SimulationCraft has not been built with PTR data.  The 'ptr=' option is ignored.

SimulationCraft 1002-01

for World of Warcraft 10.0.2.46924 Live (hotfix 2022-12-03/46924, git build c6eddad6df)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 45095 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45095.3 45095.3 52.2 / 0.116% 8960.5 / 19.9% 3518.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.5 12.8 Runic Power 7.15% 49.8 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 45095
Abomination Limb 0 (582) 0.0% (1.3%) 3.0 120.55sec 57770 46554

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2412 0.0000 0.00 0.00 0.00% 46554.16 46554.16

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [Z]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [a]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 582 1.3% 38.2 6.91sec 4519 0 Direct 38.2 3580 7183 4519 26.1% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.25 38.25 0.00 0.00 0.00 0.0000 0.0000 172855.59 172855.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.92% 28.27 15 38 3579.55 2324 6694 3579.38 2844 4537 101196 101196 0.00%
crit 26.08% 9.98 0 20 7183.07 4647 13388 7183.17 0 10831 71659 71659 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2704 6.0% 189.2 1.85sec 4283 2331 Direct 189.2 3887 7779 4283 26.5% 16.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.21 189.21 0.00 0.00 0.00 1.8371 0.0000 810404.19 1157749.78 30.00% 2331.45 2331.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.06% 107.96 65 155 3887.45 2482 7599 3888.13 3571 4267 419686 599567 30.00%
crit 26.55% 50.23 24 83 7779.17 4964 15198 7779.35 6850 8928 390718 558183 30.00%
miss 16.40% 31.03 12 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1318 2.9% 185.1 1.85sec 2135 1162 Direct 185.1 1943 3891 2135 26.5% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 185.07 185.07 0.00 0.00 0.00 1.8368 0.0000 395126.71 564481.13 30.00% 1162.35 1162.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.78% 105.08 66 147 1943.11 1241 3800 1943.38 1797 2142 204175 291686 30.00%
crit 26.52% 49.08 22 78 3891.00 2482 7599 3890.96 3450 4366 190951 272795 30.00%
miss 16.71% 30.92 11 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Breath of Sindragosa 0 (11703) 0.0% (26.0%) 2.9 120.64sec 1192624 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [d]:2.94
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 11703 26.0% 196.5 1.43sec 17854 0 Direct 196.5 14108 28220 17854 26.5% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 196.51 196.51 0.00 0.00 0.00 0.0000 0.0000 3508531.17 3508531.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.45% 144.34 68 213 14108.48 8053 29197 14124.71 12934 15563 2036448 2036448 0.00%
crit 26.55% 52.17 20 92 28219.57 16105 58784 28250.18 24892 32716 1472083 1472083 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 688 1.5% 2.9 119.59sec 70101 0 Direct 2.8 58537 116938 74273 26.9% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.78 0.00 0.00 0.00 0.0000 0.0000 206452.71 206452.71 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.06% 2.03 0 3 58537.03 22015 66044 56831.70 0 66044 118873 118873 0.00%
crit 26.94% 0.75 0 3 116938.44 44029 132088 67736.75 0 132088 87580 87580 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9857.76
  • base_dd_max:9857.76
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 21 0.0% 1.1 116.32sec 6086 4573 Direct 11.5 445 891 564 26.6% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.06 11.47 0.00 0.00 0.00 1.3310 0.0000 6462.19 6462.19 0.00% 4573.38 4573.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.40% 8.42 0 30 444.81 317 719 328.60 0 658 3744 3744 0.00%
crit 26.60% 3.05 0 17 891.24 635 1421 642.07 0 1357 2718 2718 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [R]:1.06
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 776 1.7% 5.5 47.12sec 42025 0 Direct 5.5 33171 66341 42064 26.8% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 5.54 0.00 0.00 0.00 0.0000 0.0000 232902.64 332726.54 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.20% 4.05 0 6 33170.70 33171 33171 33113.20 0 33171 134439 192060 29.95%
crit 26.80% 1.48 0 6 66341.40 66341 66341 54230.27 0 66341 98464 140666 24.52%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 1989 4.4% 66.3 4.50sec 9000 0 Periodic 98.7 4768 9536 6043 26.7% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.30 0.00 98.74 98.74 65.29 0.0000 2.9999 596649.65 596649.65 0.00% 2014.28 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 73.27% 72.35 46 98 4768.12 285 10224 4767.97 4427 5173 344956 344956 0.00%
crit 26.73% 26.40 8 47 9535.68 734 20574 9536.33 8424 11163 251694 251694 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 886 (1329) 2.0% (3.0%) 24.7 7.10sec 16223 12076 Direct 24.7 (49.3) 8556 17123 10820 26.4% (26.4%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.66 24.66 0.00 0.00 0.00 1.3435 0.0000 266819.25 266819.25 0.00% 12076.11 12076.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.58% 18.14 1 45 8556.21 5533 14514 8530.92 6637 10522 155253 155253 0.00%
crit 26.42% 6.52 0 21 17122.80 10882 28512 16965.84 0 23521 111566 111566 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:25.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [C]:14.27
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [i]:3.22
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [m]:7.18
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 443 1.0% 24.7 7.10sec 5404 0 Direct 24.7 4280 8551 5404 26.3% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.66 24.66 0.00 0.00 0.00 0.0000 0.0000 133262.32 133262.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.69% 18.17 1 42 4279.94 2721 7257 4265.92 3319 5328 77774 77774 0.00%
crit 26.31% 6.49 0 21 8551.17 5533 14299 8479.29 0 12258 55488 55488 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 6894 (8338) 15.3% (18.5%) 66.3 4.50sec 37672 30634 Direct 66.3 (132.5) 24591 49195 31147 26.6% (26.6%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.30 66.30 0.00 0.00 0.00 1.2298 0.0000 2064985.13 2064985.13 0.00% 30633.79 30633.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.36% 48.63 25 73 24591.35 4294 51996 24595.09 22055 27162 1195968 1195968 0.00%
crit 26.64% 17.66 4 36 49195.37 8588 101057 49196.32 40139 60458 869017 869017 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [N]:49.36
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [S]:0.55
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [U]:0.73
  • if_expr:buff.rime.react
    single_target
    [h]:15.66
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1444 3.2% 66.2 4.51sec 6539 0 Direct 66.2 5163 10340 6539 26.6% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.15 66.15 0.00 0.00 0.00 0.0000 0.0000 432556.81 432556.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.43% 48.58 27 75 5162.84 2773 10924 5163.76 4535 5747 250795 250795 0.00%
crit 26.57% 17.58 4 35 10340.14 5547 20993 10341.78 8227 12936 181762 181762 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1657 (8666) 3.7% (19.2%) 64.5 4.60sec 40242 19832 Direct 64.5 (212.5) 6082 12176 7696 26.5% (55.4%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.54 64.54 0.00 0.00 0.00 2.0291 0.0000 496697.70 709586.23 30.00% 19832.31 19832.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.52% 47.45 25 75 6081.91 3943 12239 6085.18 5495 6785 288582 412270 30.00%
crit 26.48% 17.09 4 36 12176.26 7886 23934 12179.58 9802 15955 208116 297316 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [P]:23.81
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Q]:47.11
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [T]:9.27
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [g]:11.39
  • if_expr:!variable.pooling_runes&buff.killing_machine.react
    single_target
    [j]:14.67
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 829 1.8% 64.5 4.60sec 3852 0 Direct 64.5 3041 6090 3852 26.6% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.54 64.54 0.00 0.00 0.00 0.0000 0.0000 248588.22 355135.09 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.40% 47.37 25 76 3040.67 1971 6119 3042.45 2737 3409 144051 205793 30.00%
crit 26.60% 17.17 4 37 6089.67 3943 12103 6090.98 4890 7494 104537 149342 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 4120 9.1% 41.7 7.08sec 29603 0 Direct 41.7 0 29603 29603 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.71 41.71 0.00 0.00 0.00 0.0000 0.0000 1234648.99 1234648.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 41.71 21 66 29603.39 16073 62599 29590.75 26582 33553 1234649 1234649 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2060 4.6% 41.7 7.08sec 14802 0 Direct 41.7 0 14802 14802 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.71 41.71 0.00 0.00 0.00 0.0000 0.0000 617324.49 617324.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 41.71 21 66 14801.69 8036 31299 14795.37 13291 16777 617324 617324 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (5531) 0.0% (12.3%) 15.0 20.59sec 110422 87549

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.02 0.00 0.00 0.00 0.00 1.2613 0.0000 0.00 0.00 0.00% 87549.16 87549.16

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [M]:9.41
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [f]:5.61
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5531 12.3% 243.4 1.23sec 6814 0 Direct 243.4 5374 10784 6814 26.6% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 243.36 243.36 0.00 0.00 0.00 0.0000 0.0000 1658181.07 1658181.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.39% 178.60 122 238 5374.21 1112 14546 5372.21 4596 6183 959852 959852 0.00%
crit 26.61% 64.76 32 102 10783.74 2224 27757 10780.79 8615 13170 698329 698329 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 195 0.4% 20.1 14.49sec 2906 0 Direct 20.1 2296 4593 2906 26.5% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.11 20.11 0.00 0.00 0.00 0.0000 0.0000 58443.44 83492.76 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.47% 14.78 3 28 2296.31 2296 2296 2296.31 2296 2296 33936 48481 30.00%
crit 26.53% 5.34 0 15 4592.63 4593 4593 4572.42 0 4593 24508 35012 29.87%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 195 0.4% 20.1 14.45sec 2905 0 Direct 20.1 2296 4593 2905 26.5% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.11 20.11 0.00 0.00 0.00 0.0000 0.0000 58409.76 83444.64 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.49% 14.78 5 30 2296.31 2296 2296 2296.31 2296 2296 33929 48471 30.00%
crit 26.51% 5.33 0 16 4592.63 4593 4593 4572.42 0 4593 24481 34973 29.87%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 1945 / 1061
Claw 641 0.8% 52.3 5.39sec 2005 2005 Direct 52.3 1583 3168 2005 26.6% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.27 52.27 0.00 0.00 0.00 1.0000 0.0000 104781.19 149691.24 30.00% 2004.77 2004.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.41% 38.37 21 53 1583.30 999 3045 1585.25 1416 1800 60745 86780 30.00%
crit 26.59% 13.90 3 29 3168.01 1998 6023 3171.41 2389 4061 44037 62911 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.27
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.69sec 72 72 Direct 2.9 57 115 72 26.2% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.00 1.0000 0.0000 211.68 302.41 30.00% 72.34 72.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.81% 2.16 0 3 57.30 35 79 56.09 0 77 124 177 29.36%
crit 26.19% 0.77 0 3 114.73 71 155 67.45 0 155 88 126 17.64%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.93
main_hand 1303 1.6% 94.6 2.93sec 2251 1445 Direct 94.6 1777 3558 2251 26.6% 0.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.59 94.59 0.00 0.00 0.00 1.5582 0.0000 212922.51 304182.77 30.00% 1444.66 1444.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.38% 69.41 43 91 1777.04 1110 3346 1779.45 1609 1966 123340 176204 30.00%
crit 26.62% 25.18 10 47 3557.51 2220 6617 3562.62 3070 4219 89583 127979 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 2.1 138.43sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.00 1.2952 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [V]:1.45
  • if_expr:runic_power<60
    single_target
    [l]:0.61
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 85.46sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [X]:0.36
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [Y]:3.58
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.8 62.51sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.84 0.00 0.00 0.00 0.00 1.2304 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [O]:4.45
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [k]:0.39
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 7.8 40.10sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.85 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [b]:0.31
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [c]:7.54
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.4 307.26sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [W]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.69sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [e]:2.98
Unholy Strength 20.2 14.46sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.15 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5sec 120.5sec 11.8sec 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 124.9s
  • trigger_min/max:120.0s / 124.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 12.1 29.6 25.1sec 7.1sec 19.2sec 77.74% 0.00% 0.0 (0.0) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.9s / 70.1s
  • trigger_min/max:0.9s / 57.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.9s

Stack Uptimes

  • bonegrinder_crit_1:25.39%
  • bonegrinder_crit_2:18.93%
  • bonegrinder_crit_3:14.14%
  • bonegrinder_crit_4:10.78%
  • bonegrinder_crit_5:8.49%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 3.6 0.0 70.3sec 70.3sec 9.8sec 11.74% 37.39% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.5s / 310.9s
  • trigger_min/max:9.1s / 310.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.1s

Stack Uptimes

  • bonegrinder_frost_1:11.74%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.9 13.8 120.5sec 15.8sec 19.4sec 19.17% 0.00% 1.4 (1.4) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 130.8s
  • trigger_min/max:0.0s / 116.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:1.44%
  • bound_by_fire_and_blaze_2:4.40%
  • bound_by_fire_and_blaze_3:4.25%
  • bound_by_fire_and_blaze_4:3.71%
  • bound_by_fire_and_blaze_5:2.69%
  • bound_by_fire_and_blaze_6:2.68%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=28189} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.6sec 120.6sec 66.7sec 65.42% 0.00% 196.0 (196.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 187.9s
  • trigger_min/max:120.0s / 187.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 181.0s

Stack Uptimes

  • breath_of_sindragosa_1:65.42%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.6sec 120.6sec 0.6sec 0.59% 0.00% 5.5 (5.5) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.63
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 130.8s
  • trigger_min/max:120.0s / 130.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.6s

Stack Uptimes

  • dragon_games_equipment_1:0.59%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 307.3sec 307.3sec 26.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 330.5s
  • trigger_min/max:300.0s / 330.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.72%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 85.5sec 85.5sec 19.5sec 25.89% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 216.4s
  • trigger_min/max:7.2s / 216.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 27.2s

Stack Uptimes

  • empower_rune_weapon_1:25.89%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 7.5 0.0 40.1sec 40.1sec 12.0sec 30.19% 0.00% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:27.3s / 55.8s
  • trigger_min/max:27.3s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • enduring_strength_1:30.19%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 7.7 16.4 40.6sec 12.0sec 9.6sec 24.65% 98.35% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.2s / 127.1s
  • trigger_min/max:0.9s / 117.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:9.92%
  • enduring_strength_builder_2:7.76%
  • enduring_strength_builder_3:4.42%
  • enduring_strength_builder_4:1.82%
  • enduring_strength_builder_5:0.56%
  • enduring_strength_builder_6:0.14%
  • enduring_strength_builder_7:0.03%
  • enduring_strength_builder_8:0.00%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gathering Storm 13.4 127.2 23.1sec 2.1sec 15.2sec 68.24% 86.90% 67.4 (105.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.8s / 85.3s
  • trigger_min/max:0.9s / 36.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.9s

Stack Uptimes

  • gathering_storm_1:2.31%
  • gathering_storm_2:5.00%
  • gathering_storm_3:5.38%
  • gathering_storm_4:3.29%
  • gathering_storm_5:5.44%
  • gathering_storm_6:3.93%
  • gathering_storm_7:3.52%
  • gathering_storm_8:3.74%
  • gathering_storm_9:3.02%
  • gathering_storm_10:32.61%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 7.1 213.5 41.7sec 1.3sec 39.7sec 94.35% 76.72% 199.7 (199.7) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 244.0s
  • trigger_min/max:1.0s / 19.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 271.0s

Stack Uptimes

  • icy_talons_1:4.02%
  • icy_talons_2:3.43%
  • icy_talons_3:86.90%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 42.0 7.3 7.1sec 6.0sec 1.7sec 24.08% 27.45% 7.3 (7.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 52.9s
  • trigger_min/max:0.0s / 50.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.6s

