63.32% 9.9s 0.0s 49.9s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.8550.0011.5217.6221.84113.495
Sundering14.4600.001139.73965.5000.000184.002
Primordial Wave0.8930.0016.2264.3360.00015.950
Lava Lash0.9860.00112.52363.57631.608115.831
Flame Shock23.5060.001271.545180.0850.000308.825
Ice Strike0.6950.00114.26614.2991.12741.257
Frost Shock2.4120.00122.89195.52150.992153.227
Elemental Blast4.3340.00133.24736.2525.60593.743
Stormstrike2.4130.00130.511104.47350.773182.470
Earth Elemental10.8640.01950.1231.2620.00050.123

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana623.86219422.06100.00%351.72259958.9154.23%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 731.40 733.43 259959.9 49391.2 47000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 22.1130407.461375.001375.0080.10
Flame ShockMana 8.786582.82750.0080.07221.24
Frost ShockMana 43.2221611.52500.00500.0077.02
Ice StrikeMana 24.7040750.231650.001650.0014.66
Lava LashMana 66.4926597.52400.00399.99107.36
Lightning BoltMana 18.609301.16500.00499.98126.60
Primordial WaveMana 7.0310547.391500.001500.0084.60
StormstrikeMana 46.3946392.611000.001000.0411.90
SunderingMana 5.7017090.123000.003000.0414.12

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 47146.56
Minimum 40101.01
Maximum 54640.01
Spread ( max - min ) 14539.00
Range [ ( max - min ) / 2 * 100% ] 15.42%
Standard Deviation 1878.2352
5th Percentile 44165.10
95th Percentile 50373.16
( 95th Percentile - 5th Percentile ) 6208.05
Mean Distribution
Standard Deviation 21.6894
95.00% Confidence Interval ( 47104.05 - 47189.08 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6097
0.1 Scale Factor Error with Delta=300 30116
0.05 Scale Factor Error with Delta=300 120461
0.01 Scale Factor Error with Delta=300 3011506
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 47146.56
Minimum 40101.01
Maximum 54640.01
Spread ( max - min ) 14539.00
Range [ ( max - min ) / 2 * 100% ] 15.42%
Standard Deviation 1878.2352
5th Percentile 44165.10
95th Percentile 50373.16
( 95th Percentile - 5th Percentile ) 6208.05
Mean Distribution
Standard Deviation 21.6894
95.00% Confidence Interval ( 47104.05 - 47189.08 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6097
0.1 Scale Factor Error with Delta=300 30116
0.05 Scale Factor Error with Delta=300 120461
0.01 Scale Factor Error with Delta=300 3011506
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 47146.56
Minimum 40101.01
Maximum 54640.01
Spread ( max - min ) 14539.00
Range [ ( max - min ) / 2 * 100% ] 15.42%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 13469517.98
Minimum 9561206.35
Maximum 17408605.98
Spread ( max - min ) 7847399.63
Range [ ( max - min ) / 2 * 100% ] 29.13%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.47 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 10.73 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
G 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
H 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
I 51.01 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
0.00 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
0.00 ice_strike,if=buff.doom_winds_talent.up
0.00 sundering,if=buff.doom_winds_talent.up
J 7.03 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking
K 6.99 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
L 24.70 ice_strike,if=talent.hailstorm.enabled
M 38.79 frost_shock,if=buff.hailstorm.up
0.00 lava_lash,if=dot.flame_shock.refreshable
0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
0.00 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
N 22.11 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
O 1.65 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
P 46.39 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
Q 15.48 lava_lash
0.00 bag_of_tricks
R 9.96 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
S 5.70 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
T 4.43 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
U 1.12 earth_elemental
V 8.78 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ACDEFBJKLMNPIMIPIILINIMIPISILIPIPQFNMPLPNMPIUTVPLNMPQJKMPVFILINIMPPQSNLMPPQRMVPLQTPRVMQPJFIKILIMNPQMINILIMPQRMSPPLFNMIPVTNLMJKIMPVIRILIIMINIFIMLINIMIPINILIMIPIOIDEIJFIKILMNPQMSPNMLPQRMVIPITILPNMFIPITILNJKMPQVRMLPSQTVIPFILINMPVNMQPLPPIPIPIOIJFIKLMNPIMINIILIMIPQPRM

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_earth
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), elemental_chaos_earth
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), crumbling_power(20), elemental_chaos_earth
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry(2), crumbling_power(20), elemental_chaos_earth
0:00.894 default B potion Fluffy_Pillow 40680.4/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, molten_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_earth
0:00.894 single J primordial_wave Fluffy_Pillow 40680.4/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, molten_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:01.789 single K lightning_bolt Fluffy_Pillow 40612.4/50000: 81% mana bloodlust, berserking, flurry(2), primordial_wave, feral_spirit, molten_weapon(2), maelstrom_weapon(10), crumbling_power(19), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.684 single L ice_strike Fluffy_Pillow 41544.4/50000: 83% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(2), hailstorm(10), crumbling_power(18), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.497 single M frost_shock Fluffy_Pillow 41195.2/50000: 82% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, crumbling_power(17), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.309 single N elemental_blast Fluffy_Pillow 41994.4/50000: 84% mana bloodlust, berserking, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), crumbling_power(16), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.124 single P stormstrike Fluffy_Pillow 41923.4/50000: 84% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), stormbringer, hailstorm(5), crumbling_power(15), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.938 single I lava_lash Fluffy_Pillow 42225.8/50000: 84% mana bloodlust, berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), hot_hand, hailstorm(5), crumbling_power(14), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.753 single M frost_shock Fluffy_Pillow 43129.8/50000: 86% mana bloodlust, berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(5), crumbling_power(13), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.567 single I lava_lash Fluffy_Pillow 43932.2/50000: 88% mana bloodlust, berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), crumbling_power(12), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.383 single P stormstrike Fluffy_Pillow 44837.8/50000: 90% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), crumbling_power(11), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.197 single I lava_lash Fluffy_Pillow 45140.2/50000: 90% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), crumbling_power(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.011 single I lava_lash Fluffy_Pillow 46042.6/50000: 92% mana bloodlust, berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), crumbling_power(9), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.823 single L ice_strike Fluffy_Pillow 46941.8/50000: 94% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), hot_hand, stormbringer, maelstrom_weapon(6), crumbling_power(8), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.638 single I lava_lash Fluffy_Pillow 46595.8/50000: 93% mana bloodlust, berserking, flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, crumbling_power(7), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.451 single N elemental_blast Fluffy_Pillow 47496.6/50000: 95% mana bloodlust, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, crumbling_power(6), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.346 single I lava_lash Fluffy_Pillow 47553.6/50000: 95% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, hailstorm(8), ice_strike, crumbling_power(5), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.214 single M frost_shock Fluffy_Pillow 48542.4/50000: 97% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, hailstorm(8), ice_strike, crumbling_power(4), forgestorm_ignited, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.171 single I lava_lash Fluffy_Pillow 49573.6/50000: 99% mana bloodlust, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), crumbling_power(3), forgestorm_ignited, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.126 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), crumbling_power(2), forgestorm_ignited, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.083 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), crumbling_power, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.039 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(3), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.993 single I lava_lash Fluffy_Pillow 48526.4/50000: 97% mana bloodlust, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(3), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.947 single L ice_strike Fluffy_Pillow 49652.8/50000: 99% mana bloodlust, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(3), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.917 single I lava_lash Fluffy_Pillow 49554.8/50000: 99% mana bloodlust, elemental_blast_haste, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.874 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(5), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.829 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.811 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.794 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(2), maelstrom_weapon(5), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.835 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), ashen_catalyst, maelstrom_weapon(7), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.982 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(8), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.965 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hailstorm(8), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.950 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.934 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.919 single P stormstrike Fluffy_Pillow 49926.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(4), ice_strike, sophic_devotion_oh, elemental_chaos_earth
0:31.902 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(6), ice_strike, sophic_devotion_oh, elemental_chaos_earth
0:32.886 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(2), hailstorm(6), ice_strike, sophic_devotion_oh, elemental_chaos_earth
0:33.870 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), stormbringer, maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_earth
0:34.853 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), maelstrom_weapon(3), elemental_chaos_earth
0:35.837 single U earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(4), elemental_chaos_earth
0:36.821 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(4), elemental_chaos_earth
0:37.803 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), elemental_chaos_earth
0:38.787 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(5), elemental_chaos_earth
0:39.772 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, maelstrom_weapon(6), elemental_chaos_earth
0:40.753 single N elemental_blast Fluffy_Pillow 49919.6/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_earth
0:42.030 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(5), stormbringer, maelstrom_weapon, hailstorm(8), ice_strike, elemental_chaos_earth
0:43.308 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_earth
0:44.586 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(6), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_earth
0:45.863 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(3), spiraling_winds, forgestorm_ignited, elemental_chaos_earth
0:47.172 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, ashen_catalyst(2), maelstrom_weapon(10), spiraling_winds(2), forgestorm_ignited, elemental_chaos_earth
0:48.450 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), spiraling_winds(2), forgestorm_ignited, elemental_chaos_earth
0:49.611 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, splintered_elements, ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(3), forgestorm_ignited, elemental_chaos_earth
0:50.772 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth
0:51.934 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(5), hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds(4), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
0:53.096 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(5), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
0:54.258 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(5), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
0:55.418 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(6), sophic_devotion_oh, elemental_chaos_earth
0:56.579 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(6), sophic_devotion_oh, elemental_chaos_earth
0:57.740 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, hailstorm(10), ice_strike, spiraling_winds(7), sophic_devotion_oh, elemental_chaos_earth
0:58.902 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(8), sophic_devotion_oh, elemental_chaos_earth
1:00.063 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), spiraling_winds(8), sophic_devotion_oh, elemental_chaos_frost
1:01.341 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), spiraling_winds(9), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
1:02.618 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
1:03.895 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
1:05.172 single N elemental_blast Fluffy_Pillow 49043.2/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(6), spiraling_winds(10), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
1:06.448 single L ice_strike Fluffy_Pillow 49709.8/50000: 99% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(6), spiraling_winds(10), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
1:07.779 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(3), hailstorm(6), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
1:09.056 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
1:10.333 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(5), stormbringer, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_frost
1:11.610 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(6), maelstrom_weapon(5), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:12.888 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(5), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:14.165 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, hailstorm(5), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:15.441 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:16.719 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:17.996 Waiting     1.006 sec 50000.0/50000: 100% mana flurry, ashen_catalyst(4), maelstrom_weapon(2), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:19.002 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), maelstrom_weapon(2), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:20.511 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), maelstrom_weapon(4), ice_strike, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:21.788 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(4), ice_strike, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:23.064 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(4), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:24.364 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(6), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
1:25.642 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(3), hailstorm(6), forgestorm_ignited, elemental_chaos_frost
1:26.920 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon, hailstorm(6), forgestorm_ignited, elemental_chaos_frost
1:28.198 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_frost
1:29.476 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), stormbringer, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_frost
1:30.753 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, stormbringer, maelstrom_weapon(2), elemental_chaos_frost
1:32.172 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), elemental_chaos_frost
1:33.451 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(10), elemental_chaos_frost
1:34.730 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, feral_spirit, molten_weapon(2), hot_hand, stormbringer, maelstrom_weapon(10), elemental_chaos_frost
1:36.006 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), elemental_chaos_frost
1:37.168 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), elemental_chaos_frost
1:38.330 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(10), ice_strike, elemental_chaos_frost
1:39.492 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), stormbringer, maelstrom_weapon(6), hailstorm(10), ice_strike, elemental_chaos_frost
1:40.654 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon(7), elemental_chaos_frost
1:41.813 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(2), hailstorm(7), elemental_chaos_frost
1:42.942 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(3), hailstorm(7), elemental_chaos_frost
1:44.070 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), maelstrom_weapon(3), hailstorm(7), elemental_chaos_frost
1:45.199 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), elemental_chaos_frost
1:46.327 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), elemental_chaos_frost
1:47.453 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(6), elemental_chaos_frost
1:48.693 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, hot_hand, stormbringer, maelstrom_weapon, hailstorm(6), elemental_chaos_frost
1:49.932 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(6), ice_strike, forgestorm_ignited, elemental_chaos_frost
1:51.172 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(6), ice_strike, forgestorm_ignited, elemental_chaos_frost
1:52.412 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_frost
1:53.653 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_frost
1:54.891 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst, maelstrom_weapon(9), forgestorm_ignited, elemental_chaos_frost
1:56.131 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(9), forgestorm_ignited, elemental_chaos_frost
1:57.372 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(3), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_frost
1:58.649 single P stormstrike Fluffy_Pillow 49043.2/50000: 98% mana flurry, ashen_catalyst(3), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_frost
1:59.939 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_frost
2:01.217 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_air
2:02.455 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(6), maelstrom_weapon(7), ice_strike, elemental_chaos_air
2:03.693 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), maelstrom_weapon(8), ice_strike, elemental_chaos_air
2:04.932 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), hailstorm(8), ice_strike, elemental_chaos_air
2:06.169 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), maelstrom_weapon(2), elemental_chaos_air
2:07.406 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(2), elemental_chaos_air
2:08.642 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), elemental_chaos_air
2:09.881 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(4), elemental_chaos_air
2:11.119 Waiting     0.409 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_air
2:11.528 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(5), sophic_devotion_oh, elemental_chaos_air
2:12.765 Waiting     0.495 sec 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hailstorm(5), sophic_devotion_oh, elemental_chaos_air
2:13.260 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hailstorm(5), sophic_devotion_oh, elemental_chaos_air
2:14.691 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(2), hailstorm(5), ice_strike, sophic_devotion_oh, elemental_chaos_air
2:15.916 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(3), spiraling_winds, sophic_devotion_oh, elemental_chaos_air
2:17.117 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), maelstrom_weapon(10), spiraling_winds(2), sophic_devotion_oh, elemental_chaos_air
2:18.320 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(8), maelstrom_weapon, hailstorm(10), spiraling_winds(2), sophic_devotion_oh, elemental_chaos_air
2:19.411 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, maelstrom_weapon, hailstorm(10), spiraling_winds(3), sophic_devotion_oh, elemental_chaos_air
2:20.502 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst, maelstrom_weapon(3), spiraling_winds(3), sophic_devotion_oh, elemental_chaos_air
2:21.594 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(4), sophic_devotion_oh, elemental_chaos_air
2:22.721 Waiting     0.254 sec 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(5), sophic_devotion_oh, elemental_chaos_air
2:22.975 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(3), hot_hand, maelstrom_weapon(5), spiraling_winds(5), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_air
2:24.100 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, hot_hand, maelstrom_weapon(5), spiraling_winds(5), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_air
2:25.226 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, hailstorm(5), spiraling_winds(6), forgestorm_ignited, elemental_chaos_air
2:26.351 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, hot_hand, stormbringer, hailstorm(5), spiraling_winds(6), forgestorm_ignited, elemental_chaos_air
2:27.476 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(7), forgestorm_ignited, elemental_chaos_air
2:28.601 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), ice_strike, spiraling_winds(7), forgestorm_ignited, elemental_chaos_air
2:29.727 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), ice_strike, spiraling_winds(8), forgestorm_ignited, elemental_chaos_air
2:30.965 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(9), forgestorm_ignited, elemental_chaos_air
2:32.201 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(9), forgestorm_ignited, elemental_chaos_air
2:33.438 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, stormbringer, hailstorm(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
2:34.674 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, hot_hand, stormbringer, hailstorm(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
2:35.910 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(5), spiraling_winds(10), elemental_chaos_air
2:37.148 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon, hailstorm(5), spiraling_winds(10), elemental_chaos_air
2:38.383 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_air
2:39.642 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_air
2:40.878 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), ice_strike, elemental_chaos_air
2:42.116 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, hailstorm(5), ice_strike, sophic_devotion_oh, elemental_chaos_air
2:43.353 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(5), ice_strike, sophic_devotion_oh, elemental_chaos_air
2:44.592 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_air
2:45.830 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_air
2:47.068 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), sophic_devotion, sophic_devotion_oh, elemental_chaos_air
2:48.305 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(6), sophic_devotion, sophic_devotion_oh, elemental_chaos_air
2:49.545 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, stormbringer, hailstorm(6), sophic_devotion, sophic_devotion_oh, elemental_chaos_air
2:50.783 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(6), sophic_devotion, sophic_devotion_oh, elemental_chaos_air
2:52.020 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(6), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_air
2:53.257 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(6), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_air
2:54.495 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), sophic_devotion, sophic_devotion_oh, elemental_chaos_air
2:55.732 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), sophic_devotion, sophic_devotion_oh, elemental_chaos_air
2:56.969 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), sophic_devotion, elemental_chaos_air
2:58.207 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(10), sophic_devotion, elemental_chaos_air
2:59.443 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), sophic_devotion, elemental_chaos_air
3:00.679 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), spiraling_winds, sophic_devotion, elemental_chaos_frost
3:00.679 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), crumbling_power(20), spiraling_winds, sophic_devotion, elemental_chaos_frost
3:00.679 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), crumbling_power(20), spiraling_winds, sophic_devotion, elemental_chaos_frost
3:01.840 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), hailstorm(10), crumbling_power(19), spiraling_winds, sophic_devotion, elemental_chaos_frost
3:03.001 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), primordial_wave, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), hailstorm(10), crumbling_power(19), spiraling_winds(2), elemental_chaos_frost
3:04.163 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), hailstorm(10), crumbling_power(18), spiraling_winds(2), elemental_chaos_frost
3:05.324 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(10), crumbling_power(17), spiraling_winds(3), elemental_chaos_frost
3:06.485 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), crumbling_power(16), spiraling_winds(4), elemental_chaos_frost
3:07.542 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), crumbling_power(15), spiraling_winds(4), elemental_chaos_frost
3:08.599 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(14), spiraling_winds(5), elemental_chaos_frost
3:09.656 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(5), crumbling_power(13), spiraling_winds(5), elemental_chaos_frost
3:10.713 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(5), crumbling_power(12), spiraling_winds(6), sophic_devotion_oh, elemental_chaos_frost
3:11.739 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), hailstorm(5), crumbling_power(11), spiraling_winds(6), sophic_devotion_oh, elemental_chaos_frost
3:12.764 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, maelstrom_weapon, hailstorm(5), crumbling_power(10), spiraling_winds(7), sophic_devotion_oh, elemental_chaos_frost
3:13.892 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(3), crumbling_power(9), spiraling_winds(7), sophic_devotion_oh, elemental_chaos_frost
3:15.020 single P stormstrike Fluffy_Pillow 48804.8/50000: 98% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), crumbling_power(8), spiraling_winds(8), sophic_devotion_oh, elemental_chaos_frost
3:16.148 single N elemental_blast Fluffy_Pillow 49609.6/50000: 99% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(5), crumbling_power(7), spiraling_winds(8), sophic_devotion_oh, elemental_chaos_frost
3:17.277 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, hailstorm(5), crumbling_power(6), spiraling_winds(9), sophic_devotion_oh, elemental_chaos_frost
3:18.404 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), crumbling_power(5), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_frost
3:19.674 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(5), stormbringer, maelstrom_weapon(4), ice_strike, crumbling_power(4), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_frost
3:20.915 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(6), maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion_oh, elemental_chaos_frost
3:22.155 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion_oh, elemental_chaos_frost
3:23.397 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, maelstrom_weapon, hailstorm(7), ice_strike, spiraling_winds(10), sophic_devotion_oh, elemental_chaos_frost
3:24.636 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(3), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_frost
3:25.877 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), hot_hand, maelstrom_weapon(3), elemental_chaos_frost
3:27.119 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana hot_hand, maelstrom_weapon(3), elemental_chaos_frost
3:28.398 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(4), elemental_chaos_frost
3:29.676 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_frost
3:30.955 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), hot_hand, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_frost
3:32.232 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana hot_hand, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_frost
3:33.509 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(5), ice_strike, sophic_devotion_oh, elemental_chaos_frost
3:34.786 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(6), ice_strike, sophic_devotion_oh, elemental_chaos_frost
3:36.064 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(3), hailstorm(6), ice_strike, sophic_devotion_oh, elemental_chaos_frost
3:37.304 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), hot_hand, maelstrom_weapon, sophic_devotion_oh, elemental_chaos_frost
3:38.544 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hot_hand, maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_frost
3:39.785 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_frost
3:41.024 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_frost
3:42.265 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_frost
3:43.507 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), elemental_chaos_frost
3:44.748 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), elemental_chaos_frost
3:45.989 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(7), ice_strike, elemental_chaos_frost
3:47.266 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(3), hailstorm(7), ice_strike, elemental_chaos_frost
3:48.506 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(10), hailstorm(7), ice_strike, elemental_chaos_frost
3:49.746 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon, hailstorm(10), ice_strike, elemental_chaos_frost
3:50.874 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_frost
3:52.001 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_frost
3:53.128 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_frost
3:54.254 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_frost
3:55.381 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(2), hailstorm(6), forgestorm_ignited, elemental_chaos_frost
3:56.507 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(3), maelstrom_weapon, forgestorm_ignited, elemental_chaos_frost
3:57.668 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(3), maelstrom_weapon(2), ice_strike, forgestorm_ignited, elemental_chaos_frost
3:58.831 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(4), maelstrom_weapon(2), ice_strike, forgestorm_ignited, elemental_chaos_frost
3:59.990 single Q lava_lash Fluffy_Pillow 48854.4/50000: 98% mana splintered_elements, ashen_catalyst(5), maelstrom_weapon(3), ice_strike, forgestorm_ignited, elemental_chaos_frost
4:01.151 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(3), ice_strike, forgestorm_ignited, elemental_chaos_air
4:02.388 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(3), spiraling_winds, elemental_chaos_air
4:03.625 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hot_hand, maelstrom_weapon(3), spiraling_winds(2), elemental_chaos_air
4:04.863 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(4), spiraling_winds(2), sophic_devotion, elemental_chaos_air
4:06.103 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), hot_hand, maelstrom_weapon(6), spiraling_winds(3), sophic_devotion, elemental_chaos_air
4:07.341 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(7), spiraling_winds(4), sophic_devotion, elemental_chaos_air
4:08.578 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(9), spiraling_winds(5), sophic_devotion, elemental_chaos_air
4:09.816 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(10), ice_strike, spiraling_winds(5), sophic_devotion, elemental_chaos_air
4:11.052 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(10), ice_strike, spiraling_winds(6), sophic_devotion, elemental_chaos_air
4:12.291 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(6), sophic_devotion, elemental_chaos_air
4:13.491 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(3), spiraling_winds(7), sophic_devotion, elemental_chaos_air
4:14.693 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(3), spiraling_winds(8), sophic_devotion, elemental_chaos_air
4:15.895 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(5), spiraling_winds(8), sophic_devotion, elemental_chaos_air
4:17.098 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(4), hailstorm(5), spiraling_winds(9), sophic_devotion, elemental_chaos_air
4:18.297 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(2), spiraling_winds(9), sophic_devotion, elemental_chaos_air
4:19.499 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_air
4:20.701 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_air
4:21.903 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_air
4:23.140 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(3), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_air
4:24.380 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(4), hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_air
4:25.617 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_air
4:26.854 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_air
4:28.090 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(10), elemental_chaos_air
4:29.328 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), hot_hand, maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_air
4:30.566 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_air
4:31.802 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, spiraling_winds(10), elemental_chaos_air
4:33.041 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
4:34.281 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
4:35.518 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
4:36.755 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(10), hailstorm(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
4:37.993 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, stormbringer, maelstrom_weapon, hailstorm(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
4:39.118 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
4:40.243 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
4:41.369 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon, hailstorm(5), forgestorm_ignited, elemental_chaos_air
4:42.495 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), hot_hand, maelstrom_weapon(2), hailstorm(5), forgestorm_ignited, elemental_chaos_air
4:43.621 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(5), forgestorm_ignited, elemental_chaos_air
4:44.746 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_air
4:45.871 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), hot_hand, maelstrom_weapon(7), elemental_chaos_air
4:46.997 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(7), elemental_chaos_air
4:48.122 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(7), elemental_chaos_air
4:49.247 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(7), elemental_chaos_air
4:50.485 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(7), ice_strike, elemental_chaos_air
4:51.724 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(4), hailstorm(7), ice_strike, elemental_chaos_air
4:52.962 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(7), elemental_chaos_air
4:54.201 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(7), elemental_chaos_air
4:55.438 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(7), elemental_chaos_air
4:56.748 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), stormbringer, maelstrom_weapon(7), elemental_chaos_air
4:57.986 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, maelstrom_weapon(7), elemental_chaos_air
4:59.224 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hailstorm(7), elemental_chaos_air