Stack Uptimes

  • killing_machine_1:24.08%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 7.8 0.0 40.1sec 40.1sec 11.8sec 30.82% 30.41% 0.0 (0.0) 7.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:27.3s / 55.8s
  • trigger_min/max:27.3s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:30.82%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 7.8 57.0 40.1sec 4.4sec 11.6sec 30.34% 50.96% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.2s / 55.8s
  • trigger_min/max:0.9s / 46.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:2.04%
  • pillar_of_frost_bonus_2:2.36%
  • pillar_of_frost_bonus_3:2.89%
  • pillar_of_frost_bonus_4:2.40%
  • pillar_of_frost_bonus_5:2.54%
  • pillar_of_frost_bonus_6:2.88%
  • pillar_of_frost_bonus_7:2.37%
  • pillar_of_frost_bonus_8:2.32%
  • pillar_of_frost_bonus_9:2.15%
  • pillar_of_frost_bonus_10:1.82%
  • pillar_of_frost_bonus_11:1.67%
  • pillar_of_frost_bonus_12:1.47%
  • pillar_of_frost_bonus_13:1.12%
  • pillar_of_frost_bonus_14:0.80%
  • pillar_of_frost_bonus_15:0.47%
  • pillar_of_frost_bonus_16:0.29%
  • pillar_of_frost_bonus_17:0.23%
  • pillar_of_frost_bonus_18:0.20%
  • pillar_of_frost_bonus_19:0.16%
  • pillar_of_frost_bonus_20:0.11%
  • pillar_of_frost_bonus_21:0.04%
  • pillar_of_frost_bonus_22:0.01%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.5 1.5 23.0sec 20.6sec 16.8sec 75.89% 0.00% 222.3 (222.3) 12.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 83.4s
  • trigger_min/max:20.0s / 27.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.9s

Stack Uptimes

  • remorseless_winter_1:75.89%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 66.5 6.1 4.5sec 4.2sec 1.5sec 33.37% 99.78% 6.1 (6.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 55.8s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:63.11%
  • duration_min/max:0.0s / 16.3s

Stack Uptimes

  • rime_1:33.37%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.9 14.5 21.7sec 10.3sec 11.7sec 54.10% 0.00% 14.5 (14.5) 13.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 159.6s
  • trigger_min/max:0.9s / 138.8s
  • trigger_pct:15.03%
  • duration_min/max:0.0s / 97.6s

Stack Uptimes

  • rune_mastery_1:54.10%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.3 23.3sec 14.5sec 10.2sec 43.29% 42.38% 7.3 (7.3) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 87.6s
  • trigger_min/max:0.0s / 66.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.6s

Stack Uptimes

  • rune_of_hysteria_1:43.29%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Strength 8.5 11.7 35.8sec 14.4sec 23.5sec 66.30% 0.00% 11.7 (11.7) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 184.2s
  • trigger_min/max:0.0s / 62.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 177.5s

Stack Uptimes

  • unholy_strength_1:66.30%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 7.1 213.5 41.7sec 1.3sec 39.7sec 94.35% 89.53% 199.7 (199.7) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 244.0s
  • trigger_min/max:1.0s / 19.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 271.0s

Stack Uptimes

  • unleashed_frenzy_1:4.02%
  • unleashed_frenzy_2:3.43%
  • unleashed_frenzy_3:86.90%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=6 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.3 7.0 50.0 11.1s 1.3s 124.7s
windfury_totem_extra_attack_oh 22.1 7.0 44.0 13.1s 1.3s 149.8s
Killing Machine spent on Obliterate 41.7 21.0 66.0 7.1s 0.9s 57.2s
Killing Machine: Critical auto attacks 42.0 21.0 67.0 7.1s 1.3s 52.9s
Killing Machine wasted: Critical auto attacks 7.3 0.0 22.0 35.7s 1.3s 294.6s
Rune ready 224.7 157.0 293.0 1.5s 0.0s 13.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.99% 0.00% 15.95% 0.7s 0.0s 6.5s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=357034)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0671.246 / 0.9873.10920.524
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
11.54832.05159.318 / 57.41293.080137.274

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Remorseless Winter0.7290.0017.7938.2860.94022.147
Horn of Winter18.9780.001145.78966.8170.792172.733
Death and Decay86.9500.197230.29228.0250.000230.292
Empower Rune Weapon29.52218.62940.4150.0080.00040.415
Abomination Limb0.7840.0014.9420.9310.0005.685
Pillar of Frost1.8750.00117.20511.1560.77029.960
Breath of Sindragosa0.7950.00167.8671.2410.00067.867
Raise Dead0.7740.0014.9561.3780.3046.163

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Breath of SindragosaRune10.6710.594.71%0.990.080.74%
Empower Rune WeaponRunic Power19.1288.232.29%4.617.387.71%
Empower Rune WeaponRune19.1219.068.48%1.000.060.32%
Frost FeverRunic Power32.25153.573.99%4.767.674.76%
Horn of WinterRunic Power4.84120.913.14%25.000.000.00%
Horn of WinterRune9.679.674.30%1.000.000.00%
Murderous EfficiencyRune20.8620.869.28%1.000.000.00%
Rage of the Frozen ChampionRunic Power66.15513.9613.36%7.7715.282.89%
Rune RegenerationRune89.7989.7939.96%1.000.000.00%
Rune of HysteriaRunic Power162.72332.678.65%2.0428.907.99%
Runic AttenuationRunic Power71.14343.078.92%4.8212.623.55%
Runic EmpowermentRune75.0374.7133.25%1.000.310.42%
Arcane TorrentRunic Power2.0641.291.07%20.000.000.00%
Death and DecayRunic Power1.0610.620.28%10.000.000.00%
Howling BlastRunic Power66.301.430.04%0.020.000.00%
ObliterateRunic Power106.252093.9854.44%19.7130.941.46%
Remorseless WinterRunic Power15.02146.503.81%9.763.672.44%
pet - ghoul
energy_regenEnergy1114.621917.18100.00%1.72169.858.14%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 195.963135.3016.0015.961119.04
Death and DecayRune 1.061.061.001.006085.73
Frost StrikeRunic Power 24.66616.5325.0025.00648.92
Howling BlastRune 66.300.140.000.0017459517.33
ObliterateRune 106.25212.492.003.2912222.86
Remorseless WinterRune 15.0215.021.001.00110421.75
pet - ghoul
ClawEnergy 52.272090.6940.0040.0050.12
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 12.82 12.51 106.5 94.4 0.6 144.0
Rune 6.0 0.75 0.76 0.0 2.0 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 45095.30
Minimum 37425.89
Maximum 54197.76
Spread ( max - min ) 16771.86
Range [ ( max - min ) / 2 * 100% ] 18.60%
Standard Deviation 2308.0056
5th Percentile 41261.17
95th Percentile 48882.02
( 95th Percentile - 5th Percentile ) 7620.85
Mean Distribution
Standard Deviation 26.6523
95.00% Confidence Interval ( 45043.07 - 45147.54 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 101
0.1% Error 10063
0.1 Scale Factor Error with Delta=300 45474
0.05 Scale Factor Error with Delta=300 181894
0.01 Scale Factor Error with Delta=300 4547340
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 45095.30
Minimum 37425.89
Maximum 54197.76
Spread ( max - min ) 16771.86
Range [ ( max - min ) / 2 * 100% ] 18.60%
Standard Deviation 2308.0056
5th Percentile 41261.17
95th Percentile 48882.02
( 95th Percentile - 5th Percentile ) 7620.85
Mean Distribution
Standard Deviation 26.6523
95.00% Confidence Interval ( 45043.07 - 45147.54 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 101
0.1% Error 10063
0.1 Scale Factor Error with Delta=300 45474
0.05 Scale Factor Error with Delta=300 181894
0.01 Scale Factor Error with Delta=300 4547340
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 45095.30
Minimum 37425.89
Maximum 54197.76
Spread ( max - min ) 16771.86
Range [ ( max - min ) / 2 * 100% ] 18.60%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 13199302.03
Minimum 9059820.62
Maximum 17586524.92
Spread ( max - min ) 8526704.30
Range [ ( max - min ) / 2 * 100% ] 32.30%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
5 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
6 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
7 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
8 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
9 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
A 0.00 variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
C 14.27 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
D 0.00 call_action_list,name=trinkets
Choose Action list to run
E 0.00 call_action_list,name=cooldowns
F 0.00 call_action_list,name=racials
G 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
H 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
I 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
J 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
L 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
M 9.41 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
N 49.36 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
O 4.45 horn_of_winter,if=rune<2&runic_power.deficit>25
P 23.81 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
Q 47.11 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
R 1.06 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
S 0.55 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
T 9.27 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
U 0.73 howling_blast,if=buff.rime.react
V 1.45 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
W 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
X 0.36 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
Y 3.58 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
Z 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
a 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
b 0.31 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
c 7.54 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
d 2.94 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
e 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
f 5.61 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
0.00 frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
g 11.39 obliterate,if=!variable.pooling_runes&buff.killing_machine.react
h 15.66 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
i 3.22 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
j 14.67 obliterate,if=!variable.pooling_runes
k 0.39 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
l 0.61 arcane_torrent,if=runic_power.deficit>20
m 7.18 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
n 2.85 use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
o 2.77 use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
p 0.09 use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
q 0.01 use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABaefhjghdnYcWQNPNQNPNQOPNQTNMPNPNToTPNQQYQNQNMQcPNQNQNPQVQOMPQNQQjhgmghmmfjchjCCCghjhCCCjfghCCCghjhCjgCaefChdncQNPQQNQOPNQTMNoYPNQPQNPQQNPMQcNQQPQhjhlkCCCfghjCCCjhjmjhmmcfjmmgjijimghmjhfimmgjhaegChCdncMNPPNQNQNPNQQOQoMYPNPNQNQNQQPcQMNPNQNPNQN