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.82% 15.82% 1047
Haste 17.79% 17.79% 3025
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 65.95% 58.70% 3843
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +386 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1047
# gear_haste_rating=3025
# gear_mastery_rating=3843
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Gamba : 48171 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
48171.4 48171.4 85.4 / 0.177% 14909.9 / 31.0% 53.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
844.2 841.5 Mana 1.47% 52.2 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Gamba 48171
Ascendance (_dre) 0 (1065) 0.0% (2.2%) 8.4 30.59sec 38183 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.35 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1065 2.2% 8.4 30.59sec 38183 0 Direct 8.4 32006 64199 38184 19.2% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.35 8.35 0.00 0.00 0.00 0.0000 0.0000 318937.22 318937.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 6.75 0 19 32005.51 26454 55443 31919.21 0 49765 216035 216035 0.00%
crit 19.19% 1.60 0 8 64199.10 52908 108357 50819.82 0 101503 102902 102902 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 84 0.2% 3.7 90.41sec 6687 6113 Direct 3.7 6687 0 6687 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0940 0.0000 24966.32 35667.08 30.00% 6113.20 6113.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 6686.90 3838 14030 6702.15 5246 9417 24966 35667 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 7096 14.7% 25.1 11.76sec 84811 72205 Direct 25.1 70156 140396 84848 20.9% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.09 25.08 0.00 0.00 0.00 1.1746 0.0000 2128029.51 2128029.51 0.00% 72205.13 72205.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.08% 19.83 9 31 70155.82 45017 143209 70176.04 58462 82966 1391520 1391520 0.00%
crit 20.92% 5.25 0 15 140396.01 90033 296110 139693.75 0 225869 736510 736510 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [R]:25.09
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 1550 3.2% 30.0 9.85sec 15471 35026 Direct 30.0 2804 5630 3297 17.4% 0.0%
Periodic 186.8 1666 3347 1957 17.3% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.04 30.04 186.81 186.81 28.74 0.4417 1.5558 464686.16 464686.16 0.00% 1529.01 35025.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.55% 24.80 11 42 2804.48 2342 5016 2805.62 2557 3127 69538 69538 0.00%
crit 17.45% 5.24 0 15 5629.75 4685 9511 5600.12 0 7837 29499 29499 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.68% 154.46 108 202 1666.24 1 2984 1666.95 1539 1840 257368 257368 0.00%
crit 17.32% 32.35 14 58 3346.85 9 5892 3348.36 2957 3792 108282 108282 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [N]:1.29
  • if_expr:!ticking
    single
    [Z]:10.18
Flametongue Weapon 0 (1561) 0.0% (3.2%) 1.0 0.00sec 467542 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1561 3.2% 1129.8 0.67sec 414 0 Direct 1129.8 353 707 414 17.2% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1129.82 1129.82 0.00 0.00 0.00 0.0000 0.0000 467542.26 467542.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 934.98 627 1295 352.63 290 614 352.86 328 387 329706 329706 0.00%
crit 17.25% 194.84 114 292 707.44 580 1229 707.94 653 783 137836 137836 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1108 2.3% 28.9 7.65sec 11511 0 Direct 28.9 9805 19711 11511 17.2% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.88 28.88 0.00 0.00 0.00 0.0000 0.0000 332389.30 332389.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.78% 23.90 2 64 9804.70 9732 10030 9805.46 9732 10030 234355 234355 0.00%
crit 17.22% 4.97 0 19 19711.43 19463 20059 19299.45 0 20059 98034 98034 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1052 2.2% 16.7 16.79sec 18875 16112 Direct 16.7 16051 32370 18875 17.3% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.70 16.70 0.00 0.00 0.00 1.1715 0.0000 315297.95 315297.95 0.00% 16112.11 16112.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 13.81 1 29 16051.08 7567 32117 16118.74 12134 20732 221721 221721 0.00%
crit 17.31% 2.89 0 10 32370.45 15135 60870 30828.01 0 59070 93577 93577 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [X]:16.70
Ice Strike 1452 3.0% 20.3 14.87sec 21402 18473 Direct 20.3 18188 36534 21402 17.5% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.33 20.33 0.00 0.00 0.00 1.1586 0.0000 435101.58 435101.58 0.00% 18472.51 18472.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.48% 16.77 7 27 18188.01 15041 31584 18196.01 16256 20458 304996 304996 0.00%
crit 17.52% 3.56 0 13 36533.95 30081 62248 35726.20 0 55166 130106 130106 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:2.57
  • if_expr:buff.doom_winds_talent.up
    single
    [T]:17.76
Lava Lash 1374 2.9% 18.6 15.77sec 22201 18923 Direct 18.6 18908 37935 22201 17.3% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.56 18.56 0.00 0.00 0.00 1.1732 0.0000 412089.97 412089.97 0.00% 18923.17 18923.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 15.35 6 25 18907.70 15840 32778 18913.73 17032 21147 290226 290226 0.00%
crit 17.31% 3.21 0 11 37935.33 31680 62648 36699.66 0 61181 121864 121864 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [O]:4.17
  • if_expr:dot.flame_shock.refreshable
    single
    [U]:14.39
Lightning Bolt 2833 5.9% 16.5 17.00sec 51603 43918 Direct 16.5 42335 85148 51604 21.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.46 16.46 0.00 0.00 0.00 1.1750 0.0000 849496.41 849496.41 0.00% 43917.51 43917.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.35% 12.90 1 25 42335.13 28471 91069 42378.00 32144 55536 546050 546050 0.00%
crit 21.65% 3.56 0 12 85147.63 56942 189692 83161.98 0 149734 303446 303446 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [S]:4.14
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [V]:12.32
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1424 3.0% 162.9 2.15sec 2621 1542 Direct 162.9 2591 5208 2621 17.3% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 162.87 162.87 0.00 0.00 0.00 1.6992 0.0000 426851.06 609802.78 30.00% 1542.37 1542.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.32% 108.01 55 164 2590.87 2204 4445 2592.10 2359 2899 279840 399781 30.00%
crit 17.33% 28.23 10 52 5207.88 4408 8778 5209.85 4662 6007 147012 210022 30.00%
miss 16.35% 26.63 9 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 729 1.5% 166.6 2.09sec 1311 771 Direct 166.6 1298 2606 1311 17.3% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 166.62 166.62 0.00 0.00 0.00 1.6992 0.0000 218421.40 312038.53 30.00% 771.50 771.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.30% 110.46 53 162 1297.75 1102 2223 1298.36 1197 1428 143346 204786 30.00%
crit 17.29% 28.81 8 58 2606.32 2204 4389 2607.80 2363 2994 75075 107253 30.00%
miss 16.42% 27.35 8 51 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7867) 0.0% (16.3%) 92.0 3.25sec 25635 22057

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 91.96 0.00 0.00 0.00 0.00 1.1623 0.0000 0.00 0.00 0.00% 22056.88 22056.88

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:12.93
  • if_expr:buff.doom_winds_talent.up
    single
    [Q]:79.03
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Stormstrike (_mh) 4237 (5245) 8.8% (10.9%) 122.6 3.25sec 12816 0 Direct 122.6 (183.9) 8808 17717 10353 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.64 122.64 0.00 0.00 0.00 0.0000 0.0000 1269720.47 1813932.64 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 101.37 51 154 8808.04 2743 25394 8830.29 7299 10283 892892 1275593 30.00%
crit 17.34% 21.27 5 49 17717.41 5486 45800 17761.73 12130 23754 376828 538340 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 1008 2.1% 61.2 5.48sec 4933 0 Direct 61.2 4933 0 4933 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.24 61.24 0.00 0.00 0.00 0.0000 0.0000 302075.22 302075.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.24 21 115 4932.87 1205 20904 4948.69 3767 6409 302075 302075 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2118 (2622) 4.4% (5.4%) 122.6 3.25sec 6406 0 Direct 122.6 (183.9) 4404 8860 5175 17.3% (11.5%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.64 122.64 0.00 0.00 0.00 0.0000 0.0000 634729.89 906780.11 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 101.41 57 170 4403.89 1372 12697 4415.39 3835 5131 446583 637991 30.00%
crit 17.31% 21.23 4 43 8860.30 2743 22991 8881.29 5877 11507 188147 268789 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 504 1.0% 61.2 5.48sec 2465 0 Direct 61.2 2465 0 2465 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.24 61.24 0.00 0.00 0.00 0.0000 0.0000 150936.13 150936.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.24 21 115 2464.74 602 10610 2472.66 1934 3239 150936 150936 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1051 2.2% 6.4 49.17sec 49206 42437 Direct 6.4 41906 84110 49205 17.3% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.40 6.40 0.00 0.00 0.00 1.1596 0.0000 314923.70 314923.70 0.00% 42436.83 42436.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 5.29 1 9 41905.62 26739 89068 41971.61 26739 59424 221807 221807 0.00%
crit 17.30% 1.11 0 6 84109.98 53478 156959 58681.29 0 144842 93116 93116 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [M]:1.62
  • if_expr:buff.doom_winds_talent.up
    single
    [W]:4.78
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7147) 0.0% (14.8%) 1.0 0.00sec 2138556 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7147 14.8% 417.7 2.40sec 5120 0 Direct 417.7 4367 8753 5120 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 417.67 417.67 0.00 0.00 0.00 0.0000 0.0000 2138555.54 3055157.24 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.82% 345.92 189 515 4366.68 1488 12022 4366.13 3749 5165 1510545 2157977 30.00%
crit 17.18% 71.75 35 120 8752.78 2976 23284 8749.35 7043 10845 628010 897180 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 505 1.0% 33.7 8.42sec 4490 3199 Direct 33.7 3700 7441 4490 21.1% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.71 33.71 0.00 0.00 0.00 1.4033 0.0000 151339.46 151339.46 0.00% 3199.43 3199.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.90% 26.59 0 75 3700.27 3148 6270 3699.38 0 5296 98407 98407 0.00%
crit 21.10% 7.11 0 25 7441.37 6297 12540 7372.07 0 11500 52932 52932 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 293 0.6% 39.1 7.30sec 2242 1546 Direct 39.1 1851 3718 2243 21.0% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.08 39.08 0.00 0.00 0.00 1.4509 0.0000 87636.88 87636.88 0.00% 1545.57 1545.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.04% 30.89 0 78 1851.15 1574 3135 1851.17 0 2689 57179 57179 0.00%
crit 20.96% 8.19 0 26 3718.04 3148 6270 3695.72 0 5533 30457 30457 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (7078) 0.0% (14.7%) 27.5 8.59sec 76996 67010

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.50 0.00 0.00 0.00 0.00 1.1490 0.0000 0.00 0.00 0.00% 67010.18 67010.18

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:27.45
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [P]:0.05
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1924 (2274) 4.0% (4.7%) 36.7 8.59sec 18552 0 Direct 36.6 (49.2) 13393 26906 15708 17.1% (12.8%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.66 36.64 0.00 0.00 0.00 0.0000 0.0000 575545.45 575545.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.87% 30.36 0 97 13393.38 3919 35819 13376.35 0 20709 406685 406685 0.00%
crit 17.13% 6.28 0 25 26906.21 7838 67296 26486.16 0 53338 168861 168861 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 350 0.7% 12.5 18.25sec 8354 0 Direct 12.5 8354 0 8354 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.51 12.51 0.00 0.00 0.00 0.0000 0.0000 104516.24 104516.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.51 0 46 8353.76 3067 30330 8254.80 0 16917 104516 104516 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 962 (1136) 2.0% (2.4%) 36.7 8.59sec 9273 0 Direct 36.6 (49.2) 6698 13438 7852 17.1% (12.8%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.66 36.64 0.00 0.00 0.00 0.0000 0.0000 287702.34 287702.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.88% 30.37 0 91 6698.31 1959 17910 6689.63 0 10339 203413 203413 0.00%
crit 17.12% 6.27 0 26 13437.59 3919 33648 13186.91 0 26696 84289 84289 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 175 0.4% 12.5 18.25sec 4172 0 Direct 12.5 4172 0 4172 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.51 12.51 0.00 0.00 0.00 0.0000 0.0000 52198.12 52198.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.51 0 46 4172.08 1533 14814 4120.85 0 9071 52198 52198 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3668 7.6% 27.4 8.61sec 39986 0 Direct 27.4 33022 66271 39987 20.9% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.45 27.45 0.00 0.00 0.00 0.0000 0.0000 1097559.44 1097559.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.05% 21.70 0 63 33022.04 15817 60085 33028.92 0 50678 716560 716560 0.00%
crit 20.95% 5.75 0 21 66271.06 31634 118638 65142.85 0 107739 380999 380999 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 424 / 89
melee 424 0.2% 40.9 2.42sec 648 431 Direct 40.9 552 1104 648 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.89 40.89 0.00 0.00 0.00 1.5020 0.0000 26475.86 37823.63 30.00% 431.13 431.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 33.83 23 63 552.21 490 982 551.74 490 680 18679 26685 30.00%
crit 17.27% 7.06 0 21 1104.23 980 1844 1103.18 0 1508 7797 11139 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4032 / 2812
melee 4032 5.8% 365.9 1.63sec 2301 2015 Direct 365.9 1963 3921 2301 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 365.86 365.86 0.00 0.00 0.00 1.1421 0.0000 841825.92 1202639.12 30.00% 2014.65 2014.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 302.67 189 437 1962.72 1660 3348 1963.85 1820 2148 594051 848667 30.00%
crit 17.27% 63.20 30 107 3920.79 3321 6696 3923.41 3540 4475 247774 353973 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Gamba
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.2 309.36sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.15 0.00 0.00 0.00 0.00 1.0056 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Y]:1.15
Feral Spirit 14.7 21.43sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.70 0.00 0.00 0.00 0.00 1.1535 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:14.70
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.00
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 6.4 0.0 41.3sec 41.3sec 7.7sec 16.52% 91.45% 0.0 (0.0) 6.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 331.7s
  • trigger_min/max:6.0s / 331.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s

Stack Uptimes

  • ascendance_1:16.52%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.8sec 12.73% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.0s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.73%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.74%
  • crumbling_power_19:1.21%
  • crumbling_power_20:0.06%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds (_talent) 3.7 0.0 90.4sec 90.4sec 7.9sec 9.88% 11.42% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_doom_winds_talent
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_talent_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 14.7 0.0 24.0sec 21.0sec 17.5sec 69.71% 100.00% 0.0 (0.0) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.7s / 108.0s
  • trigger_min/max:6.7s / 45.8s
  • trigger_pct:49.99%
  • duration_min/max:0.0s / 116.8s

Stack Uptimes

  • earthen_weapon_2:67.53%
  • earthen_weapon_4:2.18%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.4 1.0 37.8sec 32.8sec 10.8sec 26.41% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 304.6s
  • trigger_min/max:1.7s / 304.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.7s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.41%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.4 1.0 37.6sec 32.8sec 10.7sec 26.42% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 267.5s
  • trigger_min/max:1.7s / 265.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.8s

Stack Uptimes

  • elemental_blast_haste_1:26.42%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.4 1.0 37.4sec 32.6sec 10.8sec 26.56% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 265.7s
  • trigger_min/max:1.7s / 265.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.2s

Stack Uptimes

  • elemental_blast_mastery_1:26.56%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.5sec 98.3sec 58.1sec 25.23% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 324.0s

Stack Uptimes

  • elemental_chaos_air_1:25.23%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.7sec 98.7sec 57.9sec 25.27% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 306.5s

Stack Uptimes

  • elemental_chaos_earth_1:25.27%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 123.0sec 98.6sec 58.3sec 24.69% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.7s

Stack Uptimes

  • elemental_chaos_fire_1:24.70%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.0sec 100.0sec 57.9sec 24.80% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:24.80%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0sec 0.0sec 29.4sec 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 11.9 2.8 26.1sec 21.4sec 17.5sec 69.72% 0.00% 59.4 (59.4) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 108.0s
  • trigger_min/max:7.2s / 45.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 116.7s

Stack Uptimes

  • feral_spirit_1:69.72%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.7 387.0 6.9sec 0.7sec 5.8sec 85.18% 90.83% 387.0 (919.2) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 67.7s
  • trigger_min/max:0.0s / 16.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.5s

Stack Uptimes

  • flurry_1:19.87%
  • flurry_2:34.71%
  • flurry_3:30.59%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 121.8 17.7sec 2.1sec 14.6sec 84.90% 100.00% 58.4 (58.4) 16.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 54.6s
  • trigger_min/max:0.0s / 40.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.57%
  • forceful_winds_2:13.72%
  • forceful_winds_3:12.41%
  • forceful_winds_4:10.61%
  • forceful_winds_5:33.58%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.5sec 46.5sec 12.9sec 19.46% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 207.7s
  • trigger_min/max:0.2s / 202.8s
  • trigger_pct:98.84%
  • duration_min/max:0.0s / 51.1s

Stack Uptimes

  • forgestorm_ignited_1:19.46%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 19.2 1.2 15.8sec 14.9sec 7.7sec 49.20% 79.30% 1.2 (1.2) 5.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.3s / 92.0s
  • trigger_min/max:8.3s / 92.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.3s

Stack Uptimes

  • ice_strike_1:49.20%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 23.2 20.3 12.8sec 6.8sec 8.0sec 61.65% 0.00% 20.3 (20.3) 22.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 80.2s
  • trigger_min/max:0.8s / 37.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.4s

Stack Uptimes

  • legacy_of_the_frost_witch_1:61.65%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 49.9 420.1 6.0sec 1.2sec 5.2sec 86.88% 100.00% 66.1 (70.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 48.5s
  • trigger_min/max:0.0s / 8.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.5s

Stack Uptimes

  • maelstrom_weapon_1:8.94%
  • maelstrom_weapon_2:10.46%
  • maelstrom_weapon_3:12.18%
  • maelstrom_weapon_4:12.68%
  • maelstrom_weapon_5:8.52%
  • maelstrom_weapon_6:7.22%
  • maelstrom_weapon_7:5.63%
  • maelstrom_weapon_8:4.76%
  • maelstrom_weapon_9:3.82%
  • maelstrom_weapon_10:12.68%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 61.5sec 46.1sec 16.5sec 23.52% 0.00% 1.1 (1.1) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 217.8s
  • trigger_min/max:0.0s / 205.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 63.5s

Stack Uptimes

  • sophic_devotion_1:23.52%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.1 60.6sec 45.5sec 16.5sec 23.71% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 216.8s
  • trigger_min/max:0.0s / 209.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s

Stack Uptimes

  • sophic_devotion_oh_1:23.71%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.5sec 45.3sec 32.2sec 38.45% 0.00% 25.9 (25.9) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 244.2s
  • trigger_min/max:0.0s / 194.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 205.9s

Stack Uptimes

  • spiraling_winds_1:2.36%
  • spiraling_winds_2:2.33%
  • spiraling_winds_3:2.32%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.25%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.22%
  • spiraling_winds_10:17.93%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 6.5 1.8 40.5sec 30.7sec 7.1sec 15.57% 100.00% 41.5 (41.5) 6.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 331.7s
  • trigger_min/max:0.8s / 331.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 33.5s

Stack Uptimes

  • static_accumulation_1:15.57%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 63.1 19.3 4.7sec 3.6sec 1.1sec 23.71% 52.48% 19.3 (19.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 79.5s
  • trigger_min/max:0.0s / 79.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • stormbringer_1:23.71%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.8 33.0 66.0 17.8s 15.0s 57.0s
Windfury-ForcefulWinds: 2 51.4 33.0 69.0 18.0s 0.4s 65.6s
Windfury-ForcefulWinds: 3 49.9 30.0 72.0 18.5s 0.4s 76.0s
Windfury-ForcefulWinds: 4 46.8 21.0 72.0 19.7s 0.5s 105.9s
Windfury-ForcefulWinds: 5 217.7 81.0 372.0 4.6s 0.0s 104.0s
windfury_totem_extra_attack_mh 28.0 11.0 50.0 10.5s 1.2s 137.7s
windfury_totem_extra_attack_oh 29.5 12.0 53.0 9.9s 0.1s 125.7s
Windfury: Unruly Winds 139.2 77.0 205.0 2.4s 0.0s 40.6s
Maelstrom Weapon: Feral Spirit 79.9 51.0 111.0 3.8s 0.0s 30.8s
Maelstrom Weapon: Elemental Assault 119.5 75.0 167.0 2.5s 0.8s 9.9s
Maelstrom Weapon: Static Accumulation 89.5 0.0 216.0 5.2s 1.0s 326.7s
Stormflurry 39.8 12.0 78.0 9.8s 0.8s 133.6s
Flametongue: Windfury Attack 417.7 231.0 615.0 2.4s 0.0s 40.6s
Stormbringer: Windfury Attack 44.0 14.0 80.0 7.7s 0.0s 102.9s
Maelstrom Weapon: Windfury Attack 83.5 41.0 135.0 4.6s 0.0s 70.9s
Flametongue: main_hand 136.2 67.0 203.0 2.6s 1.2s 57.8s
Maelstrom Weapon: main_hand 27.3 8.0 54.0 11.1s 1.2s 132.5s
Windfury: main_hand 51.9 16.0 84.0 6.2s 1.2s 97.8s
Flametongue: Windlash 33.7 0.0 94.0 8.4s 1.2s 326.6s
Maelstrom Weapon: Windlash 6.7 0.0 30.0 32.5s 1.2s 336.4s
Windfury: Windlash 12.7 0.0 40.0 19.6s 1.2s 328.0s
Flametongue: offhand 139.3 78.0 195.0 2.6s 1.2s 58.7s
Maelstrom Weapon: offhand 27.8 8.0 54.0 10.8s 1.2s 146.1s
Flametongue: Windlash Off-Hand 39.1 0.0 98.0 7.3s 0.1s 326.5s
Maelstrom Weapon: Windlash Off-Hand 7.8 0.0 31.0 29.1s 0.3s 322.6s
Flametongue: Sundering 6.4 3.0 9.0 49.2s 40.0s 153.0s
Stormbringer: Sundering 0.7 0.0 5.0 112.2s 40.0s 333.4s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 102.8s 40.0s 342.0s
Windfury: Sundering 3.1 0.0 9.0 88.3s 40.0s 343.4s
Flametongue: Windstrike 36.6 0.0 110.0 8.6s 0.8s 327.7s
Stormbringer: Windstrike 3.9 0.0 16.0 44.9s 0.8s 336.8s
Maelstrom Weapon: Windstrike 7.3 0.0 28.0 30.6s 0.8s 338.1s
Windfury: Windstrike 14.0 0.0 44.0 18.6s 0.8s 301.1s
Flametongue: Windstrike Off-Hand 36.6 0.0 110.0 8.6s 0.8s 327.7s
Stormbringer: Windstrike Off-Hand 3.8 0.0 17.0 45.5s 0.8s 336.6s
Maelstrom Weapon: Windstrike Off-Hand 7.3 0.0 27.0 30.8s 0.8s 310.2s
Flametongue: Lava Lash 18.6 10.0 26.0 15.8s 8.4s 79.2s
Stormbringer: Lava Lash 2.0 0.0 9.0 78.1s 8.9s 331.0s
Maelstrom Weapon: Lava Lash 3.7 0.0 12.0 58.3s 8.4s 335.9s
Flametongue: Ice Strike 20.3 11.0 29.0 14.9s 8.3s 92.0s
Stormbringer: Ice Strike 2.1 0.0 9.0 77.4s 8.4s 326.2s
Maelstrom Weapon: Ice Strike 4.1 0.0 13.0 57.3s 8.3s 326.8s
Windfury: Ice Strike 8.0 1.0 17.0 37.1s 8.3s 271.4s
Flametongue: Stormstrike 122.6 67.0 196.0 3.2s 0.8s 54.9s
Stormbringer: Stormstrike 13.0 1.0 30.0 22.0s 0.8s 261.6s
Maelstrom Weapon: Stormstrike 24.5 7.0 50.0 12.6s 0.8s 176.4s
Windfury: Stormstrike 49.5 18.0 89.0 7.0s 0.8s 83.7s
Flametongue: Stormstrike Off-Hand 122.6 67.0 196.0 3.2s 0.8s 54.9s
Stormbringer: Stormstrike Off-Hand 13.0 2.0 31.0 22.0s 0.8s 291.9s
Maelstrom Weapon: Stormstrike Off-Hand 24.5 8.0 51.0 12.6s 0.8s 172.2s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 26.36% 13.80% 42.90% 0.8s 0.0s 29.7s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7910.0011.46910.2442.38217.910
Doom Winds0.5310.0012.4021.1230.0004.797
Sundering9.5920.001112.99549.4173.680185.256
Windstrike1.0470.0013.93928.5360.00077.268
Lava Lash4.1100.00167.01070.26419.696153.640
Flame Shock21.1680.001212.431219.48243.993321.816
Ice Strike3.3910.00179.80063.07012.437139.996
Frost Shock12.4830.001152.931189.83313.008288.296
Elemental Blast3.9190.00144.9003.2230.00046.384
Stormstrike1.0510.0015.05292.02945.703150.625
Earth Elemental9.3380.00242.8601.3460.00042.860

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Gamba
mana_regenMana669.29252450.63100.00%377.19226944.0547.34%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 841.51 844.17 226943.2 49201.1 43982.4 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Gamba
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 25.0934500.571375.001375.0061.68
Flame ShockMana 11.478604.55750.00286.4854.00
Frost ShockMana 16.708351.95500.00499.9937.75
Ice StrikeMana 20.3333544.211650.001649.9612.97
Lava LashMana 18.567424.66400.00399.9955.50
Lightning BoltMana 16.468231.37500.00500.02103.20
StormstrikeMana 122.64122641.911000.001333.6319.22
SunderingMana 6.4019200.243000.003000.0116.40