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 4 trinket_1_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 5 trinket_2_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 6 trinket_1_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 7 trinket_2_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 8 trinket_priority Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 9 rw_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat A 2h_check Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default B auto_attack Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 cooldowns a abomination_limb Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, static_empowerment
0:01.036 cooldowns e raise_dead Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, rime, static_empowerment(2)
0:01.036 single_target f remorseless_winter Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, rime, static_empowerment(2)
0:02.072 single_target h howling_blast Fluffy_Pillow 10.0/144: 7% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, remorseless_winter, rime, static_empowerment(3)
0:03.108 single_target j obliterate Fluffy_Pillow 18.0/144: 12% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, gathering_storm, remorseless_winter, static_empowerment(4)
0:04.144 single_target g obliterate Fluffy_Pillow 38.0/144: 26% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, abomination_limb, gathering_storm(3), killing_machine, remorseless_winter, static_empowerment(5)
0:05.178 single_target h howling_blast Fluffy_Pillow 58.0/144: 40% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, gathering_storm(5), remorseless_winter, rime, bonegrinder_crit, static_empowerment(5)
0:06.213 cooldowns d breath_of_sindragosa Fluffy_Pillow 66.0/144: 46% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, gathering_storm(6), remorseless_winter, rime, bonegrinder_crit, static_empowerment(5)
0:06.213 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 66.0/144: 46% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(6), remorseless_winter, rime, bonegrinder_crit, static_empowerment(5)
0:06.213 cooldowns Y empower_rune_weapon Fluffy_Pillow 66.0/144: 46% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(6), remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, static_empowerment(5)
0:06.213 cooldowns c pillar_of_frost Fluffy_Pillow 71.0/144: 49% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, static_empowerment(5)
0:06.213 cooldowns W potion Fluffy_Pillow 71.0/144: 49% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, static_empowerment(5)
0:06.213 breath Q obliterate Fluffy_Pillow 71.0/144: 49% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.114 breath N howling_blast Fluffy_Pillow 96.0/144: 67% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit, bound_by_fire_and_blaze(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:08.014 breath P obliterate Fluffy_Pillow 88.0/144: 61% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons, killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy, bound_by_fire_and_blaze(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:08.916 breath N howling_blast Fluffy_Pillow 97.0/144: 67% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(2), bound_by_fire_and_blaze(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:09.818 breath Q obliterate Fluffy_Pillow 89.0/144: 62% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:10.719 breath N howling_blast Fluffy_Pillow 93.0/144: 65% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:11.619 breath P obliterate Fluffy_Pillow 96.2/144: 67% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.519 breath N howling_blast Fluffy_Pillow 105.0/144: 73% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.421 breath Q obliterate Fluffy_Pillow 98.9/144: 69% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.322 Waiting     0.917 sec 120.1/144: 83% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.239 breath O horn_of_winter Fluffy_Pillow 104.1/144: 72% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.141 breath P obliterate Fluffy_Pillow 135.1/144: 94% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.041 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.940 breath Q obliterate Fluffy_Pillow 121.9/144: 85% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.840 Waiting     0.399 sec 128.0/144: 89% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.239 breath T obliterate Fluffy_Pillow 118.2/144: 82% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:20.139 breath N howling_blast Fluffy_Pillow 143.2/144: 99% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:21.039 breath M remorseless_winter Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:21.939 breath P obliterate Fluffy_Pillow 127.0/144: 88% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:22.840 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:23.740 breath P obliterate Fluffy_Pillow 120.0/144: 83% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:24.640 breath N howling_blast Fluffy_Pillow 124.0/144: 86% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:25.539 breath T obliterate Fluffy_Pillow 116.0/144: 81% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:26.440 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 128.0/144: 89% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:26.440 Waiting     1.236 sec 128.0/144: 89% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.676 breath T obliterate Fluffy_Pillow 117.0/144: 81% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:28.711 Waiting     2.073 sec 126.0/144: 88% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:30.784 breath P obliterate Fluffy_Pillow 94.0/144: 65% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:31.819 breath N howling_blast Fluffy_Pillow 98.0/144: 68% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:32.855 breath Q obliterate Fluffy_Pillow 90.0/144: 62% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:33.890 Waiting     0.651 sec 99.0/144: 69% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:34.541 breath Q obliterate Fluffy_Pillow 83.0/144: 58% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:35.576 Waiting     1.721 sec 87.0/144: 60% runic_power
1.0/6: 17% rune
bloodlust, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:37.297 cooldowns Y empower_rune_weapon Fluffy_Pillow 61.2/144: 43% runic_power
1.0/6: 17% rune
bloodlust, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:37.297 breath Q obliterate Fluffy_Pillow 67.4/144: 47% runic_power
2.0/6: 33% rune
bloodlust, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:38.197 breath N howling_blast Fluffy_Pillow 98.4/144: 68% runic_power
1.0/6: 17% rune
bloodlust, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:39.097 breath Q obliterate Fluffy_Pillow 92.3/144: 64% runic_power
3.0/6: 50% rune
bloodlust, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:39.996 breath N howling_blast Fluffy_Pillow 101.1/144: 70% runic_power
1.0/6: 17% rune
bloodlust, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:40.896 breath M remorseless_winter Fluffy_Pillow 101.2/144: 70% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:42.208 Waiting     0.093 sec 103.8/144: 72% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:42.301 breath Q obliterate Fluffy_Pillow 94.0/144: 65% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:43.472 Waiting     0.509 sec 102.8/144: 71% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
0:43.981 cooldowns c pillar_of_frost Fluffy_Pillow 107.8/144: 75% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
0:44.213 Waiting     1.769 sec 96.8/144: 67% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
0:45.982 breath P obliterate Fluffy_Pillow 80.8/144: 56% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
0:47.152 breath N howling_blast Fluffy_Pillow 89.8/144: 62% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
0:48.322 breath Q obliterate Fluffy_Pillow 70.8/144: 49% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
0:49.490 breath N howling_blast Fluffy_Pillow 74.8/144: 52% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
0:50.659 breath Q obliterate Fluffy_Pillow 66.8/144: 46% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
0:51.831 breath N howling_blast Fluffy_Pillow 70.8/144: 49% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
0:53.002 breath P obliterate Fluffy_Pillow 72.8/144: 51% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
0:54.170 Waiting     1.116 sec 81.8/144: 57% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
0:55.286 breath Q obliterate Fluffy_Pillow 49.8/144: 35% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
0:56.456 breath V arcane_torrent Fluffy_Pillow 58.8/144: 41% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:57.626 breath Q obliterate Fluffy_Pillow 67.8/144: 47% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:58.971 Waiting     1.093 sec 71.8/144: 50% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:00.064 breath O horn_of_winter Fluffy_Pillow 55.8/144: 39% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:01.583 breath M remorseless_winter Fluffy_Pillow 53.8/144: 37% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:02.928 breath P obliterate Fluffy_Pillow 47.8/144: 33% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:04.274 breath Q obliterate Fluffy_Pillow 35.8/144: 25% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:05.618 breath N howling_blast Fluffy_Pillow 39.8/144: 28% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:06.964 breath Q obliterate Fluffy_Pillow 31.8/144: 22% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:08.308 breath Q obliterate Fluffy_Pillow 29.8/144: 21% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:09.653 Waiting     1.590 sec 33.8/144: 24% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:11.243 single_target j obliterate Fluffy_Pillow 1.8/144: 1% runic_power
2.0/6: 33% rune
gathering_storm(9), icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
1:12.588 single_target h howling_blast Fluffy_Pillow 26.8/144: 19% runic_power
1.0/6: 17% rune
gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
1:13.934 single_target g obliterate Fluffy_Pillow 39.8/144: 28% runic_power
3.0/6: 50% rune
rune_mastery, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
1:15.277 single_target m frost_strike Fluffy_Pillow 64.8/144: 45% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:16.622 single_target g obliterate Fluffy_Pillow 39.8/144: 28% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:17.965 single_target h howling_blast Fluffy_Pillow 64.6/144: 45% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:19.312 single_target m frost_strike Fluffy_Pillow 80.8/144: 56% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:20.656 single_target m frost_strike Fluffy_Pillow 62.0/144: 43% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:21.999 single_target f remorseless_winter Fluffy_Pillow 37.0/144: 26% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:23.343 single_target j obliterate Fluffy_Pillow 55.6/144: 39% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:24.687 cooldowns c pillar_of_frost Fluffy_Pillow 80.4/144: 56% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:24.687 single_target h howling_blast Fluffy_Pillow 80.4/144: 56% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(2), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:26.032 single_target j obliterate Fluffy_Pillow 96.5/144: 67% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:27.377 default C frost_strike Fluffy_Pillow 121.3/144: 84% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(5), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, rune_of_hysteria, static_empowerment(5)
1:28.724 default C frost_strike Fluffy_Pillow 96.3/144: 67% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(5), icy_talons, killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
1:30.067 default C frost_strike Fluffy_Pillow 77.5/144: 54% runic_power
3.0/6: 50% rune
unholy_strength, gathering_storm(5), icy_talons(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(2), static_empowerment(5)
1:31.412 single_target g obliterate Fluffy_Pillow 52.5/144: 36% runic_power
4.0/6: 67% rune
unholy_strength, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
1:32.757 single_target h howling_blast Fluffy_Pillow 77.5/144: 54% runic_power
3.0/6: 50% rune
unholy_strength, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
1:34.101 single_target j obliterate Fluffy_Pillow 90.5/144: 63% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
1:35.444 single_target h howling_blast Fluffy_Pillow 110.5/144: 77% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
1:36.788 default C frost_strike Fluffy_Pillow 118.5/144: 82% runic_power
1.0/6: 17% rune
unholy_strength, bonegrinder_crit(4), enduring_strength, static_empowerment(5)
1:38.131 default C frost_strike Fluffy_Pillow 98.5/144: 68% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, bonegrinder_crit(4), enduring_strength, unleashed_frenzy, static_empowerment(5)
1:39.475 default C frost_strike Fluffy_Pillow 73.5/144: 51% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(2), static_empowerment(5)
1:40.818 single_target j obliterate Fluffy_Pillow 48.5/144: 34% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:42.164 single_target f remorseless_winter Fluffy_Pillow 73.5/144: 51% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, rime, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:43.508 single_target g obliterate Fluffy_Pillow 88.5/144: 61% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, remorseless_winter, rime, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:44.853 single_target h howling_blast Fluffy_Pillow 108.5/144: 75% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:46.196 default C frost_strike Fluffy_Pillow 116.5/144: 81% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, static_empowerment(5)
1:47.541 default C frost_strike Fluffy_Pillow 96.5/144: 67% runic_power
2.0/6: 33% rune
rune_mastery, gathering_storm(3), icy_talons, killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy, static_empowerment(5)
1:48.886 default C frost_strike Fluffy_Pillow 71.5/144: 50% runic_power
3.0/6: 50% rune
gathering_storm(3), icy_talons(2), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(2), static_empowerment(5)
1:50.230 single_target g obliterate Fluffy_Pillow 46.5/144: 32% runic_power
5.0/6: 83% rune
gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:51.575 single_target h howling_blast Fluffy_Pillow 66.5/144: 46% runic_power
4.0/6: 67% rune
gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
1:52.919 single_target j obliterate Fluffy_Pillow 79.5/144: 55% runic_power
4.0/6: 67% rune
gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:54.263 single_target h howling_blast Fluffy_Pillow 104.3/144: 72% runic_power
2.0/6: 33% rune
icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:55.608 default C frost_strike Fluffy_Pillow 114.2/144: 79% runic_power
2.0/6: 33% rune
bonegrinder_crit(2), rune_of_hysteria, static_empowerment(5)
1:56.953 single_target j obliterate Fluffy_Pillow 95.4/144: 66% runic_power
4.0/6: 67% rune
icy_talons, bonegrinder_crit(2), unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
1:58.296 single_target g obliterate Fluffy_Pillow 126.4/144: 88% runic_power
2.0/6: 33% rune
icy_talons, killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
1:59.639 default C frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune
icy_talons, rime, bonegrinder_crit(3), unleashed_frenzy, static_empowerment(5)
2:00.983 cooldowns a abomination_limb Fluffy_Pillow 119.0/144: 83% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), rime, bonegrinder_crit(3), unleashed_frenzy(2), static_empowerment(5)
2:02.327 cooldowns e raise_dead Fluffy_Pillow 124.0/144: 86% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, icy_talons(2), rime, bonegrinder_crit(3), unleashed_frenzy(2), static_empowerment(5)
2:02.327 single_target f remorseless_winter Fluffy_Pillow 124.0/144: 86% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, icy_talons(2), rime, bonegrinder_crit(3), unleashed_frenzy(2), static_empowerment(5)
2:03.672 default C frost_strike Fluffy_Pillow 134.0/144: 93% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, icy_talons(2), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(2), static_empowerment(5)
2:05.016 single_target h howling_blast Fluffy_Pillow 114.0/144: 79% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
2:06.362 cooldowns d breath_of_sindragosa Fluffy_Pillow 122.0/144: 85% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
2:06.362 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 122.0/144: 85% runic_power
6.0/6: 100% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
2:06.362 cooldowns c pillar_of_frost Fluffy_Pillow 122.0/144: 85% runic_power
6.0/6: 100% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze, static_empowerment(5)
2:06.362 breath Q obliterate Fluffy_Pillow 122.0/144: 85% runic_power
6.0/6: 100% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), bound_by_fire_and_blaze, static_empowerment(5)
2:07.708 breath N howling_blast Fluffy_Pillow 126.0/144: 88% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze, static_empowerment(5)
2:09.053 breath P obliterate Fluffy_Pillow 118.0/144: 82% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(4), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:10.399 breath Q obliterate Fluffy_Pillow 106.0/144: 74% runic_power
5.0/6: 83% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:11.744 breath Q obliterate Fluffy_Pillow 110.0/144: 76% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:13.087 breath N howling_blast Fluffy_Pillow 119.0/144: 83% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:14.432 breath Q obliterate Fluffy_Pillow 95.0/144: 66% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:15.777 breath O horn_of_winter Fluffy_Pillow 99.0/144: 69% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:17.122 breath P obliterate Fluffy_Pillow 113.0/144: 78% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:18.466 breath N howling_blast Fluffy_Pillow 106.0/144: 74% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:19.810 breath Q obliterate Fluffy_Pillow 98.0/144: 68% runic_power
4.0/6: 67% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:21.156 breath T obliterate Fluffy_Pillow 107.0/144: 74% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:22.501 breath M remorseless_winter Fluffy_Pillow 100.0/144: 69% runic_power
1.0/6: 17% rune
breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:23.844 breath N howling_blast Fluffy_Pillow 94.0/144: 65% runic_power
0.0/6: 0% rune
breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
2:25.190 Waiting     1.260 sec 86.0/144: 60% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
2:26.450 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 59.0/144: 41% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:26.450 cooldowns Y empower_rune_weapon Fluffy_Pillow 59.0/144: 41% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5)
2:26.450 breath P obliterate Fluffy_Pillow 64.0/144: 44% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5)
2:27.622 breath N howling_blast Fluffy_Pillow 68.0/144: 47% runic_power
4.0/6: 67% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:28.792 breath Q obliterate Fluffy_Pillow 60.0/144: 42% runic_power
5.0/6: 83% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:29.960 breath P obliterate Fluffy_Pillow 70.2/144: 49% runic_power
3.0/6: 50% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:31.130 breath Q obliterate Fluffy_Pillow 85.2/144: 59% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:32.300 breath N howling_blast Fluffy_Pillow 106.4/144: 74% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:33.472 breath P obliterate Fluffy_Pillow 90.5/144: 63% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:34.642 Waiting     1.825 sec 99.3/144: 69% runic_power
1.0/6: 17% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:36.467 breath Q obliterate Fluffy_Pillow 79.7/144: 55% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:37.638 breath Q obliterate Fluffy_Pillow 88.5/144: 61% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:38.809 breath N howling_blast Fluffy_Pillow 97.3/144: 68% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), static_empowerment(5)
2:39.979 Waiting     0.414 sec 94.3/144: 66% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_frost, unleashed_frenzy(3), static_empowerment(5)
2:40.393 breath P obliterate Fluffy_Pillow 78.3/144: 54% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_frost, unleashed_frenzy(3), static_empowerment(5)
2:41.561 Waiting     0.791 sec 92.3/144: 64% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), static_empowerment(5)
2:42.352 breath M remorseless_winter Fluffy_Pillow 92.3/144: 64% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), static_empowerment(5)
2:43.673 breath Q obliterate Fluffy_Pillow 70.3/144: 49% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:44.843 cooldowns c pillar_of_frost Fluffy_Pillow 84.3/144: 59% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:44.843 breath N howling_blast Fluffy_Pillow 84.3/144: 59% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:46.013 breath Q obliterate Fluffy_Pillow 76.3/144: 53% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:47.182 Waiting     3.596 sec 85.3/144: 59% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
2:50.778 breath Q obliterate Fluffy_Pillow 26.3/144: 18% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
2:52.122 Waiting     0.885 sec 30.3/144: 21% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
2:53.007 breath P obliterate Fluffy_Pillow 19.3/144: 13% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
2:54.352 breath Q obliterate Fluffy_Pillow 23.3/144: 16% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
2:55.698 single_target h howling_blast Fluffy_Pillow 11.3/144: 8% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
2:57.042 single_target j obliterate Fluffy_Pillow 24.3/144: 17% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:58.387 single_target h howling_blast Fluffy_Pillow 44.3/144: 31% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:59.731 single_target l arcane_torrent Fluffy_Pillow 52.3/144: 36% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:01.075 single_target k horn_of_winter Fluffy_Pillow 72.3/144: 50% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:02.420 default C frost_strike Fluffy_Pillow 107.3/144: 75% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, killing_machine, bonegrinder_crit, enduring_strength, rune_of_hysteria, static_empowerment(5)
3:03.764 default C frost_strike Fluffy_Pillow 82.3/144: 57% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, icy_talons, killing_machine, enduring_strength, unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
3:05.109 default C frost_strike Fluffy_Pillow 57.3/144: 40% runic_power
6.0/6: 100% rune
unholy_strength, icy_talons(2), killing_machine, enduring_strength, unleashed_frenzy(2), rune_of_hysteria, static_empowerment(5)
3:06.453 single_target f remorseless_winter Fluffy_Pillow 32.3/144: 22% runic_power
6.0/6: 100% rune
unholy_strength, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:07.798 single_target g obliterate Fluffy_Pillow 44.7/144: 31% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:09.143 single_target h howling_blast Fluffy_Pillow 81.9/144: 57% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:10.487 single_target j obliterate Fluffy_Pillow 91.8/144: 64% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:11.832 default C frost_strike Fluffy_Pillow 116.6/144: 81% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(5), remorseless_winter, bonegrinder_crit, rune_of_hysteria, static_empowerment(5)
3:13.176 default C frost_strike Fluffy_Pillow 91.6/144: 64% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons, remorseless_winter, bonegrinder_crit, unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
3:14.521 default C frost_strike Fluffy_Pillow 72.8/144: 51% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons(2), remorseless_winter, bonegrinder_crit, unleashed_frenzy(2), rune_of_hysteria, static_empowerment(5)
3:15.866 single_target j obliterate Fluffy_Pillow 54.0/144: 38% runic_power
3.0/6: 50% rune
gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:17.209 single_target h howling_blast Fluffy_Pillow 78.8/144: 55% runic_power
3.0/6: 50% rune
unholy_strength, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:18.554 single_target j obliterate Fluffy_Pillow 88.8/144: 62% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
3:19.897 single_target m frost_strike Fluffy_Pillow 108.8/144: 76% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
3:21.242 single_target j obliterate Fluffy_Pillow 83.8/144: 58% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
3:22.587 single_target h howling_blast Fluffy_Pillow 103.8/144: 72% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), rime, unleashed_frenzy(3), static_empowerment(5)
3:23.929 single_target m frost_strike Fluffy_Pillow 111.8/144: 78% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
3:25.274 single_target m frost_strike Fluffy_Pillow 91.8/144: 64% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
3:26.618 cooldowns c pillar_of_frost Fluffy_Pillow 71.8/144: 50% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
3:26.843 single_target f remorseless_winter Fluffy_Pillow 71.8/144: 50% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), pillar_of_frost, unleashed_frenzy(3), static_empowerment(5)
3:28.186 single_target j obliterate Fluffy_Pillow 81.8/144: 57% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:29.532 single_target m frost_strike Fluffy_Pillow 111.8/144: 78% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(2), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:30.876 single_target m frost_strike Fluffy_Pillow 91.8/144: 64% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(2), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:32.222 single_target g obliterate Fluffy_Pillow 71.8/144: 50% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(2), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:33.566 single_target j obliterate Fluffy_Pillow 96.8/144: 67% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:34.911 single_target i frost_strike Fluffy_Pillow 121.8/144: 85% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:36.256 single_target j obliterate Fluffy_Pillow 101.8/144: 71% runic_power
3.0/6: 50% rune
rune_mastery, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:37.602 single_target i frost_strike Fluffy_Pillow 121.8/144: 85% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
3:38.946 single_target m frost_strike Fluffy_Pillow 101.8/144: 71% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:40.291 single_target g obliterate Fluffy_Pillow 81.8/144: 57% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:41.636 single_target h howling_blast Fluffy_Pillow 106.8/144: 74% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:42.981 single_target m frost_strike Fluffy_Pillow 114.8/144: 80% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:44.325 single_target j obliterate Fluffy_Pillow 89.8/144: 62% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:45.670 single_target h howling_blast Fluffy_Pillow 114.6/144: 80% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:47.015 single_target f remorseless_winter Fluffy_Pillow 124.5/144: 86% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:48.360 single_target i frost_strike Fluffy_Pillow 136.9/144: 95% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:49.708 single_target m frost_strike Fluffy_Pillow 111.9/144: 78% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:51.052 single_target m frost_strike Fluffy_Pillow 93.1/144: 65% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:52.397 single_target g obliterate Fluffy_Pillow 68.1/144: 47% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:53.741 single_target j obliterate Fluffy_Pillow 88.1/144: 61% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(2), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:55.085 single_target h howling_blast Fluffy_Pillow 108.1/144: 75% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:56.431 Waiting     4.340 sec 116.1/144: 81% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
4:00.771 cooldowns a abomination_limb Fluffy_Pillow 126.1/144: 88% runic_power
1.0/6: 17% rune
unholy_strength, killing_machine, bonegrinder_crit, rune_of_hysteria, static_empowerment(5)
4:02.328 cooldowns e raise_dead Fluffy_Pillow 126.1/144: 88% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, killing_machine, rime, bonegrinder_crit, rune_of_hysteria, static_empowerment(5)
4:02.328 single_target g obliterate Fluffy_Pillow 126.1/144: 88% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, killing_machine, rime, bonegrinder_crit, rune_of_hysteria, static_empowerment(5)
4:03.671 default C frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, rime, bonegrinder_crit(2), rune_of_hysteria, static_empowerment(5)
4:05.016 single_target h howling_blast Fluffy_Pillow 125.2/144: 87% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, icy_talons, killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
4:06.361 default C frost_strike Fluffy_Pillow 141.3/144: 98% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, icy_talons, killing_machine, bonegrinder_crit(2), unleashed_frenzy, rune_of_hysteria, static_empowerment(5)
4:07.706 cooldowns d breath_of_sindragosa Fluffy_Pillow 116.3/144: 81% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, icy_talons(2), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(2), rune_of_hysteria, static_empowerment(5)
4:07.706 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 116.3/144: 81% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(2), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(2), rune_of_hysteria, static_empowerment(5)
4:07.706 cooldowns c pillar_of_frost Fluffy_Pillow 116.3/144: 81% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(2), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(2), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
4:07.706 breath M remorseless_winter Fluffy_Pillow 116.3/144: 81% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(2), killing_machine, pillar_of_frost, rime, bonegrinder_crit(2), unleashed_frenzy(2), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
4:09.050 breath N howling_blast Fluffy_Pillow 112.7/144: 78% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze, static_empowerment(5)
4:10.395 breath P obliterate Fluffy_Pillow 104.7/144: 73% runic_power
6.0/6: 100% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze, static_empowerment(5)
4:11.739 breath P obliterate Fluffy_Pillow 92.7/144: 64% runic_power
6.0/6: 100% rune
abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze, static_empowerment(5)
4:13.083 breath N howling_blast Fluffy_Pillow 96.7/144: 67% runic_power
5.0/6: 83% rune
breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
4:14.428 breath Q obliterate Fluffy_Pillow 98.7/144: 69% runic_power
5.0/6: 83% rune
breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:15.773 breath N howling_blast Fluffy_Pillow 91.7/144: 64% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:17.116 breath Q obliterate Fluffy_Pillow 83.7/144: 58% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
4:18.461 breath N howling_blast Fluffy_Pillow 87.7/144: 61% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
4:19.805 breath P obliterate Fluffy_Pillow 68.7/144: 48% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
4:21.150 breath N howling_blast Fluffy_Pillow 77.7/144: 54% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:22.496 breath Q obliterate Fluffy_Pillow 69.7/144: 48% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:23.839 breath Q obliterate Fluffy_Pillow 63.9/144: 44% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:25.183 breath O horn_of_winter Fluffy_Pillow 78.9/144: 55% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:26.529 breath Q obliterate Fluffy_Pillow 93.9/144: 65% runic_power
3.0/6: 50% rune
breath_of_sindragosa, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:27.872 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 86.7/144: 60% runic_power
1.0/6: 17% rune
breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:27.872 breath M remorseless_winter Fluffy_Pillow 86.7/144: 60% runic_power
1.0/6: 17% rune
breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, static_empowerment(5)
4:29.216 Waiting     1.579 sec 89.3/144: 62% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:30.795 cooldowns Y empower_rune_weapon Fluffy_Pillow 57.3/144: 40% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:30.795 breath P obliterate Fluffy_Pillow 63.5/144: 44% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:31.965 breath N howling_blast Fluffy_Pillow 78.5/144: 55% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:33.136 breath P obliterate Fluffy_Pillow 78.6/144: 55% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:34.307 breath N howling_blast Fluffy_Pillow 93.6/144: 65% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:35.477 breath Q obliterate Fluffy_Pillow 87.6/144: 61% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:36.647 breath N howling_blast Fluffy_Pillow 101.6/144: 71% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:37.818 breath Q obliterate Fluffy_Pillow 77.6/144: 54% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:38.988 breath N howling_blast Fluffy_Pillow 86.4/144: 60% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:40.158 breath Q obliterate Fluffy_Pillow 80.3/144: 56% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:41.329 breath Q obliterate Fluffy_Pillow 95.3/144: 66% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:42.500 Waiting     2.818 sec 104.1/144: 72% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:45.318 breath P obliterate Fluffy_Pillow 62.3/144: 43% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:46.488 cooldowns c pillar_of_frost Fluffy_Pillow 83.5/144: 58% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:46.488 breath Q obliterate Fluffy_Pillow 83.5/144: 58% runic_power
2.0/6: 33% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:47.657 breath M remorseless_winter Fluffy_Pillow 98.5/144: 68% runic_power
4.0/6: 67% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
4:49.042 breath N howling_blast Fluffy_Pillow 76.5/144: 53% runic_power
4.0/6: 67% rune
breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
4:50.213 breath P obliterate Fluffy_Pillow 68.5/144: 48% runic_power
5.0/6: 83% rune
breath_of_sindragosa, empower_rune_weapon, gathering_storm, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
4:51.383 breath N howling_blast Fluffy_Pillow 77.5/144: 54% runic_power
5.0/6: 83% rune
breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
4:52.728 breath Q obliterate Fluffy_Pillow 53.5/144: 37% runic_power
5.0/6: 83% rune
breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
4:54.072 breath N howling_blast Fluffy_Pillow 62.5/144: 43% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
4:55.416 breath P obliterate Fluffy_Pillow 54.5/144: 38% runic_power
4.0/6: 67% rune
breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
4:56.761 breath N howling_blast Fluffy_Pillow 47.5/144: 33% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
4:58.106 breath Q obliterate Fluffy_Pillow 39.5/144: 27% runic_power
4.0/6: 67% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
4:59.450 breath N howling_blast Fluffy_Pillow 48.5/144: 34% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5903 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3463 0 13076 12453 6915
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 261520 249060 0
Runic Power 144 144 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 24.64% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 6198 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +687 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +89 Sta (watchers_loam_2) }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit (devotion_of_critical_strike_2) }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +386 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets=use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant=watchers_loam_2
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_critical_strike_2
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=6915
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 43864 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
43863.6 43863.6 43.9 / 0.100% 7411.3 / 16.9% 2620.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.5 7.7 Runic Power 2.56% 52.0 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 43864
Apocalypse 224 0.5% 7.0 45.50sec 9637 7545 Direct 7.0 8339 16676 9637 15.6%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 0.00 1.2774 0.0000 67254.77 67254.77 0.00% 7544.85 7544.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.44% 5.89 1 8 8339.37 6617 11341 8333.11 7279 9314 49146 49146 0.00%
crit 15.56% 1.09 0 6 16676.43 13235 22683 11567.53 0 21591 18109 18109 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=15 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [O]:5.98
  • if_expr:active_enemies<=3&cooldown.dark_transformation.remains
  • target_if_expr:debuff.festering_wound.stack
    opener
    [Z]:1.00
  • if_expr:buff.commander_of_the_dead_window.up
auto_attack_mh 2858 6.5% 148.0 2.44sec 5789 2403 Direct 148.0 5021 10042 5789 15.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.04 148.04 0.00 0.00 0.00 2.4094 0.0000 857000.04 1224316.98 30.00% 2402.60 2402.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.70% 125.40 87 167 5020.87 3791 6917 5019.94 4779 5278 629599 899451 30.00%
crit 15.30% 22.65 8 42 10041.70 7582 13835 10040.16 8931 11121 227401 324866 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Dark Transformation 199 0.5% 7.0 45.62sec 8525 6673 Direct 7.0 7385 14762 8524 15.4%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.00 1.2777 0.0000 59673.62 59673.62 0.00% 6672.66 6672.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.55% 5.92 2 8 7385.23 5823 10419 7378.19 6167 8408 43711 43711 0.00%
crit 15.45% 1.08 0 6 14761.99 11646 20292 10192.44 0 19641 15963 15963 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [M]:5.83
  • if_expr:variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
    cooldowns
    [N]:0.18
  • if_expr:variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
    opener
    [a]:1.00
  • if_expr:debuff.festering_wound.stack>=4
Death Coil 4197 (5439) 9.6% (12.4%) 95.8 3.09sec 17003 14608 Direct 95.7 (227.9) 11377 22744 13126 15.4% (15.4%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.75 95.71 0.00 0.00 0.00 1.1640 0.0000 1256305.65 1256305.65 0.00% 14608.37 14608.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.62% 80.99 55 108 11377.31 7356 18286 11386.54 10736 12365 921430 921430 0.00%
crit 15.38% 14.72 3 30 22743.86 14712 36052 22758.88 18922 28037 334876 334876 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    generic
    [T]:93.61
  • if_expr:!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
    opener
    [Y]:2.14
  • if_expr:pet.gargoyle.active&!prev_gcd.1.death_coil
    Coil of Devastation 1242 2.8% 0.0 0.00sec 0 0 Periodic 132.2 2813 0 2813 0.0% 88.1%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 132.17 132.17 81.05 0.0000 2.0000 371811.56 371811.56 0.00% 1406.56 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 132.17 98 167 2813.11 1103 12165 2820.01 2426 3390 371812 371812 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 699 1.6% 5.5 46.84sec 38472 0 Direct 5.5 33373 66746 38501 15.4%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.47 5.46 0.00 0.00 0.00 0.0000 0.0000 210251.72 300367.26 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.64% 4.62 1 6 33373.08 33373 33373 33373.08 33373 33373 154249 220361 30.00%
crit 15.36% 0.84 0 5 66746.15 66746 66746 39554.60 0 66746 56003 80006 17.78%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1170 2.7% 26.2 11.52sec 13405 10914 Direct 26.2 11614 23221 13405 15.4%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.20 26.20 0.00 0.00 0.00 1.2282 0.0000 351236.13 501778.69 30.00% 10914.39 10914.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.56% 22.16 11 32 11613.57 8646 18322 11601.32 10391 12563 257322 367612 30.00%
crit 15.44% 4.04 0 14 23220.87 17293 36107 22837.50 0 35035 93914 134167 29.55%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    generic
    [V]:24.37
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
    opener
    [b]:1.84
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1867 4.3% 103.9 3.51sec 5389 0 Direct 103.9 4675 9347 5389 15.3%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.91 103.91 0.00 0.00 0.00 0.0000 0.0000 559950.73 559950.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.72% 88.03 59 117 4675.05 3287 7872 4676.05 4343 4965 411550 411550 0.00%
crit 15.28% 15.88 4 32 9347.43 6575 15743 9346.80 7775 11128 148401 148401 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 84 0.2% 11.9 26.32sec 2115 1756 Direct 11.9 1836 3677 2115 15.2%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.87 11.87 0.00 0.00 0.00 1.2047 0.0000 25105.08 25105.08 0.00% 1755.97 1755.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.81% 10.07 3 14 1835.72 1259 3080 1836.08 1552 2126 18479 18479 0.00%
crit 15.19% 1.80 0 10 3676.54 2517 6161 3145.27 0 6072 6626 6626 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    default
    [E]:11.87
  • target_if_expr:(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
Scourge Strike 970 (2245) 2.2% (5.1%) 77.1 3.75sec 8738 7609 Direct 77.1 (154.2) 3272 6546 3776 15.4% (15.4%)