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Gamba Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Gamba Damage Per Second
Count 7499
Mean 48171.36
Minimum 36392.47
Maximum 63940.75
Spread ( max - min ) 27548.28
Range [ ( max - min ) / 2 * 100% ] 28.59%
Standard Deviation 3771.5186
5th Percentile 42351.94
95th Percentile 54733.48
( 95th Percentile - 5th Percentile ) 12381.55
Mean Distribution
Standard Deviation 43.5526
95.00% Confidence Interval ( 48086.00 - 48256.72 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 236
0.1% Error 23548
0.1 Scale Factor Error with Delta=300 121428
0.05 Scale Factor Error with Delta=300 485710
0.01 Scale Factor Error with Delta=300 12142726
Priority Target DPS
PR_Shaman_Enhancement_Gamba Priority Target Damage Per Second
Count 7499
Mean 48171.36
Minimum 36392.47
Maximum 63940.75
Spread ( max - min ) 27548.28
Range [ ( max - min ) / 2 * 100% ] 28.59%
Standard Deviation 3771.5186
5th Percentile 42351.94
95th Percentile 54733.48
( 95th Percentile - 5th Percentile ) 12381.55
Mean Distribution
Standard Deviation 43.5526
95.00% Confidence Interval ( 48086.00 - 48256.72 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 236
0.1% Error 23548
0.1 Scale Factor Error with Delta=300 121428
0.05 Scale Factor Error with Delta=300 485710
0.01 Scale Factor Error with Delta=300 12142726
DPS(e)
PR_Shaman_Enhancement_Gamba Damage Per Second (Effective)
Count 7499
Mean 48171.36
Minimum 36392.47
Maximum 63940.75
Spread ( max - min ) 27548.28
Range [ ( max - min ) / 2 * 100% ] 28.59%
Damage
PR_Shaman_Enhancement_Gamba Damage
Count 7499
Mean 13561248.02
Minimum 8767088.70
Maximum 19242761.11
Spread ( max - min ) 10475672.41
Range [ ( max - min ) / 2 * 100% ] 38.62%
DTPS
PR_Shaman_Enhancement_Gamba Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Gamba Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Gamba Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Gamba Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Gamba Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Gamba Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_GambaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Gamba Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.00 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 14.70 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
G 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 27.45 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
K 12.93 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
L 2.57 ice_strike,if=buff.doom_winds_talent.up
M 1.62 sundering,if=buff.doom_winds_talent.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
N 1.29 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 frost_shock,if=buff.hailstorm.up
O 4.17 lava_lash,if=dot.flame_shock.refreshable
P 0.05 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
Q 79.03 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 25.09 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
S 4.14 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
0.00 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
T 17.76 ice_strike
U 14.39 lava_lash
0.00 bag_of_tricks
V 12.32 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 4.78 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
X 16.70 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Y 1.15 earth_elemental
Z 10.18 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGKLKKKMNRKUXTQQRQXVFUQTXRQQVXQUVQTRXYQZVQQUTVXFQWRQJJTJQJFJJOQRQTXRQZXUQQQQFJRJTUQQQGJJJFKKQRQTOWXQRZXQTUXQRQQQVQFRTQQUVQVXZTQQJJRFQRQTUVQVWXZQQQRQFTUVQXZEDQGLRKKSKKQJFJJJORQTWQRQVQUXRQFQQQQSQQRQTUVQXZVQFRQTUWVQQJJRJTUQFSQQRQQJTJJUBVGKFRKKKQSQQTROQQVWQQRQQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 2 augmentation PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_frost
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_frost
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, crumbling_power(20), elemental_chaos_frost
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, crumbling_power(20), elemental_chaos_frost
0:00.869 default G doom_winds Fluffy_Pillow 40640.4/50000: 81% mana bloodlust, berserking, feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_frost
0:01.735 single K stormstrike Fluffy_Pillow 42026.0/50000: 84% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), doom_winds_talent, crumbling_power(19), elemental_chaos_frost
0:02.602 single L ice_strike Fluffy_Pillow 42413.2/50000: 85% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), doom_winds_talent, crumbling_power(18), elemental_chaos_frost
0:03.470 single K stormstrike Fluffy_Pillow 42152.0/50000: 84% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds_talent, ice_strike, crumbling_power(17), elemental_chaos_frost
0:04.338 single K stormstrike Fluffy_Pillow 42540.8/50000: 85% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds_talent, ice_strike, crumbling_power(16), elemental_chaos_frost
0:05.205 single K stormstrike Fluffy_Pillow 42928.0/50000: 86% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(15), elemental_chaos_frost
0:06.073 single M sundering Fluffy_Pillow 43316.8/50000: 87% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(14), elemental_chaos_frost
0:06.939 single N flame_shock Fluffy_Pillow 41702.4/50000: 83% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(13), forgestorm_ignited, elemental_chaos_frost
0:07.806 single R elemental_blast Fluffy_Pillow 42339.6/50000: 85% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(12), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:08.674 single K stormstrike Fluffy_Pillow 42353.4/50000: 85% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:09.541 single U lava_lash Fluffy_Pillow 42740.6/50000: 85% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(10), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:10.409 single X frost_shock Fluffy_Pillow 43729.4/50000: 87% mana bloodlust, berserking, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(9), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:11.276 single T ice_strike Fluffy_Pillow 44616.6/50000: 89% mana bloodlust, berserking, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, crumbling_power(8), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:12.145 single Q stormstrike Fluffy_Pillow 44357.0/50000: 89% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:13.099 single Q stormstrike Fluffy_Pillow 44883.4/50000: 90% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, crumbling_power(6), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:14.054 single R elemental_blast Fluffy_Pillow 44411.4/50000: 89% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(5), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:15.007 single Q stormstrike Fluffy_Pillow 44561.2/50000: 89% mana bloodlust, elemental_blast_mastery, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:15.959 single X frost_shock Fluffy_Pillow 45084.4/50000: 90% mana bloodlust, flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:16.914 single V lightning_bolt Fluffy_Pillow 46112.4/50000: 92% mana bloodlust, flurry(2), elemental_blast_mastery, maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power(2), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:17.867 default F feral_spirit Fluffy_Pillow 47137.2/50000: 94% mana bloodlust, elemental_blast_mastery, legacy_of_the_frost_witch, crumbling_power, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:18.953 single U lava_lash Fluffy_Pillow 48874.8/50000: 98% mana bloodlust, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:19.908 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, sophic_devotion_oh, elemental_chaos_frost
0:20.864 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_frost
0:21.818 single X frost_shock Fluffy_Pillow 49876.4/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, sophic_devotion_oh, elemental_chaos_frost
0:22.772 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), sophic_devotion_oh, elemental_chaos_frost
0:23.724 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:24.648 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:25.573 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:26.500 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:27.426 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:28.351 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_frost
0:29.278 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), sophic_devotion_oh, elemental_chaos_frost
0:30.203 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:31.128 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:32.054 single R elemental_blast Fluffy_Pillow 49831.6/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:32.979 single X frost_shock Fluffy_Pillow 49936.6/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:33.933 single Y earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:34.886 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_frost
0:35.840 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_frost
0:36.794 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, maelstrom_weapon(5), sophic_devotion_oh, elemental_chaos_frost
0:37.748 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:38.703 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:39.659 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:40.613 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
0:41.985 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(5), ice_strike, sophic_devotion_oh, elemental_chaos_frost
0:43.223 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, ice_strike, sophic_devotion_oh, elemental_chaos_frost
0:44.462 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, sophic_devotion_oh, elemental_chaos_frost
0:45.699 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, sophic_devotion_oh, elemental_chaos_frost
0:46.938 single W sundering Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:48.175 single R elemental_blast Fluffy_Pillow 48961.6/50000: 98% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:49.413 single Q stormstrike Fluffy_Pillow 49567.4/50000: 99% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
0:50.652 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
0:51.890 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
0:53.132 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
0:54.372 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
0:55.612 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
0:56.849 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
0:58.088 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
0:59.328 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:00.567 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
1:01.769 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
1:02.969 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
1:04.170 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
1:05.371 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_air
1:06.536 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_air
1:07.701 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_air
1:08.867 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:10.034 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:11.200 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:12.364 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:13.529 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
1:14.694 Waiting     1.006 sec 50000.0/50000: 100% mana elemental_blast_critical_strike, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_air
1:15.700 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_air
1:17.093 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(4), elemental_chaos_air
1:18.293 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(6), elemental_chaos_air
1:19.494 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, stormbringer, maelstrom_weapon(7), elemental_chaos_air
1:20.695 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, forceful_winds, maelstrom_weapon(10), static_accumulation, elemental_chaos_air
1:21.895 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, elemental_chaos_air
1:23.095 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, elemental_chaos_air
1:24.295 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_air
1:25.494 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_air
1:26.697 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:27.896 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:29.096 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_air
1:30.298 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_air
1:31.499 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, elemental_chaos_air
1:32.699 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, elemental_chaos_air
1:33.900 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:35.099 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:36.299 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(10), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
1:37.498 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_air
1:38.697 single K stormstrike Fluffy_Pillow 49918.4/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
1:39.898 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
1:41.099 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), sophic_devotion, elemental_chaos_air
1:42.300 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
1:43.500 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
1:44.700 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
1:45.902 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
1:47.103 single X frost_shock Fluffy_Pillow 48921.6/50000: 98% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_air
1:48.304 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), sophic_devotion, elemental_chaos_air
1:49.503 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), sophic_devotion, elemental_chaos_air
1:50.702 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, earthen_weapon(2), sophic_devotion, elemental_chaos_air
1:51.868 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon, sophic_devotion, elemental_chaos_air
1:53.033 Waiting     0.895 sec 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon, elemental_chaos_air
1:53.928 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon, elemental_chaos_air
1:55.312 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(3), elemental_chaos_air
1:56.478 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, maelstrom_weapon(3), ice_strike, elemental_chaos_air
1:57.644 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, maelstrom_weapon(4), ice_strike, elemental_chaos_air
1:58.810 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(5), elemental_chaos_air
1:59.975 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(7), elemental_chaos_air
2:01.174 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), legacy_of_the_frost_witch, elemental_chaos_fire
2:02.377 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
2:03.580 single Q stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
2:04.781 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_fire
2:05.984 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds, forgestorm_ignited, elemental_chaos_fire
2:07.188 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
2:08.392 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
2:09.595 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
2:10.798 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, spiraling_winds(4), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
2:12.002 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(4), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
2:13.204 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(5), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
2:14.405 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), ice_strike, spiraling_winds(5), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
2:15.609 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
2:16.810 single V lightning_bolt Fluffy_Pillow 48921.6/50000: 98% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
2:18.012 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), sophic_devotion, elemental_chaos_fire
2:19.216 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(8), sophic_devotion, elemental_chaos_fire
2:20.454 Waiting     0.976 sec 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(8), sophic_devotion, elemental_chaos_fire
2:21.430 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(9), sophic_devotion, elemental_chaos_fire
2:22.915 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(4), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_fire
2:24.153 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10), elemental_chaos_fire
2:25.389 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), forceful_winds(5), maelstrom_weapon(10), static_accumulation, ice_strike, spiraling_winds(10), elemental_chaos_fire
2:26.628 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, forceful_winds(5), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:27.867 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:29.105 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_fire
2:30.345 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
2:31.582 single R elemental_blast Fluffy_Pillow 49979.2/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
2:33.045 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
2:34.248 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_fire
2:35.450 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
2:36.652 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
2:37.852 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
2:39.057 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
2:40.260 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
2:41.463 single X frost_shock Fluffy_Pillow 48924.8/50000: 98% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
2:42.666 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
2:43.902 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
2:45.142 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), stormbringer, maelstrom_weapon(9), sophic_devotion, elemental_chaos_fire
2:46.379 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), stormbringer, maelstrom_weapon(10), sophic_devotion, elemental_chaos_fire
2:47.618 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
2:48.857 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
2:50.059 default F feral_spirit Fluffy_Pillow 49923.2/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
2:51.262 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
2:52.464 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
2:53.666 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), ice_strike, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
2:54.868 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
2:56.069 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
2:57.272 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
2:58.473 Waiting     1.314 sec 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
2:59.787 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:00.000 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_air
3:00.000 Waiting     0.594 sec 50000.0/50000: 100% mana berserking, flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), crumbling_power(20), forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_air
3:00.594 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), crumbling_power(20), sophic_devotion, sophic_devotion_oh, elemental_chaos_air
3:01.932 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), crumbling_power(19), sophic_devotion, elemental_chaos_air
3:03.025 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), doom_winds_talent, crumbling_power(19), sophic_devotion, elemental_chaos_air
3:04.117 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(9), doom_winds_talent, ice_strike, crumbling_power(18), sophic_devotion, elemental_chaos_air
3:05.208 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(4), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(17), sophic_devotion, elemental_chaos_air
3:06.299 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(8), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(16), sophic_devotion, elemental_chaos_air
3:07.389 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(10), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), sophic_devotion, elemental_chaos_air
3:08.478 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, forceful_winds(5), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_air
3:09.568 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_air
3:10.658 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_air
3:11.749 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_air
3:12.841 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_air
3:14.042 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_air
3:15.242 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_air
3:16.442 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_air
3:17.642 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_air
3:18.843 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_air
3:20.043 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
3:21.208 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
3:22.376 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:23.542 single Q stormstrike Fluffy_Pillow 48865.6/50000: 98% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:24.708 single R elemental_blast Fluffy_Pillow 49731.2/50000: 99% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, elemental_chaos_air
3:25.875 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, elemental_chaos_air
3:27.041 single V lightning_bolt Fluffy_Pillow 49865.6/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_air
3:28.207 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:29.372 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:30.574 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:31.773 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_air
3:33.006 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, forceful_winds(5), stormbringer, elemental_chaos_air
3:34.206 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(3), elemental_chaos_air
3:35.407 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), elemental_chaos_air
3:36.608 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(6), elemental_chaos_air
3:37.806 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), elemental_chaos_air
3:39.006 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(9), elemental_chaos_air
3:40.206 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_air
3:41.407 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
3:42.606 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_air
3:43.806 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, elemental_chaos_air
3:45.007 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
3:46.173 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:47.339 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:48.505 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:49.669 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:50.834 single X frost_shock Fluffy_Pillow 49864.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:51.998 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:53.163 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
3:54.327 Waiting     0.985 sec 50000.0/50000: 100% mana sophic_devotion, elemental_chaos_air
3:55.312 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, maelstrom_weapon(2), sophic_devotion, elemental_chaos_air
3:56.728 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(4), sophic_devotion, elemental_chaos_air
3:57.929 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), sophic_devotion, elemental_chaos_air
3:59.128 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
4:00.292 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:01.492 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:02.696 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:03.897 single V lightning_bolt Fluffy_Pillow 48921.6/50000: 98% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, forgestorm_ignited, elemental_chaos_earth
4:05.099 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, forgestorm_ignited, elemental_chaos_earth
4:06.301 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, forgestorm_ignited, elemental_chaos_earth
4:07.501 single J windstrike Fluffy_Pillow 49920.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, forgestorm_ignited, elemental_chaos_earth
4:08.704 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:09.943 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:11.182 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:12.385 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(8), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:13.589 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds, forgestorm_ignited, elemental_chaos_earth
4:14.794 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_earth
4:15.994 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, maelstrom_weapon(9), ice_strike, spiraling_winds(2), forgestorm_ignited, elemental_chaos_earth
4:17.196 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(2), forgestorm_ignited, elemental_chaos_earth
4:18.398 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), forgestorm_ignited, elemental_chaos_earth
4:19.601 single Q stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth
4:20.804 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, elemental_chaos_earth
4:22.043 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth
4:23.283 single Q stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth
4:24.521 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth
4:25.760 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
4:26.998 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, spiraling_winds(7), elemental_chaos_earth
4:28.235 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth
4:29.475 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
4:30.713 default B potion Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
4:30.713 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:31.951 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:33.190 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(4), stormbringer, maelstrom_weapon(3), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:34.430 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(7), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:35.667 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:36.905 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:38.144 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), doom_winds_talent, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:39.383 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:40.622 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:41.862 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:43.099 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:44.338 single Q stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:45.577 single T ice_strike Fluffy_Pillow 49964.8/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:46.814 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:48.052 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:49.253 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:50.455 single Q stormstrike Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:51.658 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:52.860 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, ice_strike, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:54.063 single Q stormstrike Fluffy_Pillow 48924.8/50000: 98% mana flurry, elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(2), ice_strike, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:55.264 single Q stormstrike Fluffy_Pillow 49846.4/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(3), ice_strike, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:56.467 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(6), ice_strike, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:57.670 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:58.871 single Q stormstrike Fluffy_Pillow 49921.6/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.51% 21.51% 3656
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 59.31% 52.07% 3246
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Gamba"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Phys : 46664 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
46664.2 46664.2 50.2 / 0.108% 8694.2 / 18.6% 51.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
849.4 846.5 Mana 1.90% 52.1 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Phys 46664
Ascendance 0 (352) 0.0% (0.7%) 2.0 180.43sec 52134 48161

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0826 0.0000 0.00 0.00 0.00% 48160.75 48160.75

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [G]:2.00
  • if_expr:(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
    Ascendance (_damage) 352 0.7% 2.0 180.43sec 52134 0 Direct 2.0 43771 88001 52135 18.9% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 104268.03 104268.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 1.62 0 2 43770.67 38272 56262 42203.09 0 56262 70988 70988 0.00%
crit 18.91% 0.38 0 2 88001.47 76545 109483 30133.63 0 108440 33280 33280 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 82 0.2% 3.7 90.48sec 6577 6014 Direct 3.7 6577 0 6577 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0939 0.0000 24481.57 34974.56 30.00% 6013.65 6013.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.72 3 4 6577.33 3838 10609 6598.23 5329 8596 24482 34975 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.72
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6671 14.3% 24.7 11.69sec 80984 68307 Direct 24.7 66882 134271 81023 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.72 24.71 0.00 0.00 0.00 1.1856 0.0000 2002222.98 2002222.98 0.00% 68307.28 68307.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.01% 19.53 10 29 66881.99 45017 137968 66867.03 55729 83915 1305915 1305915 0.00%
crit 20.99% 5.19 0 14 134271.05 90033 269787 133756.52 0 216478 696308 696308 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [S]:24.72
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 1551 3.3% 32.9 8.86sec 14161 28740 Direct 32.9 2775 5573 3261 17.4% 0.0%
Periodic 183.1 1666 3344 1957 17.3% 0.0% 95.5%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.87 32.87 183.08 183.08 31.71 0.4928 1.5645 465443.71 465443.71 0.00% 1538.04 28739.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 27.16 13 43 2774.93 2342 4834 2774.23 2515 3183 75362 75362 0.00%
crit 17.37% 5.71 0 15 5573.31 4685 9328 5548.44 0 8085 31822 31822 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.65% 151.32 106 201 1665.59 7 2946 1665.24 1539 1868 252037 252037 0.00%
crit 17.35% 31.76 13 59 3344.27 10 5837 3343.84 2950 3765 106222 106222 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [O]:1.15
  • if_expr:!ticking
    single
    [b]:12.62
Flametongue Weapon 0 (1528) 0.0% (3.3%) 1.0 0.00sec 457533 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1528 3.3% 1086.5 0.68sec 421 0 Direct 1086.5 359 720 421 17.2% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1086.54 1086.54 0.00 0.00 0.00 0.0000 0.0000 457533.43 457533.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.77% 899.28 615 1212 358.93 290 614 359.05 334 403 322781 322781 0.00%
crit 17.23% 187.26 106 281 719.61 580 1229 719.91 665 818 134752 134752 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1109 2.4% 28.9 7.60sec 11531 0 Direct 28.9 9806 19720 11531 17.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.86 28.86 0.00 0.00 0.00 0.0000 0.0000 332834.89 332834.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 23.84 2 63 9806.22 9732 10030 9805.92 9732 10030 233802 233802 0.00%
crit 17.40% 5.02 0 18 19719.86 19463 20059 19348.87 0 20059 99033 99033 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1223 2.6% 20.0 13.86sec 18389 15470 Direct 20.0 15656 31500 18389 17.2% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.99 19.99 0.00 0.00 0.00 1.1887 0.0000 367643.04 367643.04 0.00% 15469.94 15469.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 16.54 4 30 15655.67 7567 31069 15691.64 12513 19168 259011 259011 0.00%
crit 17.25% 3.45 0 12 31500.00 15135 57910 30584.47 0 55306 108632 108632 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [Z]:19.99
Ice Strike 1498 3.2% 21.2 14.15sec 21241 18183 Direct 21.2 18061 36243 21240 17.5% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.17 21.17 0.00 0.00 0.00 1.1682 0.0000 449645.94 449645.94 0.00% 18182.94 18182.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 17.47 9 26 18061.42 15041 31988 18056.81 16133 20188 315477 315477 0.00%
crit 17.49% 3.70 0 12 36242.69 30081 61655 35501.85 0 54711 134169 134169 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:2.37
  • if_expr:buff.doom_winds_talent.up
    single
    [V]:18.80
Lava Lash 1400 3.0% 19.1 14.95sec 22027 18579 Direct 19.1 18715 37589 22027 17.5% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.09 19.09 0.00 0.00 0.00 1.1856 0.0000 420480.23 420480.23 0.00% 18579.01 18579.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.46% 15.74 6 25 18715.28 15840 32466 18706.35 16867 21504 294583 294583 0.00%
crit 17.54% 3.35 0 14 37589.25 31680 63875 36437.50 0 60224 125897 125897 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [P]:2.58
  • if_expr:dot.flame_shock.refreshable
    single
    [W]:16.51
Lightning Bolt 3034 6.5% 18.1 15.43sec 50269 42586 Direct 18.1 41324 82829 50270 21.6% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.13 18.13 0.00 0.00 0.00 1.1804 0.0000 911467.38 911467.38 0.00% 42585.96 42585.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.45% 14.22 4 27 41324.16 28471 93984 41330.78 32557 51775 587790 587790 0.00%
crit 21.55% 3.91 0 12 82828.75 56942 189692 81350.89 0 136291 323677 323677 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [T]:4.08
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [X]:14.05
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1466 3.2% 172.1 1.93sec 2558 1437 Direct 172.1 2530 5085 2558 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 172.13 172.13 0.00 0.00 0.00 1.7803 0.0000 440375.77 629124.28 30.00% 1437.05 1437.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.24% 114.01 71 160 2529.67 2204 4405 2528.42 2334 2818 288421 412040 30.00%
crit 17.36% 29.88 12 52 5085.36 4408 8778 5082.51 4609 5659 151955 217084 30.00%
miss 16.40% 28.24 9 52 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 743 1.6% 173.8 2.01sec 1283 721 Direct 173.8 1269 2552 1283 17.3% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 173.83 173.83 0.00 0.00 0.00 1.7793 0.0000 223108.14 318734.04 30.00% 721.34 721.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.28% 115.22 69 163 1269.43 1102 2195 1268.92 1172 1418 146260 208948 30.00%
crit 17.32% 30.11 11 55 2552.34 2204 4400 2550.98 2296 2904 76848 109786 30.00%
miss 16.40% 28.51 11 50 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7198) 0.0% (15.5%) 88.7 3.20sec 24366 20563

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 88.74 0.00 0.00 0.00 0.00 1.1849 0.0000 0.00 0.00 0.00% 20562.68 20562.68

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:5.68
  • if_expr:buff.doom_winds_talent.up
    single
    [R]:70.42
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    single
    [U]:12.65
    Stormstrike (_mh) 3896 (4800) 8.4% (10.3%) 118.5 3.20sec 12172 0 Direct 118.5 (176.6) 8395 16894 9879 17.5% (11.7%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.47 118.47 0.00 0.00 0.00 0.0000 0.0000 1170426.94 1672081.11 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.54% 97.79 51 153 8395.20 2743 21526 8406.78 7369 9930 820927 1172783 30.00%
crit 17.46% 20.69 6 42 16894.44 5486 42410 16924.41 11679 22719 349500 499298 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 904 1.9% 58.2 5.43sec 4671 0 Direct 58.2 4671 0 4671 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.16 58.16 0.00 0.00 0.00 0.0000 0.0000 271640.82 271640.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 58.16 21 107 4670.87 1205 19428 4680.84 3560 6082 271641 271641 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 1946 (2397) 4.2% (5.2%) 118.5 3.20sec 6078 0 Direct 118.5 (176.6) 4198 8440 4933 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.47 118.47 0.00 0.00 0.00 0.0000 0.0000 584450.53 834950.62 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 97.95 51 161 4198.33 1372 10763 4204.19 3616 4993 411212 587460 30.00%
crit 17.33% 20.53 5 42 8439.88 2743 20882 8451.26 5734 11817 173239 247490 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 451 1.0% 58.2 5.43sec 2332 0 Direct 58.2 2332 0 2332 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.16 58.16 0.00 0.00 0.00 0.0000 0.0000 135626.84 135626.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 58.16 21 107 2332.10 602 9371 2337.05 1775 3138 135627 135627 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1038 2.2% 6.6 46.71sec 47520 40640 Direct 6.6 40365 81328 47519 17.5% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.55 6.55 0.00 0.00 0.00 1.1694 0.0000 311259.34 311259.34 0.00% 40639.68 40639.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.53% 5.41 1 9 40364.92 26739 86345 40379.94 28044 57940 218219 218219 0.00%
crit 17.47% 1.14 0 6 81328.08 53478 161664 57540.21 0 156379 93041 93041 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [N]:0.78
  • if_expr:buff.doom_winds_talent.up
    single
    [Y]:5.77
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7276) 0.0% (15.6%) 1.0 0.00sec 2174470 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7276 15.6% 410.2 2.45sec 5300 0 Direct 410.2 4524 9037 5300 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 410.25 410.25 0.00 0.00 0.00 0.0000 0.0000 2174470.42 3106465.52 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.79% 339.67 193 494 4523.83 1488 11725 4528.63 3942 5373 1536575 2195163 30.00%
crit 17.21% 70.58 32 125 9037.26 2976 23450 9046.88 7143 11529 637895 911302 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 454 1.0% 24.0 10.21sec 5597 4123 Direct 24.0 4626 9291 5597 20.8% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.02 24.02 0.00 0.00 0.00 1.3576 0.0000 134409.49 134409.49 0.00% 4122.74 4122.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.18% 19.02 8 28 4625.62 3540 6270 4626.12 4167 5507 87961 87961 0.00%
crit 20.82% 5.00 0 15 9291.34 7080 12540 9248.96 0 12411 46449 46449 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 239 0.5% 25.2 9.69sec 2804 2052 Direct 25.2 2317 4660 2804 20.8% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.21 25.21 0.00 0.00 0.00 1.3664 0.0000 70684.59 70684.59 0.00% 2052.04 2052.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.23% 19.97 12 30 2317.34 1770 3135 2317.24 2056 2717 46285 46285 0.00%
crit 20.77% 5.24 0 14 4659.57 3540 6270 4639.96 0 5769 24400 24400 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (7005) 0.0% (14.8%) 20.3 9.99sec 102137 103957

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.29 0.00 0.00 0.00 0.00 0.9825 0.0000 0.00 0.00 0.00% 103957.07 103957.07

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [K]:20.29
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [Q]:0.01
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1936 (2371) 4.1% (5.0%) 27.0 9.99sec 25936 0 Direct 27.0 (38.7) 18129 36360 21178 16.7% (11.7%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.05 27.05 0.00 0.00 0.00 0.0000 0.0000 572762.06 572762.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.27% 22.52 12 38 18128.93 5341 32891 18247.70 13617 23791 408296 408296 0.00%
crit 16.73% 4.52 0 15 36359.59 10757 64590 36257.45 0 57191 164466 164466 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 435 0.9% 11.7 17.74sec 11030 0 Direct 11.7 11030 0 11030 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.67 11.67 0.00 0.00 0.00 0.0000 0.0000 128688.55 128688.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.67 2 20 11030.18 3392 29480 11021.56 7685 17313 128689 128689 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 967 (1185) 2.1% (2.5%) 27.0 9.99sec 12966 0 Direct 27.0 (38.7) 9063 18194 10584 16.7% (11.6%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.05 27.05 0.00 0.00 0.00 0.0000 0.0000 286247.53 286247.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.34% 22.54 11 39 9062.85 2670 16446 9123.16 6842 11983 204274 204274 0.00%
crit 16.66% 4.51 0 14 18194.41 5341 32258 18097.15 0 29839 81974 81974 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 218 0.5% 11.7 17.74sec 5522 0 Direct 11.7 5522 0 5522 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.67 11.67 0.00 0.00 0.00 0.0000 0.0000 64426.27 64426.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.67 2 20 5522.01 1697 14163 5517.59 4057 8863 64426 64426 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3449 7.3% 20.3 9.99sec 50310 0 Direct 20.3 41659 83641 50310 20.6% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.29 20.29 0.00 0.00 0.00 0.0000 0.0000 1020571.68 1020571.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.39% 16.11 8 23 41658.91 18967 60196 41652.87 36555 49321 670931 670931 0.00%
crit 20.61% 4.18 0 12 83640.66 38693 116022 82668.16 0 109915 349640 349640 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 414 / 86
melee 414 0.2% 39.4 2.42sec 650 421 Direct 39.4 554 1108 650 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.38 39.38 0.00 0.00 0.00 1.5455 0.0000 25599.79 36572.06 30.00% 420.68 420.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 32.55 21 56 554.18 490 909 553.62 490 680 18039 25770 30.00%
crit 17.34% 6.83 0 17 1107.69 980 1706 1105.81 0 1439 7561 10802 29.97%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4354 / 2712
melee 4354 5.8% 342.7 1.73sec 2365 2110 Direct 342.7 2019 4028 2365 17.2% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 342.74 342.74 0.00 0.00 0.00 1.1210 0.0000 810640.17 1158086.91 30.00% 2109.79 2109.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 283.62 202 370 2018.55 1660 3306 2019.12 1880 2325 572499 817877 30.00%
crit 17.25% 59.12 30 101 4027.90 3321 6611 4029.20 3683 4613 238141 340210 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Phys
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.70sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 306.29sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.14 0.00 0.00 0.00 0.00 1.0081 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [a]:1.15
Feral Spirit 13.5 23.98sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.52 0.00 0.00 0.00 0.00 1.1405 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:13.52
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.50
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 95.74% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 180.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.2s / 182.7s
  • trigger_min/max:180.2s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.6sec 5.5sec 18.8sec 12.74% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.5s
  • trigger_min/max:0.0s / 164.2s
  • trigger_pct:100.00%
  • duration_min/max:17.1s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.72%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.70%
  • crumbling_power_7:0.70%
  • crumbling_power_8:0.68%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.71%
  • crumbling_power_18:1.24%
  • crumbling_power_19:0.84%
  • crumbling_power_20:0.02%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds (_talent) 3.7 0.0 90.5sec 90.5sec 7.9sec 9.85% 12.51% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_doom_winds_talent
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.6s
  • trigger_min/max:90.0s / 92.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_talent_1:9.85%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 13.5 0.0 25.9sec 22.8sec 17.5sec 62.28% 100.00% 0.0 (0.0) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.6s / 70.8s
  • trigger_min/max:6.1s / 48.6s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 57.2s

Stack Uptimes

  • earthen_weapon_2:58.16%
  • earthen_weapon_4:4.12%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.2 1.0 37.5sec 32.7sec 10.8sec 25.95% 0.00% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 253.7s
  • trigger_min/max:1.7s / 253.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.2s

Stack Uptimes

  • elemental_blast_critical_strike_1:25.95%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.3 0.9 37.1sec 32.4sec 10.7sec 26.18% 0.00% 0.9 (0.9) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 286.6s
  • trigger_min/max:1.7s / 286.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.0s

Stack Uptimes

  • elemental_blast_haste_1:26.18%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.3 1.0 37.3sec 32.5sec 10.8sec 26.20% 0.00% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 300.2s
  • trigger_min/max:1.7s / 300.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.5s

Stack Uptimes

  • elemental_blast_mastery_1:26.20%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 125.0sec 99.4sec 57.9sec 25.09% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 334.0s

Stack Uptimes

  • elemental_chaos_air_1:25.09%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.0sec 101.0sec 58.0sec 24.82% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 338.7s

Stack Uptimes

  • elemental_chaos_earth_1:24.82%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.0sec 100.0sec 58.2sec 25.26% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 336.8s

Stack Uptimes

  • elemental_chaos_fire_1:25.26%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.9sec 100.2sec 58.1sec 24.84% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:24.84%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 308.0sec 0.0sec 27.4sec 13.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 331.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.41%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 2.8 29.5sec 24.0sec 17.5sec 62.28% 0.00% 53.3 (53.3) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 70.8s
  • trigger_min/max:6.2s / 48.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.2s

Stack Uptimes

  • feral_spirit_1:62.28%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.9 368.7 6.9sec 0.7sec 5.7sec 84.18% 90.46% 368.7 (874.4) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 63.6s
  • trigger_min/max:0.0s / 15.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 61.5s

Stack Uptimes

  • flurry_1:20.23%
  • flurry_2:33.22%
  • flurry_3:30.72%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 119.5 17.8sec 2.2sec 14.6sec 84.09% 100.00% 58.0 (58.0) 16.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 52.9s
  • trigger_min/max:0.0s / 46.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:15.28%
  • forceful_winds_2:14.33%
  • forceful_winds_3:12.72%
  • forceful_winds_4:10.60%
  • forceful_winds_5:31.17%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.0sec 45.9sec 13.0sec 19.59% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 208.3s
  • trigger_min/max:0.1s / 207.8s
  • trigger_pct:98.77%
  • duration_min/max:0.0s / 52.0s

Stack Uptimes

  • forgestorm_ignited_1:19.59%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.4 0.8 14.7sec 14.2sec 7.1sec 48.04% 77.03% 0.8 (0.8) 4.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.9s / 68.7s
  • trigger_min/max:8.4s / 68.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.2s

Stack Uptimes

  • ice_strike_1:48.04%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 24.2 16.0 12.5sec 7.4sec 7.1sec 57.18% 0.00% 16.0 (16.0) 23.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 49.9s
  • trigger_min/max:0.8s / 34.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.1s

Stack Uptimes

  • legacy_of_the_frost_witch_1:57.18%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 46.7 380.9 6.5sec 1.4sec 5.5sec 85.51% 100.00% 43.1 (47.2) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 37.3s
  • trigger_min/max:0.0s / 10.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.1s

Stack Uptimes

  • maelstrom_weapon_1:9.70%
  • maelstrom_weapon_2:11.39%
  • maelstrom_weapon_3:13.04%
  • maelstrom_weapon_4:13.65%
  • maelstrom_weapon_5:8.75%
  • maelstrom_weapon_6:7.11%
  • maelstrom_weapon_7:5.28%
  • maelstrom_weapon_8:4.31%
  • maelstrom_weapon_9:3.45%
  • maelstrom_weapon_10:8.84%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.1sec 45.6sec 16.5sec 23.64% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 215.9s
  • trigger_min/max:0.1s / 215.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.6s

Stack Uptimes

  • sophic_devotion_1:23.64%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.2 61.1sec 45.7sec 16.5sec 23.64% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 209.9s
  • trigger_min/max:0.0s / 209.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.3s

Stack Uptimes

  • sophic_devotion_oh_1:23.64%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.7sec 45.5sec 32.1sec 38.30% 0.00% 25.7 (25.7) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 253.4s
  • trigger_min/max:0.0s / 229.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 185.1s

Stack Uptimes

  • spiraling_winds_1:2.36%
  • spiraling_winds_2:2.33%
  • spiraling_winds_3:2.32%
  • spiraling_winds_4:2.30%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.27%
  • spiraling_winds_7:2.25%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.77%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.4s
  • trigger_min/max:180.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 59.9 18.9 4.9sec 3.7sec 1.2sec 23.27% 54.56% 18.9 (18.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 70.7s
  • trigger_min/max:0.0s / 70.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.1s