Stats Details: Scourge Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.10 77.10 0.00 0.00 0.00 1.1485 0.0000 291147.83 415936.08 30.00% 7608.53 7608.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.61% 65.24 42 91 3272.22 2446 4940 3271.62 3065 3449 213481 304981 30.00%
crit 15.39% 11.86 1 27 6546.21 4892 9880 6546.77 5367 7841 77667 110955 30.00%

Action Details: Scourge Strike

  • id:55090
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:
  • description:An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.

Action Priority List

    generic
    [U]:77.11
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    Scourge Strike (_shadow) 1276 2.9% 0.0 0.00sec 0 0 Direct 77.1 4301 8602 4962 15.4%

Stats Details: Scourge Strike Shadow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 77.10 0.00 0.00 0.00 0.0000 0.0000 382618.03 382618.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.62% 65.24 39 92 4300.60 2777 6804 4302.90 3991 4619 280584 280584 0.00%
crit 15.38% 11.86 1 26 8601.81 5553 13608 8605.26 6857 10849 102034 102034 0.00%

Action Details: Scourge Strike Shadow

  • id:70890
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:70890
  • name:Scourge Strike
  • school:shadow
  • tooltip:
  • description:{$@spelldesc55090=An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.}
Soul Reaper 444 (2577) 1.0% (5.9%) 15.7 6.86sec 49313 39787 Direct 15.7 (31.4) 7358 14722 8502 15.5% (15.5%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.68 15.68 0.00 0.00 0.00 1.2395 0.0000 133316.39 133316.39 0.00% 39786.62 39786.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.47% 13.24 6 20 7358.35 4770 11186 7365.84 6444 8129 97460 97460 0.00%
crit 15.53% 2.44 0 10 14721.83 8999 22054 13633.59 0 21100 35856 35856 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [S]:15.68
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
    Soul Reaper (_execute) 2132 4.9% 15.7 6.86sec 40835 0 Direct 15.7 35341 70730 40836 15.5%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.67 15.67 0.00 0.00 0.00 0.0000 0.0000 639936.52 639936.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.48% 13.24 6 20 35341.33 26079 50965 35375.92 31856 40239 467858 467858 0.00%
crit 15.52% 2.43 0 9 70730.25 52158 101931 65245.66 0 100485 172078 172078 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 211 0.5% 3.7 90.74sec 17250 14871 Direct 3.7 14982 30000 17250 15.1%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.66 3.66 0.00 0.00 0.00 1.1602 0.0000 63214.58 63214.58 0.00% 14870.52 14870.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.90% 3.11 0 4 14982.05 12322 17822 14963.26 0 17822 46612 46612 0.00%
crit 15.10% 0.55 0 4 29999.70 24644 35644 13503.11 0 35644 16602 16602 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [R]:3.66
  • if_expr:variable.st_planning
Unholy Pact 1337 3.1% 123.1 2.63sec 3255 0 Direct 123.1 2823 5644 3255 15.3%

Stats Details: Unholy Pact

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 123.13 123.13 0.00 0.00 0.00 0.0000 0.0000 400809.93 400809.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.67% 104.25 75 135 2822.56 1948 4501 2822.51 2595 3042 294251 294251 0.00%
crit 15.33% 18.88 4 35 5643.92 3896 9002 5642.21 4847 6862 106558 106558 0.00%

Action Details: Unholy Pact

  • id:319236
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:319236
  • name:Unholy Pact
  • school:shadow
  • tooltip:Deals {$s1=0} Shadow damage.
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
Virulent Plague 882 2.0% 11.9 26.32sec 22285 0 Periodic 99.2 2312 4624 2667 15.4% 99.2%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.87 0.00 99.16 99.16 10.87 0.0000 3.0000 264485.37 264485.37 0.00% 889.09 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 84.61% 83.90 55 113 2311.52 1654 4017 2311.75 2191 2443 193942 193942 0.00%
crit 15.39% 15.26 4 33 4623.59 3309 8033 4623.88 3885 5629 70543 70543 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 6005 / 6005
Claw 312 0.7% 37.9 7.86sec 2477 2466 Direct 37.9 2146 4290 2477 15.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.92 37.92 0.00 0.00 0.00 1.0045 0.0000 93913.85 134166.06 30.00% 2465.51 2465.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.59% 32.08 19 47 2146.30 1713 3343 2144.53 1977 2277 68851 98361 30.00%
crit 15.41% 5.84 0 15 4290.16 3425 5945 4280.09 0 5240 25063 35805 29.94%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:37.92
  • if_expr:energy>70
Gnaw 1 0.0% 2.6 90.04sec 84 84 Direct 2.6 73 146 84 15.4%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.61 2.61 0.00 0.00 0.00 1.0046 0.0000 220.36 314.81 30.00% 84.01 84.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.57% 2.21 0 4 73.05 63 91 51.40 0 91 161 230 21.12%
crit 15.43% 0.40 0 4 146.43 125 180 47.12 0 180 59 84 9.66%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.61
main_hand 4306 9.8% 191.8 1.55sec 6717 4329 Direct 191.8 5825 11659 6717 15.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 191.85 191.85 0.00 0.00 0.00 1.5517 0.0000 1288725.21 1841082.95 30.00% 4329.14 4329.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.71% 162.51 120 208 5825.27 1936 13250 5835.59 5298 6530 946660 1352406 30.00%
crit 15.29% 29.34 11 54 11658.99 3871 26501 11684.15 7145 16482 342065 488677 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Monstrous Blow 10 0.0% 1.1 91.11sec 2849 2839 Direct 1.1 2458 4929 2849 15.8%

Stats Details: Monstrous Blow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.09 1.09 0.00 0.00 0.00 1.0045 0.0000 3114.17 4448.93 30.00% 2838.81 2838.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.18% 0.92 0 4 2457.97 2006 3075 740.11 0 2922 2262 3231 9.02%
crit 15.82% 0.17 0 3 4928.90 4012 6151 682.85 0 6151 852 1218 4.16%

Action Details: Monstrous Blow

  • id:91797
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91797
  • name:Monstrous Blow
  • school:physical
  • tooltip:Stunned.
  • description:Strike an enemy with a smashing attack, dealing {$s2=0} Physical damage and stunning for {$d=2 seconds}.