Stack Uptimes

  • stormbringer_1:23.27%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.3 33.0 69.0 17.9s 15.0s 52.9s
Windfury-ForcefulWinds: 2 50.6 33.0 69.0 18.1s 0.6s 66.6s
Windfury-ForcefulWinds: 3 48.7 27.0 69.0 18.8s 1.1s 79.6s
Windfury-ForcefulWinds: 4 45.3 24.0 69.0 20.3s 0.7s 108.5s
Windfury-ForcefulWinds: 5 214.4 96.0 348.0 4.7s 0.0s 88.6s
windfury_totem_extra_attack_mh 27.8 9.0 51.0 10.6s 1.2s 156.2s
windfury_totem_extra_attack_oh 28.3 11.0 59.0 10.4s 0.1s 118.5s
Windfury: Unruly Winds 136.7 78.0 197.0 2.4s 0.0s 46.8s
Maelstrom Weapon: Feral Spirit 71.3 49.0 95.0 4.2s 0.0s 33.6s
Maelstrom Weapon: Elemental Assault 109.0 73.0 149.0 2.7s 0.8s 11.1s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.4s
Stormflurry 36.5 9.0 72.0 10.7s 0.8s 119.9s
Flametongue: Windfury Attack 410.2 234.0 591.0 2.4s 0.0s 46.8s
Stormbringer: Windfury Attack 43.2 18.0 81.0 7.9s 0.0s 111.3s
Maelstrom Weapon: Windfury Attack 82.0 38.0 128.0 4.7s 0.0s 80.4s
Flametongue: main_hand 143.9 99.0 200.0 2.5s 1.3s 29.9s
Maelstrom Weapon: main_hand 28.8 9.0 55.0 10.1s 1.3s 118.7s
Windfury: main_hand 49.1 22.0 79.0 6.3s 1.3s 84.4s
Flametongue: Windlash 24.0 19.0 32.0 10.2s 1.2s 170.4s
Maelstrom Weapon: Windlash 4.8 0.0 15.0 43.8s 1.2s 194.4s
Windfury: Windlash 16.3 10.0 25.0 14.7s 1.2s 176.7s
Flametongue: offhand 145.3 96.0 197.0 2.5s 1.3s 28.7s
Maelstrom Weapon: offhand 29.1 10.0 51.0 10.1s 1.3s 111.9s
Flametongue: Windlash Off-Hand 25.2 21.0 33.0 9.7s 1.2s 168.4s
Maelstrom Weapon: Windlash Off-Hand 5.0 0.0 15.0 42.2s 1.2s 194.4s
Flametongue: Sundering 6.6 4.0 9.0 46.7s 40.0s 116.2s
Stormbringer: Sundering 0.7 0.0 6.0 110.9s 40.0s 332.7s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 102.5s 40.0s 338.2s
Windfury: Sundering 2.6 0.0 8.0 86.7s 40.0s 342.0s
Flametongue: Windstrike 27.0 17.0 45.0 10.0s 0.8s 172.0s
Stormbringer: Windstrike 2.8 0.0 10.0 59.6s 0.8s 195.3s
Maelstrom Weapon: Windstrike 5.4 0.0 15.0 40.3s 0.8s 193.1s
Windfury: Windstrike 19.1 10.0 35.0 13.7s 0.8s 177.4s
Flametongue: Windstrike Off-Hand 27.0 17.0 45.0 10.0s 0.8s 172.0s
Stormbringer: Windstrike Off-Hand 2.8 0.0 11.0 57.8s 0.8s 194.0s
Maelstrom Weapon: Windstrike Off-Hand 5.4 0.0 14.0 40.6s 0.8s 192.9s
Flametongue: Lava Lash 19.1 12.0 26.0 15.0s 8.9s 53.2s
Stormbringer: Lava Lash 2.0 0.0 9.0 75.6s 9.0s 323.2s
Maelstrom Weapon: Lava Lash 3.8 0.0 11.0 56.4s 9.0s 299.7s
Flametongue: Ice Strike 21.2 14.0 28.0 14.2s 8.4s 68.7s
Stormbringer: Ice Strike 2.2 0.0 9.0 74.9s 9.0s 326.9s
Maelstrom Weapon: Ice Strike 4.2 0.0 13.0 54.9s 8.4s 317.9s
Windfury: Ice Strike 8.1 0.0 17.0 36.0s 8.5s 259.0s
Flametongue: Stormstrike 118.5 67.0 189.0 3.2s 0.9s 28.3s
Stormbringer: Stormstrike 12.6 1.0 30.0 21.6s 0.9s 245.9s
Maelstrom Weapon: Stormstrike 23.7 6.0 47.0 12.5s 0.9s 135.6s
Windfury: Stormstrike 41.6 14.0 75.0 7.7s 0.9s 114.2s
Flametongue: Stormstrike Off-Hand 118.5 67.0 189.0 3.2s 0.9s 28.3s
Stormbringer: Stormstrike Off-Hand 12.5 2.0 31.0 21.6s 0.9s 316.1s
Maelstrom Weapon: Stormstrike Off-Hand 23.7 7.0 50.0 12.4s 0.9s 148.2s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 24.03% 15.25% 31.79% 0.7s 0.0s 18.8s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7960.0011.4599.2553.26716.744
Ascendance0.5540.0012.3960.4310.0002.396
Doom Winds0.5820.0012.6081.2940.2104.718
Sundering7.0850.00176.24137.0751.017105.408
Windstrike0.8960.0013.92317.7738.87525.132
Lava Lash3.2050.00141.53256.21518.057106.298
Flame Shock16.7250.001162.312211.36784.635298.341
Ice Strike2.5770.00156.75149.70011.87196.429
Frost Shock9.4000.001106.417172.50182.297251.814
Elemental Blast3.3830.00120.2532.1740.00025.098
Stormstrike1.0480.0015.16388.71640.588146.200
Earth Elemental6.7780.00332.2280.9130.00032.228

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Phys
mana_regenMana674.00253958.74100.00%376.79225437.6147.03%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 846.53 849.43 225437.8 49130.3 43421.6 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Phys
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 24.7233995.181375.001375.0058.90
Flame ShockMana 13.7810333.72750.00314.4045.04
Frost ShockMana 19.999996.40500.00500.0036.78
Ice StrikeMana 21.1734928.261650.001649.9912.87
Lava LashMana 19.097635.78400.00400.0055.07
Lightning BoltMana 18.139066.19500.00500.02100.53
StormstrikeMana 118.47118472.871000.001335.0918.25
SunderingMana 6.5519650.183000.002999.9915.84

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Phys Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Phys Damage Per Second
Count 7499
Mean 46664.16
Minimum 39747.77
Maximum 55671.46
Spread ( max - min ) 15923.69
Range [ ( max - min ) / 2 * 100% ] 17.06%
Standard Deviation 2217.5812
5th Percentile 43155.32
95th Percentile 50483.47
( 95th Percentile - 5th Percentile ) 7328.15
Mean Distribution
Standard Deviation 25.6081
95.00% Confidence Interval ( 46613.97 - 46714.35 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 87
0.1% Error 8676
0.1 Scale Factor Error with Delta=300 41981
0.05 Scale Factor Error with Delta=300 167921
0.01 Scale Factor Error with Delta=300 4198003
Priority Target DPS
PR_Shaman_Enhancement_Phys Priority Target Damage Per Second
Count 7499
Mean 46664.16
Minimum 39747.77
Maximum 55671.46
Spread ( max - min ) 15923.69
Range [ ( max - min ) / 2 * 100% ] 17.06%
Standard Deviation 2217.5812
5th Percentile 43155.32
95th Percentile 50483.47
( 95th Percentile - 5th Percentile ) 7328.15
Mean Distribution
Standard Deviation 25.6081
95.00% Confidence Interval ( 46613.97 - 46714.35 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 87
0.1% Error 8676
0.1 Scale Factor Error with Delta=300 41981
0.05 Scale Factor Error with Delta=300 167921
0.01 Scale Factor Error with Delta=300 4198003
DPS(e)
PR_Shaman_Enhancement_Phys Damage Per Second (Effective)
Count 7499
Mean 46664.16
Minimum 39747.77
Maximum 55671.46
Spread ( max - min ) 15923.69
Range [ ( max - min ) / 2 * 100% ] 17.06%
Damage
PR_Shaman_Enhancement_Phys Damage
Count 7499
Mean 13125170.14
Minimum 9556734.04
Maximum 16600610.75
Spread ( max - min ) 7043876.71
Range [ ( max - min ) / 2 * 100% ] 26.83%
DTPS
PR_Shaman_Enhancement_Phys Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Phys Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Phys Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Phys Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Phys Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Phys Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_PhysTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Phys Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.50 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 13.52 feral_spirit
G 2.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
H 3.72 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
K 20.29 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
L 5.68 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
M 2.37 ice_strike,if=buff.doom_winds_talent.up
N 0.78 sundering,if=buff.doom_winds_talent.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
O 1.15 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 frost_shock,if=buff.hailstorm.up
P 2.58 lava_lash,if=dot.flame_shock.refreshable
Q 0.01 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 70.42 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
S 24.72 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
T 4.08 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
U 12.65 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
V 18.80 ice_strike
W 16.51 lava_lash
0.00 bag_of_tricks
X 14.05 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 5.77 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
Z 19.99 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
a 1.15 earth_elemental
b 12.62 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ABCDFGEHKMKKNKKFKKKKOKKRSRFRVWSRZXabRRSRRVWXZUUUTFRSRRVWXRYSZbUUVWXRRRRFSRVWXRZSRbRXRRRRSRVHFNLLLLPSRVXZbUZWbUSRVZFXRRWSRRRVRTRYRRSRRPFRRSRVZbRWXZbUVZbUSRRWRSRVDGEFHKKKKKNFKKKKPSRSVZbRRUWFSRVZbXRRRRSRRVWXYUUXRZbVWUFRRSRZbVSRRWTRRRRSFRRVWSRYHLLLTLLSRVWZbUUFSZbRRBR

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 2 augmentation PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_earth
0:00.000 default B potion Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_earth
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), crumbling_power(20), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:00.956 default G ascendance Fluffy_Pillow 40779.6/50000: 82% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:01.910 default E berserking Fluffy_Pillow 42306.0/50000: 85% mana bloodlust, ascendance, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), static_accumulation, crumbling_power(18), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:01.910 default H doom_winds Fluffy_Pillow 42306.0/50000: 85% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), static_accumulation, crumbling_power(18), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.778 single K windstrike Fluffy_Pillow 43694.8/50000: 87% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds_talent, crumbling_power(18), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.646 single M ice_strike Fluffy_Pillow 45083.6/50000: 90% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, doom_winds_talent, crumbling_power(17), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.513 single K windstrike Fluffy_Pillow 44820.8/50000: 90% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds_talent, ice_strike, crumbling_power(16), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.381 single K windstrike Fluffy_Pillow 46209.6/50000: 92% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.249 single N sundering Fluffy_Pillow 47598.4/50000: 95% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.117 single K windstrike Fluffy_Pillow 45987.2/50000: 92% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.984 single K windstrike Fluffy_Pillow 47374.4/50000: 95% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.851 default F feral_spirit Fluffy_Pillow 48761.6/50000: 98% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.717 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.584 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.451 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.320 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.187 single O flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.054 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.013 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.967 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), legacy_of_the_frost_witch, crumbling_power(3), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.920 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, crumbling_power(2), sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.873 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.827 default F feral_spirit Fluffy_Pillow 49526.4/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.781 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(4), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.735 single V ice_strike Fluffy_Pillow 49526.4/50000: 99% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.688 single W lava_lash Fluffy_Pillow 49401.2/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.640 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.594 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.547 single Z frost_shock Fluffy_Pillow 49524.8/50000: 99% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.500 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.454 single a earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.406 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.362 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.316 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.269 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), elemental_chaos_earth
0:31.224 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth
0:32.178 single R stormstrike Fluffy_Pillow 49526.4/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth
0:33.133 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_earth
0:34.087 single W lava_lash Fluffy_Pillow 49876.4/50000: 100% mana bloodlust, elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:35.040 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:35.995 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds, ice_strike, elemental_chaos_earth
0:36.949 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, forceful_winds, elemental_chaos_earth
0:37.903 single U stormstrike Fluffy_Pillow 49526.4/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(3), elemental_chaos_earth
0:38.858 single U stormstrike Fluffy_Pillow 48054.4/50000: 96% mana bloodlust, flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(8), elemental_chaos_earth
0:39.814 single T lightning_bolt Fluffy_Pillow 48584.0/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(10), elemental_chaos_earth
0:40.766 default F feral_spirit Fluffy_Pillow 49607.2/50000: 99% mana flurry, forceful_winds(5), legacy_of_the_frost_witch, elemental_chaos_earth
0:42.066 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_earth
0:43.304 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_chaos_earth
0:44.541 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth
0:45.779 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
0:47.018 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth
0:48.256 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:49.495 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_earth
0:50.733 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:51.972 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:53.210 single S elemental_blast Fluffy_Pillow 48980.8/50000: 98% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:54.449 single Z frost_shock Fluffy_Pillow 49588.2/50000: 99% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:55.652 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, elemental_chaos_earth
0:56.855 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_earth
0:58.056 Waiting     0.140 sec 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_earth
0:58.196 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_earth
0:59.398 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(6), sophic_devotion_oh, elemental_chaos_earth
1:00.600 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(6), ice_strike, sophic_devotion_oh, elemental_chaos_fire
1:01.802 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(6), ice_strike, sophic_devotion_oh, elemental_chaos_fire
1:03.004 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:04.207 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:05.447 single R stormstrike Fluffy_Pillow 47984.0/50000: 96% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:06.686 single R stormstrike Fluffy_Pillow 48966.4/50000: 98% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:07.925 default F feral_spirit Fluffy_Pillow 49948.8/50000: 100% mana flurry(2), maelstrom_weapon(9), ice_strike, sophic_devotion_oh, elemental_chaos_fire
1:09.164 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion_oh, elemental_chaos_fire
1:10.403 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:11.606 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
1:12.807 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:14.008 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:15.210 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:16.412 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:17.614 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
1:18.817 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
1:20.021 single b flame_shock Fluffy_Pillow 49926.4/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_fire
1:21.261 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), sophic_devotion_oh, elemental_chaos_fire
1:22.500 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), sophic_devotion_oh, elemental_chaos_fire
1:23.739 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:24.979 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:26.217 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:27.455 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:28.695 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(9), sophic_devotion_oh, elemental_chaos_fire
1:30.159 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), stormbringer, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:31.362 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:32.563 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:33.766 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(5), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_fire
1:34.969 single N sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), doom_winds_talent, ice_strike, elemental_chaos_fire
1:36.172 single L stormstrike Fluffy_Pillow 48924.8/50000: 98% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), doom_winds_talent, ice_strike, elemental_chaos_fire
1:37.375 single L stormstrike Fluffy_Pillow 47849.6/50000: 96% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, elemental_chaos_fire
1:38.577 single L stormstrike Fluffy_Pillow 48772.8/50000: 98% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, elemental_chaos_fire
1:39.779 single L stormstrike Fluffy_Pillow 48696.0/50000: 97% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, elemental_chaos_fire
1:41.019 single P lava_lash Fluffy_Pillow 49680.0/50000: 99% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_fire
1:42.259 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds, elemental_chaos_fire
1:43.499 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_fire
1:44.736 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_fire
1:45.975 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_fire
1:47.215 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, elemental_chaos_fire
1:48.453 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), spiraling_winds(4), sophic_devotion, elemental_chaos_fire
1:49.690 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(2), spiraling_winds(4), sophic_devotion, elemental_chaos_fire
1:50.928 Waiting     1.047 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(3), spiraling_winds(5), sophic_devotion, elemental_chaos_fire
1:51.975 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(3), spiraling_winds(5), sophic_devotion, elemental_chaos_fire
1:53.392 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(3), spiraling_winds(6), sophic_devotion, elemental_chaos_fire
1:54.631 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), spiraling_winds(7), sophic_devotion, elemental_chaos_fire
1:55.871 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(3), maelstrom_weapon(3), spiraling_winds(7), sophic_devotion, elemental_chaos_fire
1:57.110 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(4), stormbringer, maelstrom_weapon(5), spiraling_winds(8), sophic_devotion, elemental_chaos_fire
1:58.350 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, elemental_chaos_fire
1:59.590 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(9), sophic_devotion, elemental_chaos_fire
2:00.826 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
2:02.063 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
2:03.302 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_frost
2:04.539 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), spiraling_winds(10), elemental_chaos_frost
2:05.777 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(2), spiraling_winds(10), elemental_chaos_frost
2:07.017 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
2:08.255 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_frost
2:09.492 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
2:10.695 single R stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:11.894 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:13.097 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:14.301 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_frost
2:15.502 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_frost
2:16.703 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:17.905 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:19.106 single R stormstrike Fluffy_Pillow 48921.6/50000: 98% mana flurry(2), forceful_winds(3), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:20.346 single R stormstrike Fluffy_Pillow 48905.6/50000: 98% mana flurry, forceful_winds(3), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:21.583 single S elemental_blast Fluffy_Pillow 49884.8/50000: 100% mana forceful_winds(3), stormbringer, maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_frost
2:22.821 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), stormbringer, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:24.024 single R stormstrike Fluffy_Pillow 48924.8/50000: 98% mana flurry, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:25.229 single P lava_lash Fluffy_Pillow 48852.8/50000: 98% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:26.429 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(7), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:27.631 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), forgestorm_ignited, elemental_chaos_frost
2:28.834 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_frost
2:30.035 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_frost
2:31.239 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:32.443 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:33.681 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:34.919 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:36.157 Waiting     1.018 sec 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_frost
2:37.175 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_frost
2:38.640 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), sophic_devotion, elemental_chaos_frost
2:39.879 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), sophic_devotion, elemental_chaos_frost
2:41.118 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), sophic_devotion, elemental_chaos_frost
2:42.358 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon, sophic_devotion, elemental_chaos_frost
2:43.597 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon, sophic_devotion, elemental_chaos_frost
2:44.835 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(2), sophic_devotion, elemental_chaos_frost
2:46.074 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon(3), ice_strike, sophic_devotion, elemental_chaos_frost
2:47.311 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(3), sophic_devotion, elemental_chaos_frost
2:48.550 Waiting     1.058 sec 50000.0/50000: 100% mana maelstrom_weapon(3), sophic_devotion, elemental_chaos_frost
2:49.608 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(3), sophic_devotion, elemental_chaos_frost
2:51.006 single S elemental_blast Fluffy_Pillow 49979.2/50000: 100% mana stormbringer, maelstrom_weapon(6), sophic_devotion, elemental_chaos_frost
2:52.245 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, stormbringer, legacy_of_the_frost_witch, elemental_chaos_frost
2:53.484 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
2:54.723 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
2:55.961 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
2:57.198 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, maelstrom_weapon(5), elemental_chaos_frost
2:58.435 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, legacy_of_the_frost_witch, elemental_chaos_frost
2:59.639 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
3:00.842 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, forceful_winds, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:00.842 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, forceful_winds, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(20), elemental_chaos_air
3:02.121 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), elemental_chaos_air
3:02.121 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), elemental_chaos_air
3:03.181 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, crumbling_power(18), elemental_chaos_air
3:04.241 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, crumbling_power(18), elemental_chaos_air
3:05.300 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, crumbling_power(17), elemental_chaos_air
3:06.362 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(16), elemental_chaos_air
3:07.423 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), elemental_chaos_air
3:08.514 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_air
3:09.607 single N sundering Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_air
3:10.698 default F feral_spirit Fluffy_Pillow 48745.6/50000: 97% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_air
3:11.790 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, crumbling_power(11), sophic_devotion_oh, elemental_chaos_air
3:12.881 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, crumbling_power(10), sophic_devotion_oh, elemental_chaos_air
3:13.972 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, crumbling_power(9), sophic_devotion_oh, elemental_chaos_air
3:15.063 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, earthen_weapon(4), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, crumbling_power(8), sophic_devotion_oh, elemental_chaos_air
3:16.263 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(4), maelstrom_weapon(6), legacy_of_the_frost_witch, crumbling_power(7), sophic_devotion_oh, elemental_chaos_air
3:17.461 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, crumbling_power(6), sophic_devotion_oh, elemental_chaos_air
3:18.662 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(5), sophic_devotion_oh, elemental_chaos_air
3:19.827 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power(4), sophic_devotion_oh, elemental_chaos_air
3:20.992 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_air
3:22.158 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_air
3:23.322 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_air
3:24.488 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_air
3:25.653 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), sophic_devotion_oh, elemental_chaos_air
3:26.820 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(8), elemental_chaos_air
3:27.985 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(9), elemental_chaos_air
3:29.149 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(9), elemental_chaos_air
3:30.314 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_air
3:31.514 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
3:32.713 single V ice_strike Fluffy_Pillow 48918.4/50000: 98% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_air
3:33.913 single Z frost_shock Fluffy_Pillow 49188.4/50000: 98% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
3:35.114 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:36.316 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_air
3:37.515 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:38.718 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:39.919 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:41.120 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:42.320 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_air
3:43.521 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:44.721 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:45.922 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:47.123 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:48.324 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(5), ice_strike, forgestorm_ignited, elemental_chaos_air
3:49.522 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(3), ice_strike, forgestorm_ignited, elemental_chaos_air
3:50.808 single U stormstrike Fluffy_Pillow 48921.6/50000: 98% mana flurry, elemental_blast_mastery, forceful_winds(3), ice_strike, forgestorm_ignited, elemental_chaos_air
3:52.008 single U stormstrike Fluffy_Pillow 49841.6/50000: 100% mana elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(3), ice_strike, forgestorm_ignited, elemental_chaos_air
3:53.210 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(6), ice_strike, forgestorm_ignited, elemental_chaos_air
3:54.412 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:55.611 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_air
3:56.811 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds, forgestorm_ignited, elemental_chaos_air
3:58.012 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_air
3:59.213 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(2), ice_strike, spiraling_winds(2), elemental_chaos_air
4:00.415 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon(3), ice_strike, spiraling_winds(3), elemental_chaos_frost
4:01.652 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(4), sophic_devotion, elemental_chaos_frost
4:02.890 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(4), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:04.128 single R stormstrike Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(5), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:05.368 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(5), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:06.607 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:07.845 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:09.085 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:10.323 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:11.562 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(8), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:12.800 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(9), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:14.038 single R stormstrike Fluffy_Pillow 48980.8/50000: 98% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:15.276 single W lava_lash Fluffy_Pillow 47961.6/50000: 96% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), ice_strike, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:16.515 single T lightning_bolt Fluffy_Pillow 49544.0/50000: 99% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:17.754 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:18.993 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:20.232 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_frost
4:21.471 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(3), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
4:22.710 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(4), maelstrom_weapon(10), sophic_devotion, elemental_chaos_frost
4:23.948 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
4:25.187 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
4:26.425 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_frost
4:27.664 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, elemental_chaos_frost
4:28.902 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), ice_strike, elemental_chaos_frost
4:30.142 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_frost
4:31.382 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:32.622 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:33.861 default H doom_winds Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:35.100 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:36.339 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds_talent, ice_strike, elemental_chaos_frost
4:37.579 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds_talent, ice_strike, elemental_chaos_frost
4:38.818 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, elemental_chaos_frost
4:40.057 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon, doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_frost
4:41.296 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), stormbringer, maelstrom_weapon(3), doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_frost
4:42.534 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_frost
4:43.772 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(5), legacy_of_the_frost_witch, elemental_chaos_frost
4:45.011 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
4:46.250 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:47.489 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
4:48.727 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, elemental_chaos_frost
4:49.966 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon, elemental_chaos_frost
4:51.205 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), stormbringer, maelstrom_weapon(3), elemental_chaos_frost
4:52.444 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(7), elemental_chaos_frost
4:53.684 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), elemental_chaos_frost
4:54.922 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), elemental_chaos_frost
4:56.158 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_frost
4:57.396 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_frost
4:58.632 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), elemental_chaos_frost
4:59.872 default B potion Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), elemental_chaos_frost
5:00.000 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), elemental_chaos_frost, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.51% 21.51% 3656
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 59.31% 52.07% 3246
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Phys"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 312052288
Max Event Queue: 414
Sim Seconds: 2250296
CPU Seconds: 428.8151
Physical Seconds: 215.9217
Speed Up: 5248