Action Priority List

    default
    [ ]:1.09
Sweeping Claws 1375 3.1% 68.0 4.29sec 6048 6021 Direct 68.0 5244 10490 6048 15.3%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 68.00 68.00 0.00 0.00 0.00 1.0045 0.0000 411317.20 411317.20 0.00% 6021.33 6021.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.67% 57.58 35 76 5243.86 3796 8518 5246.29 4895 5635 301926 301926 0.00%
crit 15.33% 10.43 0 23 10490.41 7592 16801 10492.03 0 13579 109392 109392 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:68.00
pet - gargoyle 31122 / 5251
Gargoyle Strike 31122 11.9% 39.8 5.31sec 39138 36093 Direct 39.8 33931 67687 39138 15.4%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.75 39.75 0.00 0.00 0.00 1.0844 0.0000 1555736.38 1555736.38 0.00% 36093.46 36093.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.58% 33.62 21 40 33931.31 6177 77415 33929.16 28022 40425 1140765 1140765 0.00%
crit 15.42% 6.13 0 16 67687.23 12354 139602 67623.13 0 113995 414971 414971 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.

Action Priority List

    default
    [ ]:41.75
pet - risen_skulker 1182 / 1182
Skulker Shot 1182 2.7% 153.8 1.94sec 2303 1185 Direct 153.7 1998 3996 2304 15.3%

Stats Details: Skulker Shot

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.80 153.74 0.00 0.00 0.00 1.9440 0.0000 354171.18 505971.72 30.00% 1184.59 1184.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.71% 130.23 95 167 1998.20 1469 3351 1998.93 1902 2122 260218 371749 30.00%
crit 15.29% 23.51 8 43 3995.90 2937 6610 3997.56 3531 4677 93954 134223 30.00%

Action Details: Skulker Shot

  • id:212423
  • school:physical
  • range:35.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:212423
  • name:Skulker Shot
  • school:physical
  • tooltip:
  • description:A ranged shot that causes Physical damage.

Action Priority List

    default
    [ ]:154.80
pet - magus_of_the_dead 7631 / 3388
Frostbolt 2270 2.3% 34.4 8.54sec 8724 6191 Direct 34.4 7553 15117 8726 15.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.44 34.43 0.00 0.00 0.00 1.4092 0.0000 300468.42 300468.42 0.00% 6190.63 6190.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.49% 29.09 19 38 7552.94 3824 11982 7553.92 6650 8366 219753 219753 0.00%
crit 15.51% 5.34 0 14 15117.41 7648 23633 15070.34 0 22310 80715 80715 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:18.78
    default
    [ ]:19.51
Shadow Bolt 5361 5.4% 82.3 3.51sec 8615 6642 Direct 82.3 7468 14938 8617 15.4%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.28 82.26 0.00 0.00 0.00 1.2970 0.0000 708854.98 708854.98 0.00% 6642.44 6642.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.62% 69.61 52 85 7468.39 3658 11269 7468.80 6662 8097 519906 519906 0.00%
crit 15.38% 12.65 2 27 14937.56 7316 22226 14938.18 11504 18947 188949 188949 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:42.94
    default
    [ ]:44.47
pet - army_ghoul 24478 / 5532
Claw 4009 2.0% 212.1 1.02sec 1265 1265 Direct 212.1 1097 2194 1265 15.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 212.09 212.09 0.00 0.00 0.00 1.0000 0.0000 268380.09 383409.91 30.00% 1265.41 1265.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.65% 179.52 139 201 1096.97 525 1564 1096.45 928 1189 196932 281338 30.00%
crit 15.35% 32.57 15 55 2193.92 1050 3129 2192.61 1607 2502 71448 102072 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:26.44
    default
    [ ]:26.49
    default
    [ ]:26.47
    default
    [ ]:26.53
    default
    [ ]:26.54
    default
    [ ]:26.52
    default
    [ ]:26.57
    default
    [ ]:26.54
main_hand 20469 10.5% 347.6 0.62sec 3941 3485 Direct 347.6 3416 6834 3941 15.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 347.64 347.64 0.00 0.00 0.00 1.1310 0.0000 1370116.22 1957358.80 30.00% 3484.84 3484.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.63% 294.20 233 321 3415.81 1571 4682 3413.85 2853 3675 1004937 1435661 30.00%
crit 15.37% 53.43 30 81 6834.12 3142 9364 6831.05 5301 7587 365179 521698 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - apoc_ghoul 7942 / 2715
Claw 1696 1.3% 153.1 1.83sec 1134 1134 Direct 153.1 983 1966 1134 15.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.07 153.07 0.00 0.00 0.00 1.0000 0.0000 173652.58 248081.43 30.00% 1134.48 1134.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.58% 129.46 83 166 982.82 551 1521 983.24 871 1064 127237 181772 30.00%
crit 15.42% 23.61 7 44 1966.00 1137 3042 1966.55 1606 2342 46416 66310 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:37.98
    default
    [ ]:38.53
    default
    [ ]:38.54
    default
    [ ]:38.02
main_hand 6245 4.9% 182.1 1.53sec 3512 2543 Direct 182.1 3043 6083 3512 15.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 182.08 182.08 0.00 0.00 0.00 1.3807 0.0000 639405.57 913459.82 30.00% 2543.39 2543.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.59% 154.02 91 202 3043.21 1649 4552 3045.36 2728 3309 468713 669607 30.00%
crit 15.41% 28.06 10 59 6083.10 3298 9105 6087.84 5120 7299 170693 243853 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Army of the Dead 2.0 0.00sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 1.1671 0.5000 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    default
    [D]:2.00
  • if_expr:talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 182.77sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [c]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 166.15sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.42 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [P]:2.42
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 306.36sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [L]:0.46
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
    opener
    [X]:1.00
  • if_expr:pet.gargoyle.active|!talent.summon_gargoyle&pet.army_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Algeth'ar Puzzle (solved_the_puzzle) 2.0 182.79sec

Stats Details: Solved The Puzzle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Solved The Puzzle

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
Summon Gargoyle 2.0 185.80sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [Q]:1.00
  • if_expr:buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
    opener
    [W]:1.00
  • if_expr:buff.commander_of_the_dead_window.up
Unholy Strength 21.5 13.58sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.53 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 2.0 182.8sec 60.9sec 20.0sec 13.51% 0.00% 2.0 (2.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3273.11
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3273.11

Trigger Details

  • interval_min/max:181.2s / 232.6s
  • trigger_min/max:0.0s / 232.6s
  • trigger_pct:100.00%
  • duration_min/max:12.9s / 20.0s

Stack Uptimes

  • algethar_puzzle_1:13.51%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 232.6s
  • trigger_min/max:180.0s / 232.6s
  • trigger_pct:100.00%
  • duration_min/max:7.4s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
commander_of_the_dead_window 7.0 0.0 45.6sec 45.6sec 4.0sec 9.30% 44.44% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead_window
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 53.9s
  • trigger_min/max:45.0s / 53.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s

Stack Uptimes

  • commander_of_the_dead_window_1:9.30%
Dark Transformation 7.0 0.0 45.6sec 45.6sec 22.1sec 51.68% 58.11% 0.0 (0.0) 6.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 53.9s
  • trigger_min/max:45.0s / 53.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.0s

Stack Uptimes

  • dark_transformation_1:51.68%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.5sec 120.5sec 0.7sec 0.61% 0.00% 5.5 (5.5) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.69
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 125.0s
  • trigger_min/max:120.0s / 125.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.7s

Stack Uptimes

  • dragon_games_equipment_1:0.61%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.3sec 306.3sec 27.3sec 13.03% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 327.0s
  • trigger_min/max:300.0s / 327.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.03%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 166.1sec 166.1sec 19.3sec 15.47% 0.00% 7.0 (7.0) 2.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 231.8s
  • trigger_min/max:120.0s / 231.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.47%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Festermight 13.3 70.8 23.1sec 3.5sec 19.3sec 85.26% 0.00% 0.0 (0.0) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 45.4s
  • trigger_min/max:0.8s / 26.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:8.79%
  • festermight_2:9.46%
  • festermight_3:10.44%
  • festermight_4:15.55%
  • festermight_5:9.95%
  • festermight_6:8.27%
  • festermight_7:6.88%
  • festermight_8:5.70%
  • festermight_9:4.10%
  • festermight_10:2.89%
  • festermight_11:1.73%
  • festermight_12:0.96%
  • festermight_13:0.41%
  • festermight_14:0.11%
  • festermight_15:0.01%
  • festermight_16:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 8.2 87.6 38.7sec 3.1sec 34.3sec 93.14% 75.47% 72.8 (72.8) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 238.6s
  • trigger_min/max:0.8s / 18.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 235.3s

Stack Uptimes

  • icy_talons_1:6.57%
  • icy_talons_2:7.03%
  • icy_talons_3:79.53%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 11.9 8.1 25.1sec 14.6sec 10.7sec 42.16% 0.00% 8.1 (8.1) 11.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 167.7s
  • trigger_min/max:0.8s / 162.0s
  • trigger_pct:15.00%
  • duration_min/max:0.0s / 62.9s

Stack Uptimes

  • rune_mastery_1:42.16%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 40.8 5.2 7.2sec 6.4sec 2.6sec 35.15% 0.00% 5.2 (5.2) 40.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 79.1s
  • trigger_min/max:0.8s / 79.1s
  • trigger_pct:47.98%
  • duration_min/max:0.0s / 20.4s

Stack Uptimes

  • runic_corruption_1:35.15%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 20.3 0.2 14.4sec 14.2sec 1.1sec 7.14% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.4s / 56.8s
  • trigger_min/max:1.4s / 56.8s
  • trigger_pct:14.31%
  • duration_min/max:0.0s / 11.8s

Stack Uptimes

  • sudden_doom_1:7.14%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.7 0.0 90.7sec 90.7sec 19.5sec 23.86% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 94.4s
  • trigger_min/max:90.0s / 94.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • unholy_assault_1:23.86%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Pact 7.0 0.0 45.6sec 45.6sec 14.7sec 34.33% 37.69% 96.1 (96.1) 6.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_pact
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:45.0s / 53.9s
  • trigger_min/max:45.0s / 53.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • unholy_pact_1:34.33%

Spelldata

  • id:319233
  • name:Unholy Pact
  • tooltip:
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 13.1 36.3sec 13.6sec 24.6sec 68.94% 0.00% 13.1 (13.1) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 184.9s
  • trigger_min/max:0.0s / 55.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 166.7s

Stack Uptimes

  • unholy_strength_1:68.94%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.6 0.0 47.7sec 47.7sec 14.7sec 99.92% 99.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 182.0s
  • trigger_min/max:45.0s / 182.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.92%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.7 0.0 47.0sec 47.0sec 14.7sec 99.93% 99.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 227.8s
  • trigger_min/max:45.0s / 227.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.93%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.7 0.0 46.9sec 46.9sec 14.7sec 99.93% 99.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 182.8s
  • trigger_min/max:45.0s / 182.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.93%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.7 0.0 47.6sec 47.6sec 14.7sec 99.93% 99.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 186.7s
  • trigger_min/max:45.0s / 186.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:99.93%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.6sec 186.6sec 28.6sec 92.53% 97.37% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 231.9s
  • trigger_min/max:180.8s / 231.9s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.53%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.4sec 186.4sec 28.5sec 92.46% 97.64% 0.0 (0.0) 0.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 231.9s
  • trigger_min/max:180.0s / 231.9s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.46%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.5sec 186.5sec 28.5sec 92.63% 97.59% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 231.4s
  • trigger_min/max:180.5s / 231.4s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.63%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.5sec 186.5sec 28.6sec 92.15% 97.03% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 231.4s
  • trigger_min/max:180.8s / 231.4s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.15%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.6sec 186.6sec 28.6sec 92.49% 97.40% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 232.4s
  • trigger_min/max:180.8s / 232.4s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.49%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.7sec 186.7sec 28.5sec 91.56% 96.72% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.8s / 232.9s
  • trigger_min/max:180.8s / 232.9s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.56%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.7sec 186.7sec 28.5sec 91.56% 96.93% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.5s / 233.4s
  • trigger_min/max:180.5s / 233.4s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.56%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.8sec 186.8sec 28.4sec 91.27% 96.95% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 233.9s
  • trigger_min/max:180.0s / 233.9s
  • trigger_pct:100.00%
  • duration_min/max:7.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.27%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Commander of the Dead 2.0 0.0 185.8sec 185.8sec 25.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:182.2s / 235.9s
  • trigger_min/max:182.2s / 235.9s
  • trigger_pct:100.00%
  • duration_min/max:8.1s / 25.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 187.2sec 187.2sec 23.2sec 92.98% 99.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.2s / 237.5s
  • trigger_min/max:181.2s / 237.5s
  • trigger_pct:100.00%
  • duration_min/max:8.1s / 25.0s

Stack Uptimes

  • dark_empowerment_1:92.98%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.4 0.0 67.0sec 67.0sec 17.3sec 97.31% 97.66% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:42.4s / 229.8s
  • trigger_min/max:42.4s / 229.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.31%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.6 0.0 64.6sec 64.6sec 17.4sec 97.13% 97.51% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:42.4s / 232.0s
  • trigger_min/max:42.4s / 232.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:97.13%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 24.6 8.0 46.0 11.9s 1.4s 145.0s
delayed_aa_cast 2.0 2.0 2.0 182.5s 181.0s 232.0s
Rune ready 155.3 114.0 199.0 2.0s 0.0s 11.5s
Runic Corruption from Runic Power Spent 45.9 22.0 68.0 6.4s 0.8s 79.1s
Festering Wound from Festering Strike 65.5 40.0 96.0 11.5s 1.0s 73.0s
Festering Wound from Infected Claws 31.7 14.0 57.0 9.3s 1.0s 110.3s
Festering Wound from Unholy Assault 14.7 12.0 16.0 90.7s 90.0s 94.4s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 4.11% 0.00% 15.36% 2.3s 0.0s 24.5s
ghoul - Energy Cap 0.40% 0.16% 1.37% 0.2s 0.0s 1.0s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=300886)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0942.073 / 1.1548.08628.394
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
42.02662.58683.172 / 82.618105.736143.799

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Army of the Dead5.7540.00141.8195.5020.00041.819
Apocalypse0.5080.0018.6872.9710.19410.944
Dark Transformation0.6230.0018.8923.6690.90911.832
Empower Rune Weapon46.6810.002111.77365.40357.449111.773
Summon Gargoyle5.7512.23755.8545.7512.23755.854
Unholy Assault0.7920.0014.3861.9340.0006.972
Soul Reaper0.9250.00112.59812.6355.18125.134

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
ApocalypseRune13.9613.928.96%1.000.030.25%
Empower Rune WeaponRunic Power11.5953.922.32%4.654.016.92%
Empower Rune WeaponRune11.5910.977.06%0.950.615.30%
Festering WoundRunic Power103.91299.0912.89%2.8812.634.05%
Rune RegenerationRune130.44130.4483.97%1.000.000.00%
Runic AttenuationRunic Power73.64352.5615.19%4.7915.634.24%
Army of the DeadRunic Power2.0019.750.85%9.870.251.27%
Festering StrikeRunic Power26.20503.6121.70%19.2220.423.90%
OutbreakRunic Power11.87114.424.93%9.644.263.59%
Scourge StrikeRunic Power77.11749.8632.31%9.7321.202.75%
Soul ReaperRunic Power15.68145.196.26%9.2611.627.41%
Summon GargoyleRunic Power2.0082.583.56%41.2917.4217.42%
pet - ghoul
Dark TransformationEnergy7.00361.918.68%51.70338.0948.30%
energy_regenEnergy1333.963809.5091.32%2.8654.651.41%
pet - army_ghoul
energy_regenEnergy893.147000.72100.00%7.841078.4613.35%
pet - apoc_ghoul
energy_regenEnergy466.883790.21100.00%8.121693.7330.89%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.001.000.00
Death CoilRunic Power 95.752264.4323.6523.65719.00
Festering StrikeRune 26.2052.402.002.006702.65
OutbreakRune 11.8711.871.001.002115.26
Scourge StrikeRune 77.1177.111.001.008738.25
Soul ReaperRune 15.6815.681.001.0049312.79
pet - ghoul
ClawEnergy 37.921516.8240.0040.0061.92
Sweeping ClawsEnergy 68.002720.1940.0040.00151.21
pet - army_ghoul
ClawEnergy 212.098483.6540.0040.0031.63
pet - apoc_ghoul
ClawEnergy 153.076122.8040.0040.0028.36
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 7.74 7.55 107.4 56.5 0.0 100.0
Rune 6.0 0.52 0.53 0.0 2.3 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 43863.64
Minimum 38176.11
Maximum 50343.00
Spread ( max - min ) 12166.89
Range [ ( max - min ) / 2 * 100% ] 13.87%
Standard Deviation 1937.8460
5th Percentile 41016.44
95th Percentile 47442.86
( 95th Percentile - 5th Percentile ) 6426.42
Mean Distribution
Standard Deviation 22.3778
95.00% Confidence Interval ( 43819.78 - 43907.50 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7498
0.1 Scale Factor Error with Delta=300 32057
0.05 Scale Factor Error with Delta=300 128228
0.01 Scale Factor Error with Delta=300 3205696
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 43863.64
Minimum 38176.11
Maximum 50343.00
Spread ( max - min ) 12166.89
Range [ ( max - min ) / 2 * 100% ] 13.87%
Standard Deviation 1937.8460
5th Percentile 41016.44
95th Percentile 47442.86
( 95th Percentile - 5th Percentile ) 6426.42
Mean Distribution
Standard Deviation 22.3778
95.00% Confidence Interval ( 43819.78 - 43907.50 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7498
0.1 Scale Factor Error with Delta=300 32057
0.05 Scale Factor Error with Delta=300 128228
0.01 Scale Factor Error with Delta=300 3205696
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 43863.64
Minimum 38176.11
Maximum 50343.00
Spread ( max - min ) 12166.89
Range [ ( max - min ) / 2 * 100% ] 13.87%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 5934117.93
Minimum 4501158.35
Maximum 7402535.58
Spread ( max - min ) 2901377.23
Range [ ( max - min ) / 2 * 100% ] 24.45%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 fleshcraft
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%45=0)
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%45=0)
8 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
9 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
A 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
B 0.00 variable,name=opener_done,op=setif,value=1,value_else=0,condition=active_enemies>=3
Default action list Executed every time the actor is available.
# count action,conditions
C 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
0.00 variable,name=apoc_timing,op=setif,value=8,value_else=4,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<4
Variables
0.00 variable,name=garg_pooling,op=setif,value=(((cooldown.summon_gargoyle.remains+1)%gcd)%((rune+1)*(runic_power+20)))*100,value_else=gcd,condition=cooldown.summon_gargoyle.remains<gcd*2
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(2-talent.infected_claws),condition=talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
0.00 variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4|fight_remains<debuff.festering_wound.stack*gcd)
0.00 variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=pooling_runes,value=talent.soul_reaper&rune<2&target.time_to_pct_35<5&fight_remains>5
0.00 variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion.
D 2.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
Prioritize Army, Outbreak and Maintaining Plaguebringer
E 11.87 outbreak,target_if=(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
0.00 wound_spender,if=cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
F 0.00 call_action_list,name=opener,if=variable.opener_done=0
Call Action Lists
G 0.00 call_action_list,name=cooldowns
H 0.00 call_action_list,name=trinkets
I 0.00 call_action_list,name=racials
J 0.00 run_action_list,name=aoe,if=active_enemies>=4
K 0.00 run_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
L 0.46 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Potion
0.00 vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
M 5.83 dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
N 0.18 dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
O 5.98 apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&cooldown.dark_transformation.remains
P 2.42 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
Q 1.00 summon_gargoyle,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
0.00 unholy_blight,if=variable.adds_remain|fight_remains<21
0.00 abomination_limb,if=variable.st_planning&rune<3
R 3.66 unholy_assault,if=variable.st_planning
S 15.68 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
0.00 sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd
actions.generic
# count action,conditions
T 93.61 death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
Generic
0.00 any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
U 77.11 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
V 24.37 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.opener
# count action,conditions
W 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up
Opener
X 1.00 potion,if=pet.gargoyle.active|!talent.summon_gargoyle&pet.army_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up
Y 2.14 death_coil,if=pet.gargoyle.active&!prev_gcd.1.death_coil
Z 1.00 apocalypse,if=buff.commander_of_the_dead_window.up
a 1.00 dark_transformation,if=debuff.festering_wound.stack>=4
b 1.84 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 variable,name=opener_done,op=setif,value=1,value_else=0,condition=cooldown.apocalypse.remains|!talent.apocalypse&(cooldown.dark_transformation.remains|cooldown.summon_gargoyle.remains)
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.blood_fury.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
c 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&15>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.fireblood.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
d 2.00 use_item,slot=trinket1,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets
0.00 use_item,slot=trinket2,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
e 2.74 use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

Sample Sequence

01246789ABCDEbaWXYZYPRdcTTTTUUTUUTUUTTTETVTUTUTTUUUeUVTTUUTUVTTTVUTVTMOEUTUTVUTUUTTVTUUTEUTUUTVUTVTMORUUTEUTUUTUVTTUTUTUUTVTUUTUETVTUMOVTTUUTeUVTUETUTUTTUVTUTUUTVTVUTDEMOQPRTdScTTTTUTSUTUTUTSTUTUUESTUVTSTUTUSVTSMOTUESTVTTSTUUTSUVTTSTUUVETSTTeVTSTMORSTUUUTSTUUETSUTTUT