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.55sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 172842 576 7.65 3580 7185 38.2 38.2 26.1% 0.0% 0.0% 0.0% 6.91sec 172842 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 138.57sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 810925 2703 37.88 3885 7782 189.4 189.4 26.5% 16.4% 0.0% 0.0% 1.85sec 1158494 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 395112 1317 37.01 1942 3891 185.1 185.1 26.6% 16.7% 0.0% 0.0% 1.85sec 564460 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.66sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 3514094 11714 39.36 14106 28198 196.8 196.8 26.6% 0.0% 0.0% 0.0% 1.43sec 3514094 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 205911 686 0.56 58189 117676 2.9 2.8 26.8% 0.0% 0.0% 0.0% 119.57sec 205911 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 6369 21 2.28 444 887 1.1 11.4 26.0% 0.0% 0.0% 0.0% 113.11sec 6369 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 233208 777 1.11 33171 66341 5.5 5.5 27.0% 0.0% 0.0% 0.0% 47.08sec 333163 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 85.48sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 595943 1986 19.75 4765 9543 66.3 98.7 26.6% 0.0% 0.0% 0.0% 4.50sec 595943 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 266425 888 4.92 8555 17101 24.6 24.6 26.7% 0.0% 0.0% 0.0% 7.12sec 266425 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 133126 444 4.92 4277 8555 24.6 24.6 26.6% 0.0% 0.0% 0.0% 7.12sec 133126 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 62.56sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 2063122 6877 13.26 24574 49217 66.3 66.3 26.5% 0.0% 0.0% 0.0% 4.50sec 2063122 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 432308 1441 13.23 5163 10327 66.2 66.2 26.5% 0.0% 0.0% 0.0% 4.52sec 432308 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 496722 1656 12.90 6077 12175 64.5 64.5 26.6% 0.0% 0.0% 0.0% 4.60sec 709621 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 248095 827 12.90 3040 6080 64.5 64.5 26.5% 0.0% 0.0% 0.0% 4.60sec 354431 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1236131 4120 8.35 0 29611 41.7 41.7 100.0% 0.0% 0.0% 0.0% 7.08sec 1236131 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 618065 2060 8.35 0 14805 41.7 41.7 100.0% 0.0% 0.0% 0.0% 7.08sec 618065 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 7.9 0.0 0.0% 0.0% 0.0% 0.0% 40.09sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 307.32sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.70sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 20.59sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1657099 5524 48.68 5373 10781 243.4 243.4 26.5% 0.0% 0.0% 0.0% 1.23sec 1657099 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 58375 195 4.02 2296 4593 20.1 20.1 26.6% 0.0% 0.0% 0.0% 14.49sec 83394 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 58368 195 4.02 2296 4593 20.1 20.1 26.6% 0.0% 0.0% 0.0% 14.50sec 83385 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.1 0.0 0.0% 0.0% 0.0% 0.0% 14.49sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 104748 640 19.15 1583 3168 52.3 52.3 26.6% 0.0% 0.0% 0.0% 5.39sec 149643 163.78sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 211 1 1.07 57 114 2.9 2.9 26.2% 0.0% 0.0% 0.0% 120.70sec 302 163.78sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul main_hand 0 213058 1301 34.65 1777 3554 94.6 94.6 26.8% 0.0% 0.0% 0.0% 2.93sec 304377 163.78sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.70sec 0 163.78sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 67177 224 1.40 8341 16670 7.0 7.0 15.4% 0.0% 0.0% 0.0% 45.49sec 67177 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 857779 2859 29.61 5020 10046 148.1 148.1 15.4% 0.0% 0.0% 0.0% 2.44sec 1225430 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.73sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 59668 199 1.40 7381 14768 7.0 7.0 15.4% 0.0% 0.0% 0.0% 45.61sec 59668 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1255592 4185 19.14 11376 22754 95.7 95.7 15.3% 0.0% 0.0% 0.0% 3.09sec 1255592 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 371630 1239 26.44 2811 0 0.0 132.2 0.0% 0.0% 0.0% 0.0% 0.00sec 371630 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 210603 702 1.09 33373 66746 5.5 5.5 15.5% 0.0% 0.0% 0.0% 46.83sec 300870 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 166.18sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 350856 1170 5.23 11611 23212 26.2 26.2 15.5% 0.0% 0.0% 0.0% 11.53sec 501236 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 560634 1869 20.79 4675 9344 104.0 104.0 15.4% 0.0% 0.0% 0.0% 3.51sec 560634 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 25080 84 2.37 1836 3674 11.9 11.9 15.1% 0.0% 0.0% 0.0% 26.31sec 25080 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.44sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike 55090 291206 971 15.43 3272 6542 77.2 77.2 15.3% 0.0% 0.0% 0.0% 3.74sec 416019 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike_shadow 70890 382951 1277 15.43 4300 8595 0.0 77.2 15.4% 0.0% 0.0% 0.0% 0.00sec 382951 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy solved_the_puzzle 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.76sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 133084 444 3.14 7355 14697 15.7 15.7 15.4% 0.0% 0.0% 0.0% 6.86sec 133084 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 639583 2132 3.13 35332 70744 15.7 15.7 15.5% 0.0% 0.0% 0.0% 6.86sec 639583 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.74sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 63487 212 0.73 14978 29954 3.7 3.7 15.7% 0.0% 0.0% 0.0% 90.73sec 63487 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_pact 319236 400972 1337 24.63 2822 5651 123.1 123.1 15.3% 0.0% 0.0% 0.0% 2.63sec 400972 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 21.4 0.0 0.0% 0.0% 0.0% 0.0% 13.68sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 264487 882 19.83 2311 4624 11.9 99.2 15.4% 0.0% 0.0% 0.0% 26.31sec 264487 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 93873 313 7.58 2145 4293 37.9 37.9 15.4% 0.0% 0.0% 0.0% 7.86sec 134108 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 218 1 0.52 73 146 2.6 2.6 15.9% 0.0% 0.0% 0.0% 90.04sec 312 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul main_hand 0 1289708 4299 38.37 5824 11654 191.8 191.8 15.4% 0.0% 0.0% 0.0% 1.55sec 1842487 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul monstrous_blow 91797 3187 11 0.23 2453 4917 1.1 1.1 15.1% 0.0% 0.0% 0.0% 91.09sec 4553 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul spawn_travel 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 411144 1370 13.60 5244 10479 68.0 68.0 15.3% 0.0% 0.0% 0.0% 4.29sec 411144 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1554842 31103 47.72 33909 67870 39.8 39.8 15.3% 0.0% 0.0% 0.0% 5.31sec 1554842 49.99sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.74sec 0 49.99sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_risen_skulker skulker_shot 212423 354380 1181 30.75 1998 3997 153.8 153.7 15.4% 0.0% 0.0% 0.0% 1.94sec 506270 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 300398 3852 26.51 7554 15098 34.5 34.4 15.5% 0.0% 0.0% 0.0% 8.53sec 300398 77.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 708312 9083 63.27 7468 14932 82.3 82.2 15.4% 0.0% 0.0% 0.0% 3.51sec 708312 77.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 268324 4474 212.07 1097 2193 212.0 212.0 15.4% 0.0% 0.0% 0.0% 1.02sec 383330 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1369559 22834 347.59 3417 6835 347.5 347.5 15.4% 0.0% 0.0% 0.0% 0.62sec 1956563 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.43sec 0 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.14sec 0 59.97sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.84sec 0 59.96sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.55sec 0 59.95sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.10sec 0 59.94sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.60sec 0 59.94sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.17sec 0 59.93sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.77sec 0 59.92sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 173568 1778 94.11 983 1966 153.1 153.1 15.3% 0.0% 0.0% 0.0% 1.83sec 247961 97.60sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 638804 6545 111.90 3043 6085 182.0 182.0 15.3% 0.0% 0.0% 0.0% 1.53sec 912601 97.60sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 47.68sec 0 97.60sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 47.03sec 0 99.01sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 46.90sec 0 99.18sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 47.65sec 0 97.73sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.47sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow dark_ascension 391109 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.88sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 1184762 3949 10.15 19173 40989 50.7 50.7 19.2% 0.0% 0.0% 0.0% 5.90sec 2766536 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 1581774 5273 25.71 10369 21166 50.7 128.6 17.9% 0.0% 0.0% 0.0% 5.90sec 2766536 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 179.3 0.0 0.0% 0.0% 0.0% 0.0% 1.66sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo 120644 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 62.48sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_heal 390971 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 62.48sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_damage 390964 131705 439 0.98 22007 47793 4.9 4.9 18.5% 0.0% 0.0% 0.0% 62.48sec 131705 300.00sec
PR_Priest_Shadow PR_Priest_Shadow idol_of_cthun 377349 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_void_tendril mind_flay ticks -193473 967544 3225 33.06 5010 10163 22.1 165.3 16.4% 0.0% 0.0% 0.0% 12.60sec 967544 24.22sec
PR_Priest_Shadow PR_Priest_Shadow mental_fortitude 377065 153738 512 69.54 442 0 335.9 347.7 0.0% 0.0% 0.0% 0.0% 0.88sec 7076815 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 1211092 4037 12.58 15776 34570 62.9 62.9 18.5% 0.0% 0.0% 0.0% 4.77sec 1211092 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay ticks -15407 177242 591 8.14 3752 7704 6.8 40.7 15.2% 0.0% 0.0% 0.0% 39.02sec 177242 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay_insanity ticks -391403 1659335 5531 32.25 8693 17775 40.5 161.3 17.6% 0.0% 0.0% 0.0% 7.30sec 1659335 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 256523 855 2.04 21206 45858 10.2 10.2 16.1% 0.0% 0.0% 0.0% 25.09sec 256523 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.65sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames 375901 415016 1383 1.55 43499 95533 7.8 7.8 19.3% 0.0% 0.0% 0.0% 40.39sec 415016 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames_damage_reversal 323706 0 0 0.00 0 0 7.8 0.0 0.0% 0.0% 0.0% 0.0% 40.39sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 309.47sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow power_infusion 10060 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.68sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.91sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_damage 205386 357359 1191 1.92 30824 65797 9.6 9.6 18.5% 0.0% 0.0% 0.0% 32.84sec 357359 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_dots 391286 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.91sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 197604 659 26.07 1516 0 131.3 130.3 0.0% 0.0% 0.0% 0.0% 2.23sec 197604 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 371848 1239 2.55 24259 50253 12.7 12.7 18.9% 0.0% 0.0% 0.0% 24.37sec 371848 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 89796 299 2.53 4706 17593 12.7 12.7 18.5% 0.0% 0.0% 0.0% 24.37sec 251334 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain ticks -589 662629 2209 40.27 2774 5676 9.6 201.4 17.8% 0.0% 0.0% 0.0% 32.84sec 662629 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparitions 341491 0 0 0.00 0 0 113.6 0.0 0.0% 0.0% 0.0% 0.0% 2.63sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparition 148859 364571 1215 22.01 3312 0 111.9 110.1 0.0% 0.0% 0.0% 0.0% 2.63sec 364571 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 345013 1150 17.43 3958 0 7.3 87.2 0.0% 0.0% 0.0% 0.0% 36.94sec 345013 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.68sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 1002161 3341 33.41 5062 10355 9.6 167.1 17.7% 0.0% 0.0% 0.0% 32.84sec 1002161 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 167.1 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment 373427 0 0 0.00 0 0 41.9 0.0 0.0% 0.0% 0.0% 0.0% 7.00sec 0 138.66sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment_damage 373442 847057 6109 18.12 16155 33994 41.9 41.9 22.9% 0.0% 0.0% 0.0% 7.00sec 847057 138.66sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender melee 0 723109 5215 56.83 4470 9088 131.3 131.3 22.4% 0.0% 0.0% 0.0% 2.23sec 723109 138.66sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 310.77sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2435502 8118 4.42 90852 182744 22.1 22.1 21.0% 0.0% 0.0% 0.0% 13.48sec 2435502 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 30.01sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 612016 2040 16.44 6334 12740 82.2 82.2 17.3% 0.0% 0.0% 0.0% 3.65sec 1456352 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 844336 2814 38.45 3736 7512 82.2 192.3 17.4% 0.0% 0.0% 0.0% 3.65sec 1456352 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 284255 948 132.30 366 734 661.5 661.5 17.4% 0.0% 0.0% 0.0% 0.73sec 284255 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 325671 1086 5.66 9807 19717 28.3 28.3 17.2% 0.0% 0.0% 0.0% 7.84sec 325671 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 1664435 5548 8.64 32807 65392 43.2 43.2 17.5% 0.0% 0.0% 0.0% 6.90sec 1664435 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 597200 1991 4.94 20576 41324 24.7 24.7 17.4% 0.0% 0.0% 0.0% 12.26sec 597200 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 2855560 9519 13.30 36536 73461 66.5 66.5 17.4% 0.0% 0.0% 0.0% 4.45sec 2855560 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 1177564 3925 3.72 52192 104477 18.6 18.6 21.2% 0.0% 0.0% 0.0% 16.27sec 1177564 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 0 511304 1704 38.63 2613 5251 193.2 193.2 17.5% 16.4% 0.0% 0.0% 1.81sec 730453 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 1 255858 853 38.65 1308 2630 193.3 193.3 17.4% 16.4% 0.0% 0.0% 1.80sec 365520 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.58sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement primordial_wave 375982 49328 164 1.41 5981 12016 7.0 7.0 17.2% 0.0% 0.0% 0.0% 45.72sec 49328 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_pw 188196 842953 2810 1.40 99443 199475 7.0 7.0 21.1% 0.0% 0.0% 0.0% 45.91sec 842953 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 46.4 0.0 0.0% 0.0% 0.0% 0.0% 6.37sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 367970 1227 9.28 6743 13571 46.4 46.4 17.4% 0.0% 0.0% 0.0% 6.37sec 525685 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 184053 614 9.28 3372 6780 46.4 46.4 17.5% 0.0% 0.0% 0.0% 6.37sec 262939 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 241333 804 1.14 36121 72589 5.7 5.7 17.1% 0.0% 0.0% 0.0% 54.00sec 241333 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 220182 734 29.73 1260 2532 148.6 148.6 17.4% 0.0% 0.0% 0.0% 4.15sec 314554 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26495 428 38.74 565 1129 40.0 40.0 17.4% 0.0% 0.0% 0.0% 2.28sec 37851 61.88sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_fiery_wolf melee 0 211594 4132 104.78 2015 4026 89.4 89.4 17.5% 0.0% 0.0% 0.0% 3.41sec 302284 51.21sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_lightning_wolf melee 0 210372 4031 102.84 2002 4000 89.5 89.5 17.5% 0.0% 0.0% 0.0% 3.40sec 300539 52.19sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_frost_wolf melee 0 211899 4519 114.80 2012 4019 89.7 89.7 17.5% 0.0% 0.0% 0.0% 3.40sec 302720 46.89sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_dre 114051 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 30.59sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_damage_dre 344548 318937 1063 1.67 32006 64199 8.4 8.4 19.2% 0.0% 0.0% 0.0% 30.59sec 318937 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba doom_winds 384352 24966 83 0.75 6687 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.41sec 35667 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 309.36sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba elemental_blast 117014 2128030 7093 5.02 70156 140396 25.1 25.1 20.9% 0.0% 0.0% 0.0% 11.76sec 2128030 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba feral_spirit 51533 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 21.43sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock 188389 99037 330 6.01 2804 5630 30.0 30.0 17.4% 0.0% 0.0% 0.0% 9.85sec 464686 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock ticks -188389 365650 1219 37.36 1666 3347 30.0 186.8 17.3% 0.0% 0.0% 0.0% 9.85sec 464686 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_attack 10444 467542 1558 225.96 353 707 1129.8 1129.8 17.2% 0.0% 0.0% 0.0% 0.67sec 467542 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba forgestorm_ignited_damage 381700 332389 1108 5.78 9805 19711 28.9 28.9 17.2% 0.0% 0.0% 0.0% 7.65sec 332389 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba frost_shock 196840 315298 1051 3.34 16051 32370 16.7 16.7 17.3% 0.0% 0.0% 0.0% 16.79sec 315298 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ice_strike 342240 435102 1450 4.07 18188 36534 20.3 20.3 17.5% 0.0% 0.0% 0.0% 14.87sec 435102 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lava_lash 60103 412090 1374 3.71 18908 37935 18.6 18.6 17.3% 0.0% 0.0% 0.0% 15.77sec 412090 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt 188196 849496 2832 3.29 42335 85148 16.5 16.5 21.6% 0.0% 0.0% 0.0% 17.00sec 849496 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba main_hand 0 426851 1423 32.57 2591 5208 162.9 162.9 17.3% 16.4% 0.0% 0.0% 2.15sec 609803 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba offhand 1 218421 728 33.32 1298 2606 166.6 166.6 17.3% 16.4% 0.0% 0.0% 2.09sec 312039 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike 17364 0 0 0.00 0 0 92.0 0.0 0.0% 0.0% 0.0% 0.0% 3.25sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_mh 32175 1269720 4232 24.53 8808 17717 122.6 122.6 17.3% 0.0% 0.0% 0.0% 3.25sec 1813933 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_mh 390287 302075 1007 12.25 4933 0 61.2 61.2 0.0% 0.0% 0.0% 0.0% 5.48sec 302075 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_offhand 32176 634730 2116 24.53 4404 8860 122.6 122.6 17.3% 0.0% 0.0% 0.0% 3.25sec 906780 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_offhand 390287 150936 503 12.25 2465 0 61.2 61.2 0.0% 0.0% 0.0% 0.0% 5.48sec 150936 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba sundering 197214 314924 1050 1.28 41906 84110 6.4 6.4 17.3% 0.0% 0.0% 0.0% 49.17sec 314924 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_attack 25504 2138556 7129 83.54 4367 8753 417.7 417.7 17.2% 0.0% 0.0% 0.0% 2.40sec 3055157 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash 114089 151339 504 6.74 3700 7441 33.7 33.7 21.1% 0.0% 0.0% 0.0% 8.42sec 151339 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash_offhand 114093 87637 292 7.82 1851 3718 39.1 39.1 21.0% 0.0% 0.0% 0.0% 7.30sec 87637 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike 115356 0 0 0.00 0 0 27.5 0.0 0.0% 0.0% 0.0% 0.0% 8.59sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_mh 115357 575545 1918 7.33 13393 26906 36.7 36.6 17.1% 0.0% 0.0% 0.0% 8.59sec 575545 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_mh 390287 104516 348 2.50 8354 0 12.5 12.5 0.0% 0.0% 0.0% 0.0% 18.25sec 104516 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_offhand 115360 287702 959 7.33 6698 13438 36.7 36.6 17.1% 0.0% 0.0% 0.0% 8.59sec 287702 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_offhand 390287 52198 174 2.50 4172 0 12.5 12.5 0.0% 0.0% 0.0% 0.0% 18.25sec 52198 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt_ti 188196 1097559 3659 5.49 33022 66271 27.4 27.4 20.9% 0.0% 0.0% 0.0% 8.61sec 1097559 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_greater_earth_elemental melee 0 26476 424 39.33 552 1104 40.9 40.9 17.3% 0.0% 0.0% 0.0% 2.42sec 37824 62.38sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_spirit_wolf melee 0 841826 7763 202.42 1963 3921 365.9 365.9 17.3% 0.0% 0.0% 0.0% 1.63sec 1202639 108.45sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.43sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance_damage 344548 104268 348 0.40 43771 88001 2.0 2.0 18.9% 0.0% 0.0% 0.0% 180.43sec 104268 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.70sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys doom_winds 384352 24482 82 0.74 6577 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.48sec 34975 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 306.29sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys elemental_blast 117014 2002223 6674 4.94 66882 134271 24.7 24.7 21.0% 0.0% 0.0% 0.0% 11.69sec 2002223 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys feral_spirit 51533 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 23.98sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock 188389 107184 357 6.57 2775 5573 32.9 32.9 17.4% 0.0% 0.0% 0.0% 8.86sec 465444 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock ticks -188389 358260 1194 36.62 1666 3344 32.9 183.1 17.3% 0.0% 0.0% 0.0% 8.86sec 465444 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_attack 10444 457533 1525 217.31 359 720 1086.5 1086.5 17.2% 0.0% 0.0% 0.0% 0.68sec 457533 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys forgestorm_ignited_damage 381700 332835 1109 5.77 9806 19720 28.9 28.9 17.4% 0.0% 0.0% 0.0% 7.60sec 332835 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys frost_shock 196840 367643 1225 4.00 15656 31500 20.0 20.0 17.2% 0.0% 0.0% 0.0% 13.86sec 367643 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ice_strike 342240 449646 1499 4.23 18061 36243 21.2 21.2 17.5% 0.0% 0.0% 0.0% 14.15sec 449646 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lava_lash 60103 420480 1402 3.82 18715 37589 19.1 19.1 17.5% 0.0% 0.0% 0.0% 14.95sec 420480 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt 188196 911467 3038 3.63 41324 82829 18.1 18.1 21.6% 0.0% 0.0% 0.0% 15.43sec 911467 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys main_hand 0 440376 1468 34.43 2530 5085 172.1 172.1 17.4% 16.4% 0.0% 0.0% 1.93sec 629124 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys offhand 1 223108 744 34.77 1269 2552 173.8 173.8 17.3% 16.4% 0.0% 0.0% 2.01sec 318734 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike 17364 0 0 0.00 0 0 88.7 0.0 0.0% 0.0% 0.0% 0.0% 3.20sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_mh 32175 1170427 3901 23.69 8395 16894 118.5 118.5 17.5% 0.0% 0.0% 0.0% 3.20sec 1672081 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_mh 390287 271641 905 11.63 4671 0 58.2 58.2 0.0% 0.0% 0.0% 0.0% 5.43sec 271641 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_offhand 32176 584451 1948 23.69 4198 8440 118.5 118.5 17.3% 0.0% 0.0% 0.0% 3.20sec 834951 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_offhand 390287 135627 452 11.63 2332 0 58.2 58.2 0.0% 0.0% 0.0% 0.0% 5.43sec 135627 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys sundering 197214 311259 1038 1.31 40365 81328 6.6 6.6 17.5% 0.0% 0.0% 0.0% 46.71sec 311259 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_attack 25504 2174470 7248 82.05 4524 9037 410.2 410.2 17.2% 0.0% 0.0% 0.0% 2.45sec 3106466 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash 114089 134409 448 4.80 4626 9291 24.0 24.0 20.8% 0.0% 0.0% 0.0% 10.21sec 134409 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash_offhand 114093 70685 236 5.04 2317 4660 25.2 25.2 20.8% 0.0% 0.0% 0.0% 9.69sec 70685 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike 115356 0 0 0.00 0 0 20.3 0.0 0.0% 0.0% 0.0% 0.0% 9.99sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_mh 115357 572762 1909 5.41 18129 36360 27.0 27.0 16.7% 0.0% 0.0% 0.0% 9.99sec 572762 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_mh 390287 128689 429 2.33 11030 0 11.7 11.7 0.0% 0.0% 0.0% 0.0% 17.74sec 128689 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_offhand 115360 286248 954 5.41 9063 18194 27.0 27.0 16.7% 0.0% 0.0% 0.0% 9.99sec 286248 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_offhand 390287 64426 215 2.33 5522 0 11.7 11.7 0.0% 0.0% 0.0% 0.0% 17.74sec 64426 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt_ti 188196 1020572 3402 4.06 41659 83641 20.3 20.3 20.6% 0.0% 0.0% 0.0% 9.99sec 1020572 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_greater_earth_elemental melee 0 25600 414 38.23 554 1108 39.4 39.4 17.3% 0.0% 0.0% 0.0% 2.42sec 36572 61.80sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_spirit_wolf melee 0 810640 15420 391.19 2019 4028 342.7 342.7 17.2% 0.0% 0.0% 0.0% 1.73sec 1158087 52.57sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
269739.2 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.7 2.2 22.2sec 18.7sec 5.5sec 23.15% 23.38% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.2s / 225.0s
  • trigger_min/max:0.2s / 225.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.15%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.6 2.2 22.3sec 18.8sec 5.5sec 23.03% 23.28% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 222.0s
  • trigger_min/max:3.0s / 222.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.03%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_death_check) 10.1 2.7 31.4sec 24.4sec 7.2sec 24.22% 0.00% 2.7 (2.7) 9.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_death_check
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.6s / 66.8s
  • trigger_min/max:0.9s / 66.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.7s