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 6 trinket_1_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 7 trinket_2_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 8 trinket_1_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 9 trinket_2_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat A trinket_priority Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat B opener_done Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default C auto_attack Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default D army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
bloodlust, static_empowerment
0:01.019 default E outbreak Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune
bloodlust, static_empowerment(2)
0:02.040 opener b festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
bloodlust, static_empowerment(3)
0:03.060 opener a dark_transformation Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
bloodlust, static_empowerment(4)
0:03.060 opener W summon_gargoyle Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
bloodlust, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(4)
0:04.080 opener X potion Fluffy_Pillow 90.0/100: 90% runic_power
2.0/6: 33% rune
bloodlust, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:04.080 opener Y death_coil Fluffy_Pillow 90.0/100: 90% runic_power
2.0/6: 33% rune
bloodlust, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.101 opener Z apocalypse Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune
bloodlust, icy_talons, dark_transformation, sudden_doom, unholy_pact, commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.122 opener Y death_coil Fluffy_Pillow 77.0/100: 77% runic_power
4.0/6: 67% rune
bloodlust, icy_talons, dark_transformation, sudden_doom, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.142 cooldowns P empower_rune_weapon Fluffy_Pillow 82.0/100: 82% runic_power
4.0/6: 67% rune
bloodlust, icy_talons(2), dark_transformation, unholy_pact, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:07.142 cooldowns R unholy_assault Fluffy_Pillow 87.0/100: 87% runic_power
5.0/6: 83% rune
bloodlust, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_pact, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:08.029 trinkets d use_item_algethar_puzzle_box Fluffy_Pillow 87.0/100: 87% runic_power
5.0/6: 83% rune
bloodlust, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:09.011 racials c berserking Fluffy_Pillow 87.0/100: 87% runic_power
6.0/6: 100% rune
bloodlust, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.011 generic T death_coil Fluffy_Pillow 87.0/100: 87% runic_power
6.0/6: 100% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.764 generic T death_coil Fluffy_Pillow 62.0/100: 62% runic_power
6.0/6: 100% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.518 generic T death_coil Fluffy_Pillow 62.0/100: 62% runic_power
6.0/6: 100% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.272 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
6.0/6: 100% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.027 generic U scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
6.0/6: 100% rune
bloodlust, berserking, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.781 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.535 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.289 generic U scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.045 generic U scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.798 generic T death_coil Fluffy_Pillow 34.0/100: 34% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.553 generic U scourge_strike Fluffy_Pillow 9.0/100: 9% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.307 generic U scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.063 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.816 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.572 generic T death_coil Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.326 default E outbreak Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.083 generic T death_coil Fluffy_Pillow 35.0/100: 35% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.837 generic V festering_strike Fluffy_Pillow 5.0/100: 5% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.592 generic T death_coil Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.347 generic U scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.100 generic T death_coil Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.855 generic U scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.609 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.365 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.121 generic U scourge_strike Fluffy_Pillow 1.0/100: 1% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.876 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.898 generic U scourge_strike Fluffy_Pillow 37.0/100: 37% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.917 trinkets e use_item_dragon_games_equipment Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:29.917 generic U scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(3), dragon_games_equipment, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.937 generic V festering_strike Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:31.958 generic T death_coil Fluffy_Pillow 83.0/100: 83% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:32.979 generic T death_coil Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:33.999 generic U scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:35.021 generic U scourge_strike Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(5), static_empowerment(5)
0:36.042 generic T death_coil Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(6), static_empowerment(5)
0:37.062 generic U scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(6), static_empowerment(5)
0:38.083 generic V festering_strike Fluffy_Pillow 37.0/100: 37% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
0:39.104 generic T death_coil Fluffy_Pillow 62.0/100: 62% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
0:40.124 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
0:41.450 generic T death_coil Fluffy_Pillow 2.0/100: 2% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(7), static_empowerment(5)
0:42.774 generic V festering_strike Fluffy_Pillow 2.0/100: 2% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
0:44.101 generic U scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
0:45.426 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(8), static_empowerment(5)
0:46.751 generic V festering_strike Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(8), static_empowerment(5)
0:48.076 generic T death_coil Fluffy_Pillow 30.0/100: 30% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), static_empowerment(5)
0:49.401 cooldowns M dark_transformation Fluffy_Pillow 5.0/100: 5% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), static_empowerment(5)
0:50.728 cooldowns O apocalypse Fluffy_Pillow 5.0/100: 5% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:52.054 default E outbreak Fluffy_Pillow 22.0/100: 22% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
0:53.380 generic U scourge_strike Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
0:54.706 generic T death_coil Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune
rune_mastery, dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
0:56.031 generic U scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons, dark_transformation, runic_corruption, unholy_pact, festermight(5), static_empowerment(5)
0:57.356 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
0:58.682 generic V festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
1:00.008 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
1:01.333 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
1:02.658 generic U scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
1:03.984 generic U scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), static_empowerment(5)
1:05.310 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
1:06.636 generic T death_coil Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(9), static_empowerment(5)
1:07.962 generic V festering_strike Fluffy_Pillow 12.0/100: 12% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(9), static_empowerment(5)
1:09.287 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
1:10.613 generic U scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(9), static_empowerment(5)
1:11.938 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
1:13.263 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, static_empowerment(5)
1:14.587 default E outbreak Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, static_empowerment(5)
1:15.911 generic U scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, static_empowerment(5)
1:17.237 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
1:18.562 Waiting     0.321 sec 1.0/100: 1% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
1:18.883 generic U scourge_strike Fluffy_Pillow 1.0/100: 1% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
1:20.209 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(3), static_empowerment(5)
1:21.534 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), festermight(4), static_empowerment(5)
1:22.859 Waiting     2.197 sec 2.0/100: 2% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(4), static_empowerment(5)
1:25.056 generic V festering_strike Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(4), static_empowerment(5)
1:26.381 generic U scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(4), static_empowerment(5)
1:27.707 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
0.0/6: 0% rune
festermight(5), static_empowerment(5)
1:29.032 Waiting     2.211 sec 15.0/100: 15% runic_power
1.0/6: 17% rune
icy_talons, runic_corruption, festermight(5), static_empowerment(5)
1:31.243 generic V festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
icy_talons, festermight(5), static_empowerment(5)
1:32.570 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons, static_empowerment(5)
1:33.896 Waiting     0.588 sec 10.0/100: 10% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(2), static_empowerment(5)
1:34.484 cooldowns M dark_transformation Fluffy_Pillow 10.0/100: 10% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(2), static_empowerment(5)
1:35.810 cooldowns O apocalypse Fluffy_Pillow 15.0/100: 15% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
1:37.134 cooldowns R unholy_assault Fluffy_Pillow 27.0/100: 27% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
1:38.468 generic U scourge_strike Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
1:39.572 generic U scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(5), static_empowerment(5)
1:40.677 generic T death_coil Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
1:41.783 default E outbreak Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
1:42.886 generic U scourge_strike Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
1:43.992 generic T death_coil Fluffy_Pillow 86.0/100: 86% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
1:45.097 generic U scourge_strike Fluffy_Pillow 86.0/100: 86% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
1:46.203 generic U scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(8), static_empowerment(5)
1:47.309 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(9), static_empowerment(5)
1:48.416 generic U scourge_strike Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(9), static_empowerment(5)
1:49.522 generic V festering_strike Fluffy_Pillow 83.0/100: 83% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(10), static_empowerment(5)
1:50.627 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(10), static_empowerment(5)
1:51.733 generic T death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(10), static_empowerment(5)
1:52.839 generic U scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(10), static_empowerment(5)
1:53.943 generic T death_coil Fluffy_Pillow 58.0/100: 58% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(11), static_empowerment(5)
1:55.050 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(11), static_empowerment(5)
1:56.156 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
icy_talons(3), unholy_assault, static_empowerment(5)
1:57.261 generic U scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power
3.0/6: 50% rune
icy_talons(3), runic_corruption, static_empowerment(5)
1:58.587 generic U scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
3.0/6: 50% rune
icy_talons(3), festermight, static_empowerment(5)
1:59.913 generic T death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), static_empowerment(5)
2:01.239 generic V festering_strike Fluffy_Pillow 12.0/100: 12% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(2), static_empowerment(5)
2:02.563 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(2), static_empowerment(5)
2:03.888 generic U scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
2:05.213 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(3), static_empowerment(5)
2:06.541 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(4), static_empowerment(5)
2:07.867 generic U scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(4), static_empowerment(5)
2:09.193 default E outbreak Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
2:10.519 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
2:11.844 generic V festering_strike Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
2:13.171 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
2:14.497 Waiting     0.199 sec 6.0/100: 6% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
2:14.696 generic U scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
2:16.021 Waiting     3.501 sec 24.0/100: 24% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(6), static_empowerment(5)
2:19.522 cooldowns M dark_transformation Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
unholy_strength, static_empowerment(5)
2:20.850 cooldowns O apocalypse Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune
unholy_strength, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
2:22.175 generic V festering_strike Fluffy_Pillow 41.0/100: 41% runic_power
4.0/6: 67% rune
unholy_strength, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
2:23.500 generic T death_coil Fluffy_Pillow 61.0/100: 61% runic_power
2.0/6: 33% rune
unholy_strength, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
2:24.827 generic T death_coil Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(4), static_empowerment(5)
2:26.152 generic U scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), dark_transformation, runic_corruption, unholy_pact, festermight(4), static_empowerment(5)
2:27.477 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
2:28.804 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, sudden_doom, unholy_pact, festermight(6), static_empowerment(5)
2:30.129 trinkets e use_item_dragon_games_equipment Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(6), static_empowerment(5)
2:30.129 generic U scourge_strike Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(6), dragon_games_equipment, static_empowerment(5)
2:31.456 generic V festering_strike Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
2:32.782 generic T death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
2:34.107 generic U scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), static_empowerment(5)
2:35.433 default E outbreak Fluffy_Pillow 53.0/100: 53% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(8), static_empowerment(5)
2:36.758 generic T death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(8), static_empowerment(5)
2:38.082 generic U scourge_strike Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(8), static_empowerment(5)
2:39.411 generic T death_coil Fluffy_Pillow 86.0/100: 86% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
2:40.736 generic U scourge_strike Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(9), static_empowerment(5)
2:42.062 generic T death_coil Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), static_empowerment(5)
2:43.389 generic T death_coil Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), static_empowerment(5)
2:44.714 generic U scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
2:46.041 generic V festering_strike Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
2:47.367 generic T death_coil Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
2:48.693 generic U scourge_strike Fluffy_Pillow 22.0/100: 22% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
2:50.018 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
2:51.344 generic U scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
2:52.670 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
2:53.998 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:55.323 generic V festering_strike Fluffy_Pillow 11.0/100: 11% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:56.649 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(4), static_empowerment(5)
2:57.974 generic V festering_strike Fluffy_Pillow 1.0/100: 1% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(4), static_empowerment(5)
2:59.300 generic U scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(4), static_empowerment(5)
3:00.626 generic T death_coil Fluffy_Pillow 39.0/100: 39% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
3:01.952 default D army_of_the_dead Fluffy_Pillow 9.0/100: 9% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(5), static_empowerment(5)
3:03.277 default E outbreak Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:04.602 cooldowns M dark_transformation Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:05.927 cooldowns O apocalypse Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:07.251 cooldowns Q summon_gargoyle Fluffy_Pillow 46.0/100: 46% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:07.251 cooldowns P empower_rune_weapon Fluffy_Pillow 96.0/100: 96% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:07.251 cooldowns R unholy_assault Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, empower_rune_weapon, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:08.404 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, empower_rune_weapon, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:09.366 trinkets d use_item_algethar_puzzle_box Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), static_empowerment(5)
3:10.643 cooldowns S soul_reaper Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune
unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:11.605 racials c berserking Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:11.605 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:12.480 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(2), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:13.353 generic T death_coil Fluffy_Pillow 75.0/100: 75% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:14.225 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:15.100 generic U scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:15.973 generic T death_coil Fluffy_Pillow 33.0/100: 33% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5)
3:16.847 cooldowns S soul_reaper Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5)
3:17.720 generic U scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune
berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5)
3:18.595 generic T death_coil Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune
berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5)
3:19.470 generic U scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune
berserking, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5)
3:20.343 generic T death_coil Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
berserking, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), algethar_puzzle, static_empowerment(5)
3:21.218 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
5.0/6: 83% rune
berserking, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), algethar_puzzle, static_empowerment(5)
3:22.094 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune
berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), algethar_puzzle, static_empowerment(5)
3:22.969 cooldowns S soul_reaper Fluffy_Pillow 12.0/100: 12% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_assault, festermight(8), algethar_puzzle, static_empowerment(5)
3:23.845 generic T death_coil Fluffy_Pillow 22.0/100: 22% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(8), algethar_puzzle, static_empowerment(5)
3:24.807 generic U scourge_strike Fluffy_Pillow 22.0/100: 22% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(8), algethar_puzzle, static_empowerment(5)
3:25.767 generic T death_coil Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), algethar_puzzle, static_empowerment(5)
3:26.729 generic U scourge_strike Fluffy_Pillow 5.0/100: 5% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, algethar_puzzle, static_empowerment(5)
3:27.690 generic U scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons(3), dark_transformation, festermight, algethar_puzzle, static_empowerment(5)
3:29.014 default E outbreak Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(2), algethar_puzzle, static_empowerment(5)
3:30.338 cooldowns S soul_reaper Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(2), algethar_puzzle, static_empowerment(5)
3:31.663 generic T death_coil Fluffy_Pillow 61.0/100: 61% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
3:32.990 generic U scourge_strike Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
3:34.315 generic V festering_strike Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
3:35.640 generic T death_coil Fluffy_Pillow 64.0/100: 64% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
3:36.965 cooldowns S soul_reaper Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
3:38.289 generic T death_coil Fluffy_Pillow 44.0/100: 44% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(3), static_empowerment(5)
3:39.614 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
icy_talons(3), runic_corruption, festermight(3), static_empowerment(5)
3:40.939 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(4), static_empowerment(5)
3:42.262 generic U scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), festermight(4), static_empowerment(5)
3:43.587 cooldowns S soul_reaper Fluffy_Pillow 15.0/100: 15% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
3:44.913 generic V festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
3:46.241 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
3:47.566 Waiting     1.844 sec 20.0/100: 20% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), static_empowerment(5)
3:49.410 cooldowns S soul_reaper Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune
icy_talons(3), static_empowerment(5)
3:50.912 cooldowns M dark_transformation Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), sudden_doom, static_empowerment(5)
3:52.237 cooldowns O apocalypse Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:53.564 generic T death_coil Fluffy_Pillow 47.0/100: 47% runic_power
4.0/6: 67% rune
rune_mastery, dark_transformation, sudden_doom, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:54.889 generic U scourge_strike Fluffy_Pillow 47.0/100: 47% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:56.216 default E outbreak Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
3:57.540 cooldowns S soul_reaper Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
3:58.864 generic T death_coil Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
4:00.187 generic V festering_strike Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
4:01.511 generic T death_coil Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
4:02.837 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(5), static_empowerment(5)
4:04.164 cooldowns S soul_reaper Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_pact, festermight(5), static_empowerment(5)
4:05.490 generic T death_coil Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, sudden_doom, unholy_pact, festermight(5), static_empowerment(5)
4:06.815 generic U scourge_strike Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(5), static_empowerment(5)
4:08.141 generic U scourge_strike Fluffy_Pillow 48.0/100: 48% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(6), static_empowerment(5)
4:09.465 generic T death_coil Fluffy_Pillow 61.0/100: 61% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(7), static_empowerment(5)
4:10.792 cooldowns S soul_reaper Fluffy_Pillow 31.0/100: 31% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(7), static_empowerment(5)
4:12.118 generic U scourge_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
4:13.445 generic V festering_strike Fluffy_Pillow 54.0/100: 54% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
4:14.771 generic T death_coil Fluffy_Pillow 74.0/100: 74% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
4:16.097 generic T death_coil Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
4:17.421 cooldowns S soul_reaper Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, sudden_doom, static_empowerment(5)
4:18.748 generic T death_coil Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), sudden_doom, static_empowerment(5)
4:20.074 generic U scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
4:21.400 generic U scourge_strike Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
4:22.724 generic V festering_strike Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
4:24.051 default E outbreak Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
4:25.375 generic T death_coil Fluffy_Pillow 90.0/100: 90% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, festermight(2), static_empowerment(5)
4:26.700 cooldowns S soul_reaper Fluffy_Pillow 65.0/100: 65% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons, runic_corruption, festermight(2), static_empowerment(5)
4:28.024 generic T death_coil Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons, festermight(2), static_empowerment(5)
4:29.349 generic T death_coil Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(2), runic_corruption, festermight(2), static_empowerment(5)
4:30.674 trinkets e use_item_dragon_games_equipment Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
4:30.674 generic V festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2), dragon_games_equipment, static_empowerment(5)
4:31.999 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(2), static_empowerment(5)
4:33.325 cooldowns S soul_reaper Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
4:34.652 generic T death_coil Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
4:35.977 cooldowns M dark_transformation Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
4:37.302 cooldowns O apocalypse Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(2), commander_of_the_dead_window, static_empowerment(5)
4:38.627 cooldowns R unholy_assault Fluffy_Pillow 37.0/100: 37% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), commander_of_the_dead_window, static_empowerment(5)
4:39.954 cooldowns S soul_reaper Fluffy_Pillow 42.0/100: 42% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(6), commander_of_the_dead_window, static_empowerment(5)
4:41.061 generic T death_coil Fluffy_Pillow 52.0/100: 52% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, dark_transformation, sudden_doom, unholy_assault, unholy_pact, static_empowerment(5)
4:42.167 generic U scourge_strike Fluffy_Pillow 52.0/100: 52% runic_power
5.0/6: 83% rune
unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, static_empowerment(5)
4:43.276 generic U scourge_strike Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight, static_empowerment(5)
4:44.380 generic U scourge_strike Fluffy_Pillow 78.0/100: 78% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(2), static_empowerment(5)
4:45.484 generic T death_coil Fluffy_Pillow 91.0/100: 91% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(3), static_empowerment(5)
4:46.590 cooldowns S soul_reaper Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(3), static_empowerment(5)
4:47.696 generic T death_coil Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(2), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(3), static_empowerment(5)
4:48.802 generic U scourge_strike Fluffy_Pillow 81.0/100: 81% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(3), static_empowerment(5)
4:49.908 generic U scourge_strike Fluffy_Pillow 94.0/100: 94% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), static_empowerment(5)
4:51.015 default E outbreak Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), static_empowerment(5)
4:52.122 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), static_empowerment(5)
4:53.227 cooldowns S soul_reaper Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(5), static_empowerment(5)
4:54.333 generic U scourge_strike Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), static_empowerment(5)
4:55.439 generic T death_coil Fluffy_Pillow 93.0/100: 93% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, unholy_assault, festermight(6), static_empowerment(5)
4:56.546 generic T death_coil Fluffy_Pillow 93.0/100: 93% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(6), static_empowerment(5)
4:57.650 generic U scourge_strike Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(6), static_empowerment(5)
4:58.755 generic T death_coil Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6227 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3463 0 12965 12348 6827
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 259300 246960 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 15.36% 15.36% 1504
Haste 13.49% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6538 5922 0
Mastery 44.26% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +687 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi (fierce_armor_kit_2) }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech (devotion_of_leech_2) }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech (regenerative_leech_2) }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +687 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/fleshcraft
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=opener_done,op=setif,value=1,value_else=0,condition=active_enemies>=3

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
# Variables
actions+=/variable,name=apoc_timing,op=setif,value=8,value_else=4,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<4
actions+=/variable,name=garg_pooling,op=setif,value=(((cooldown.summon_gargoyle.remains+1)%gcd)%((rune+1)*(runic_power+20)))*100,value_else=gcd,condition=cooldown.summon_gargoyle.remains<gcd*2
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(2-talent.infected_claws),condition=talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
actions+=/variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4|fight_remains<debuff.festering_wound.stack*gcd)
actions+=/variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=pooling_runes,value=talent.soul_reaper&rune<2&target.time_to_pct_35<5&fight_remains>5
actions+=/variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
# Prioritize Army, Outbreak and Maintaining Plaguebringer
actions+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
actions+=/outbreak,target_if=(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
actions+=/wound_spender,if=cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
# Call Action Lists
actions+=/call_action_list,name=opener,if=variable.opener_done=0
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=aoe,if=active_enemies>=4
actions+=/run_action_list,name=generic,if=active_enemies<=3

# AoE Action List
actions.aoe=any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(talent.festermight&buff.festermight.remains<3|!talent.festermight)&(death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets=8|!talent.bursting_sores&!talent.vile_contagion|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5|(cooldown.vile_contagion.remains|!talent.vile_contagion)&buff.dark_transformation.up&talent.infected_claws&(buff.empower_rune_weapon.up|buff.unholy_assault.up))|fight_remains<10
actions.aoe+=/abomination_limb,if=rune=0&variable.adds_remain
actions.aoe+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!death_and_decay.ticking&debuff.festering_wound.stack<4&(cooldown.vile_contagion.remains<5|cooldown.apocalypse.ready&cooldown.any_dnd.remains)
actions.aoe+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!death_and_decay.ticking&(cooldown.vile_contagion.remains>5|!talent.vile_contagion)
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=death_and_decay.ticking
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe+=/epidemic,if=!variable.pooling_runic_power
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=cooldown.death_and_decay.remains>10

# Potion
actions.cooldowns=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
# Cooldowns
actions.cooldowns+=/vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
actions.cooldowns+=/dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&cooldown.dark_transformation.remains
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
actions.cooldowns+=/summon_gargoyle,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
actions.cooldowns+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
actions.cooldowns+=/unholy_blight,if=variable.adds_remain|fight_remains<21
actions.cooldowns+=/abomination_limb,if=variable.st_planning&rune<3
actions.cooldowns+=/unholy_assault,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.cooldowns+=/sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# Generic
actions.generic=death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
actions.generic+=/any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Opener
actions.opener=summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up
actions.opener+=/potion,if=pet.gargoyle.active|!talent.summon_gargoyle&pet.army_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_dead&buff.dark_transformation.up
actions.opener+=/death_coil,if=pet.gargoyle.active&!prev_gcd.1.death_coil
actions.opener+=/apocalypse,if=buff.commander_of_the_dead_window.up
actions.opener+=/dark_transformation,if=debuff.festering_wound.stack>=4
actions.opener+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.opener+=/variable,name=opener_done,op=setif,value=1,value_else=0,condition=cooldown.apocalypse.remains|!talent.apocalypse&(cooldown.dark_transformation.remains|cooldown.summon_gargoyle.remains)

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.blood_fury.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&15>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.fireblood.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,slot=trinket1,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant=regenerative_leech_2
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant=waking_stats_2
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant=devotion_of_leech_2
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant=fierce_armor_kit_2
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant=devotion_of_mastery_2
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant=devotion_of_haste_2
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=6827
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 41515 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41514.7 41514.7 32.7 / 0.079% 5642.7 / 13.6% 148.0
APS APS Error APS Range APR
513.6 2.0 / 0.398% 251.1 / 48.9% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
223.4 222.1 Mana 0.00% 45.3 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIk04ABAAAAAAAAAAAAQikkSESRLJRSJhEBpRSSiECSQIFpFSCA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 41515
Devouring Plague 9216 22.2% 50.7 5.91sec 54527 49197 Direct 50.7 19174 40998 23343 19.1%
Periodic 128.6 10363 21158 12295 17.9% 85.3%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.69 50.69 128.56 128.56 29.72 1.1083 1.9906 2763886.38 2763886.38 0.00% 8855.80 49196.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.90% 41.00 23 60 19173.89 13245 30235 19163.42 17712 21167 786222 786222 0.00%
crit 19.10% 9.68 0 26 40997.53 30759 60469 41006.47 0 57918 397024 397024 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.11% 105.56 73 142 10363.26 65 32777 10361.32 8729 12117 1093928 1093928 0.00%
crit 17.89% 23.00 6 42 21157.75 143 62433 21165.22 13207 29070 486713 486713 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.701215
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.75

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.582811
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 70.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [N]:50.69
  • if_expr:(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
Halo 0 (437) 0.0% (1.1%) 4.9 62.60sec 26544 24396

Stats Details: Halo

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.93 0.00 0.00 0.00 0.00 1.0881 0.0000 0.00 0.00 0.00% 24395.69 24395.69

Action Details: Halo

  • id:120644
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Shadow damage to enemies. Healing reduced beyond {$s1=6} targets.