Stack Uptimes

  • death_and_madness_death_check_1:24.22%

Spelldata

  • id:322098
  • name:Death and Madness
  • tooltip:If the target dies within {$d=7 seconds}, the Priest gains {$321291m2=20} Insanity.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 2.2 113.9 129.0sec 2.5sec 136.5sec 97.91% 0.00% 95.1 (95.1) 1.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.1s / 341.6s
  • trigger_min/max:0.0s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.7s

Stack Uptimes

  • death_rot_1:1.06%
  • death_rot_2:1.64%
  • death_rot_3:1.22%
  • death_rot_4:1.23%
  • death_rot_5:1.14%
  • death_rot_6:1.28%
  • death_rot_7:1.23%
  • death_rot_8:1.32%
  • death_rot_9:1.35%
  • death_rot_10:86.45%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 4.7 238.7 69.4sec 1.2sec 62.4sec 97.94% 98.04% 197.2 (197.2) 3.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 347.6s
  • trigger_min/max:0.0s / 18.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.9s

Stack Uptimes

  • everfrost_1:1.57%
  • everfrost_2:1.56%
  • everfrost_3:1.56%
  • everfrost_4:1.55%
  • everfrost_5:1.54%
  • everfrost_6:1.54%
  • everfrost_7:1.53%
  • everfrost_8:1.53%
  • everfrost_9:1.52%
  • everfrost_10:84.04%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 24.5 37.1 12.3sec 4.9sec 10.1sec 82.90% 100.00% 5.1 (5.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 84.0s
  • trigger_min/max:0.0s / 28.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 81.4s

Stack Uptimes

  • festering_wound_1:18.88%
  • festering_wound_2:23.72%
  • festering_wound_3:18.68%
  • festering_wound_4:8.41%
  • festering_wound_5:6.29%
  • festering_wound_6:6.92%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 65.5 3.0sec 4.4sec 295.0sec 98.30% 97.90% 65.5 (65.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 5.1s
  • trigger_min/max:0.8s / 15.8s
  • trigger_pct:100.00%
  • duration_min/max:231.3s / 358.5s

Stack Uptimes

  • lashing_flames_1:98.30%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 65.1 195.5sec 4.5sec 286.6sec 99.19% 0.00% 61.0 (61.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 350.3s
  • trigger_min/max:0.9s / 45.2s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 357.9s

Stack Uptimes

  • razorice_1:1.02%
  • razorice_2:0.83%
  • razorice_3:0.93%
  • razorice_4:0.86%
  • razorice_5:95.55%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 272496.68
Minimum 249905.08
Maximum 300652.09
Spread ( max - min ) 50747.01
Range [ ( max - min ) / 2 * 100% ] 9.31%
Standard Deviation 6921.2138
5th Percentile 261313.39
95th Percentile 283945.01
( 95th Percentile - 5th Percentile ) 22631.62
Mean Distribution
Standard Deviation 79.9246
95.00% Confidence Interval ( 272340.03 - 272653.32 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2479
0.1 Scale Factor Error with Delta=300 408930
0.05 Scale Factor Error with Delta=300 1635718
0.01 Scale Factor Error with Delta=300 40892928
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3769
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 98969370 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.