Action Priority List

    main
    [V]:4.95
  • if_expr:raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
    Halo (_damage) 437 1.1% 4.9 62.60sec 26544 0 Direct 4.9 22066 47643 26692 18.1%

Stats Details: Halo Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.93 4.90 0.00 0.00 0.00 0.0000 0.0000 130834.07 130834.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.91% 4.02 0 7 22065.66 16818 35529 22095.71 0 32397 88598 88598 0.00%
crit 18.09% 0.89 0 5 47642.65 33636 71058 29596.32 0 71058 42237 42237 0.00%

Action Details: Halo Damage

  • id:390964
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.442000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390964
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Idol of C'Thun 0 (3205) 0.0% (7.7%) 0.0 0.00sec 0 0

Stats Details: Idol Of Cthun

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Idol Of Cthun

  • id:377349
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377349
  • name:Idol of C'Thun
  • school:physical
  • tooltip:
  • description:Mind Flay and Mind Sear have a chance to spawn a Void Tendril or Void Lasher that channels at your target for {$377355d=15 seconds}, generating {$s1=3} insanity every {$193473t1=1} sec.
    Mind Flay (void_tendril) 7284  / 3205 7.7% 22.0 12.73sec 43819 5850 Periodic 164.5 5009 10156 5850 16.3% 54.8%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.96 0.00 164.52 164.52 0.00 7.4906 1.0000 962440.32 962440.32 0.00% 5849.95 5849.95
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.67% 137.65 39 304 5009.49 4236 6701 5007.63 4709 5549 689584 689584 0.00%
crit 16.33% 26.87 4 77 10155.88 8705 13402 10144.58 9246 11762 272856 272856 0.00%

Action Details: Mind Flay

  • id:193473
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:1667.76
  • base_td_mult:1.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:{$?=}{$=}w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=30}%.

Action Priority List

    default
    [ ]:3.21
Mind Blast 4032 9.7% 62.9 4.77sec 19229 17398 Direct 62.9 15776 34577 19229 18.4%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.85 62.85 0.00 0.00 0.00 1.1052 0.0000 1208635.83 1208635.83 0.00% 17397.95 17397.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.63% 51.31 31 75 15775.98 10050 27600 15772.58 14067 17607 809489 809489 0.00%
crit 18.37% 11.54 1 24 34577.02 20100 55200 34608.29 24167 48496 399147 399147 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.{$?s137033=true}[ |cFFFFFFFFGenerates {$/100;s2=0} Insanity|r][]{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [M]:5.07
  • if_expr:(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
    main
    [Q]:56.74
  • if_expr:variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
    main
    [T]:1.23
  • if_expr:raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
Mind Flay 588 1.4% 6.8 38.69sec 25966 7714 Periodic 40.5 3750 7689 4350 15.3% 7.5%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.78 0.00 40.48 40.48 0.00 3.3663 0.5564 176109.32 176109.32 0.00% 7713.61 7713.61
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 84.75% 34.31 4 80 3749.51 3020 5614 3750.23 3286 5150 128627 128627 0.00%
crit 15.25% 6.18 0 22 7689.48 6040 11229 7588.23 0 11229 47482 47482 0.00%

Action Details: Mind Flay

  • id:15407
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:2.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.235400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.50
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=4.500 seconds} and slowing their movement speed by {$s2=50}%. |cFFFFFFFFGenerates {$=}{{$s4=6}*{$s3=200}/100} Insanity over the duration.|r

Action Priority List

    main
    [U]:40.53
  • if_expr:buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
    main
    [X]:6.78
  • interrupt_if_expr:ticks>=2
Mind Flay: Insanity 5537 13.3% 40.5 7.30sec 40988 18683 Periodic 161.4 8694 17771 10291 17.6% 29.6%

Stats Details: Mind Flay Insanity

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.53 0.00 161.42 161.42 0.00 2.1939 0.5509 1661235.02 1661235.02 0.00% 18682.57 18682.57
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.40% 133.01 78 194 8693.67 6644 12351 8691.47 8273 9241 1156339 1156339 0.00%
crit 17.60% 28.41 9 54 17770.62 13288 24703 17771.35 16249 20165 504896 504896 0.00%

Action Details: Mind Flay Insanity

  • id:391403
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.517880
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:391403
  • name:Mind Flay: Insanity
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=70}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r
Mind Spike 864 2.1% 10.3 24.93sec 25175 23055 Direct 10.3 21172 46047 25175 16.1%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.28 10.28 0.00 0.00 0.00 1.0920 0.0000 258812.43 258812.43 0.00% 23054.73 23054.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.90% 8.63 0 23 21172.00 15395 42280 21244.25 0 35592 182621 182621 0.00%
crit 16.10% 1.65 0 9 46047.17 30791 84559 36843.03 0 84559 76192 76192 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.440000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage.{$?s391090=false}[ Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times.][] |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity|r{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [W]:10.28
  • if_expr:buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
Mindgames 1385 3.3% 7.8 40.41sec 53542 48268 Direct 7.8 (7.8) 43526 95289 53542 19.3% (19.3%)

Stats Details: Mindgames

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.75 7.75 0.00 0.00 0.00 1.1094 0.0000 414961.92 414961.92 0.00% 48268.22 48268.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 6.25 1 10 43526.46 32802 69296 43459.25 34926 55221 272075 272075 0.00%
crit 19.35% 1.50 0 6 95288.81 65605 138592 78159.82 0 138592 142887 142887 0.00%

Action Details: Mindgames

  • id:375901
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:375901
  • name:Mindgames
  • school:shadow
  • tooltip:The next {$=}w2 damage and {$=}w5 healing dealt will be reversed.
  • description:Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target.

Action Priority List

    main
    [R]:7.78
  • if_expr:spell_targets.mind_sear<5&variable.all_dots_up
Shadow Crash 0 (1194) 0.0% (2.9%) 8.6 32.92sec 41559 36655

Stats Details: Shadow Crash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.63 0.00 0.00 0.00 0.00 1.1338 0.0000 0.00 0.00 0.00% 36654.66 36654.66

Action Details: Shadow Crash

  • id:205385
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:15.0

Spelldata

  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r

Action Priority List

    main
    [S]:8.63
  • if_expr:raid_event.adds.in>10
    Shadow Crash (_damage) 1194 2.9% 9.6 32.84sec 37424 0 Direct 9.6 30835 65803 37425 18.8%

Stats Details: Shadow Crash Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 9.58 0.00 0.00 0.00 0.0000 0.0000 358555.89 358555.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.16% 7.78 2 12 30835.18 20814 49353 30745.66 25134 37553 239774 239774 0.00%
crit 18.84% 1.81 0 7 65803.38 41627 98706 57047.72 0 98706 118782 118782 0.00%

Action Details: Shadow Crash Damage

  • id:205386
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.103750
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadow Weaving 659 1.6% 131.3 2.22sec 1502 0 Direct 130.3 1514 0 1514 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.26 130.26 0.00 0.00 0.00 0.0000 0.0000 197178.96 197178.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 130.26 94 160 1513.70 353 4883 1514.56 1217 2071 197179 197179 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1185.71
  • base_dd_max:1185.71
  • base_dd_mult:1.00

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}
Shadow Word: Death 1244 3.0% 12.7 24.34sec 29192 25909 Direct 12.7 24264 50589 29192 18.7%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 0.00 0.00 0.00 1.1267 0.0000 372189.31 372189.31 0.00% 25909.45 25909.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.28% 10.36 3 16 24263.74 10905 54837 24233.18 13622 34673 251441 251441 0.00%
crit 18.72% 2.39 0 9 50589.09 21810 109674 47025.65 0 109674 120749 120749 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target. {$?=}A364675[Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]

Action Priority List

    main
    [L]:3.75
  • if_expr:pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
    main
    [O]:9.00
  • target_if_expr:(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
Shadow Word: Pain 2209 5.3% 9.6 32.84sec 69140 0 Periodic 201.3 2775 5675 3290 17.8% 99.2%

Stats Details: Shadow Word Pain

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 0.00 201.34 201.34 210.48 0.0000 1.4786 662467.81 662467.81 0.00% 2225.20 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.22% 165.54 120 213 2774.55 77 3962 2773.85 2665 2929 459291 459291 0.00%
crit 17.78% 35.80 16 64 5674.72 2404 7924 5675.41 5207 6273 203177 203177 0.00%

Action Details: Shadow Word Pain

  • id:589
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:3.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.095880
  • base_td:0.00
  • base_td_mult:1.73
  • dot_duration:21.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=2} sec.
  • description:A word of darkness that causes {$?a390707=false}[{$=}{{$s1=0}*(1+{$390707s1=15}/100)}][{$s1=0}] Shadow damage instantly, and an additional {$?a390707=false}[{$=}{{$=}o2*(1+{$390707s1=15}/100)}][{$=}o2] Shadow damage over {$d=16 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m3=300}/100} Insanity.|r][]
Shadowy Apparitions 0 (1214) 0.0% (2.9%) 113.5 2.63sec 3208 0

Stats Details: Shadowy Apparitions

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.54 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowy Apparitions

  • id:341491
  • school:physical
  • range:0.0
  • travel_speed:6.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:341491
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:Mind Blast, Devouring Plague, and Void Bolt have a {$s4=100}% chance to conjure Shadowy Apparitions and Mind Sear has a {$s3=50}% chance to conjure Shadowy Apparitions. Shadowy Apparitions float towards all targets afflicted by your Vampiric Touch for {$148859s1=0} Shadow damage. Critical strikes with Mind Blast, Devouring Plague, and Void Bolt increase the damage of the Shadowy Apparitions they conjure by {$s2=100}%.
    Shadowy Apparition 1214 2.9% 111.8 2.63sec 3258 0 Direct 110.0 3312 0 3312 0.0%

Stats Details: Shadowy Apparition

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 111.78 109.98 0.00 0.00 0.00 0.0000 0.0000 364226.30 364226.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 109.98 75 144 3311.76 2321 5299 3310.39 3135 3553 364226 364226 0.00%

Action Details: Shadowy Apparition

  • id:148859
  • school:shadow
  • range:100.0
  • travel_speed:6.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Spelldata

  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals $148859sw1 Shadow damage.}
Soulseeker Arrow 1144 2.8% 7.3 36.76sec 47088 0 Periodic 86.7 3959 0 3959 0.0% 39.0%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.29 0.00 86.66 86.66 2.51 0.0000 1.3495 343062.84 343062.84 0.00% 2933.39 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 86.66 16 207 3958.59 28 4452 3956.06 3835 4321 343063 343063 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3665.83
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1747}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 3343 8.1% 9.6 32.84sec 104620 0 Periodic 167.1 5061 10357 6000 17.7% 99.2%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 0.00 167.07 167.07 210.48 0.0001 1.7805 1002425.32 1002425.32 0.00% 3369.90 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.27% 137.45 97 179 5061.47 900 7225 5060.48 4812 5345 695712 695712 0.00%
crit 17.73% 29.62 11 49 10356.58 101 14450 10357.06 9589 11791 306713 306713 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.201960
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [P]:0.00
  • target_if_expr:(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
pet - mindbender 11316 / 5244
Inescapable Torment 0 (2830) 0.0% (6.8%) 41.8 6.99sec 20254 0

Stats Details: Inescapable Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.80 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Inescapable Torment

  • id:373427
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:373427
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.
    Inescapable Torment (_damage) 6102 6.8% 41.8 6.99sec 20254 0 Direct 41.8 16163 34021 20254 22.9%

Stats Details: Inescapable Torment Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.80 41.80 0.00 0.00 0.00 0.0000 0.0000 846643.96 846643.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.10% 32.23 16 51 16163.42 10882 24138 16158.32 14289 18234 520907 520907 0.00%
crit 22.90% 9.57 1 22 34021.41 21764 48275 34040.64 26423 44462 325737 325737 0.00%

Action Details: Inescapable Torment Damage

  • id:373442
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.923780
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:373442
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:{$@spelldesc373427=Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.}
melee 5214 5.8% 131.3 2.22sec 5504 5319 Direct 131.3 4471 9094 5504 22.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.26 131.26 0.00 0.00 0.00 1.0348 0.0000 722483.14 722483.14 0.00% 5318.75 5318.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.66% 101.94 64 134 4471.20 3944 6103 4469.71 4236 4823 455789 455789 0.00%
crit 22.34% 29.33 9 55 9094.26 7887 12205 9094.77 8256 10168 266694 266694 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 0
Mental Fortitude 514 100.1% 335.9 0.88sec 457 0 Direct 347.7 442 0 442 0.0%

Stats Details: Mental Fortitude

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 335.92 347.71 0.00 0.00 0.00 0.0000 0.0000 153649.04 7076357.78 97.83% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 347.71 259 439 441.89 0 27823 443.09 271 666 153649 7076358 97.82%

Action Details: Mental Fortitude

  • id:377065
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20701.00
  • base_dd_max:20701.00
  • base_dd_mult:1.00

Spelldata

  • id:377065
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 2.9 123.48sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    default
    [D]:2.94
  • if_expr:buff.power_infusion.up|fight_remains<=15
Dark Ascension 5.3 61.88sec

Stats Details: Dark Ascension

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 0.00 102.73 0.00 0.00 1.1676 1.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Dark Ascension

  • id:391109
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:30.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:391109
  • name:Dark Ascension
  • school:shadow
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r

Action Priority List

    cds
    [G]:5.33
  • if_expr:pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
Desperate Prayer 0.3 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.27 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [J]:0.27
  • if_expr:health.pct<=75
Devouring Plague (_heal) 179.3 1.66sec

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 179.25 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 70.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Halo (_heal) 4.9 62.60sec

Stats Details: Halo Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 4.93 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Halo Heal

  • id:390971
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.610000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390971
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Mindbender 5.4 60.65sec

Stats Details: Mindbender

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.44 0.00 0.00 0.00 0.00 1.1689 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindbender

  • id:200174
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$=}{{$200010s1=300}/100} Insanity each time the Mindbender attacks.|r

Action Priority List

    cds
    [I]:5.45
  • if_expr:(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
Mindgames (_damage_reversal) 7.8 40.41sec

Stats Details: Mindgames Damage Reversal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 7.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindgames Damage Reversal

  • id:323706
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:323706
  • name:Mindgames
  • school:shadow
  • tooltip:
  • description:{$@spelldesc323673=Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. {$?=}c3[For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing generate up to {$=}{{$323706s2=10}*2} Insanity.|r] ][For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing restore up to {$=}{{$323706s3=2}*2}% mana.|r]}
Elemental Potion of Ultimate Power 1.4 309.43sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.40 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.40
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
Power Infusion 2.9 123.69sec

Stats Details: Power Infusion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Power Infusion

  • id:10060
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.

Action Priority List

    cds
    [F]:2.92
  • if_expr:(buff.voidform.up|buff.dark_ascension.up)
Shadow Crash (_dots) 8.6 32.92sec

Stats Details: Shadow Crash Dots

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.63 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadow Crash Dots

  • id:391286
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:391286
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 2.9 123.69sec

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 167.1 1.78sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 167.07 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2563.10
  • base_dd_max:2563.10
  • base_dd_mult:1.00

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ancient Madness 5.3 0.0 61.9sec 61.9sec 19.4sec 34.29% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_ancient_madness
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.2s / 71.7s
  • trigger_min/max:61.2s / 71.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • ancient_madness_1:1.66%
  • ancient_madness_2:1.67%
  • ancient_madness_3:1.67%
  • ancient_madness_4:1.68%
  • ancient_madness_5:1.68%
  • ancient_madness_6:1.69%
  • ancient_madness_7:1.69%
  • ancient_madness_8:1.70%
  • ancient_madness_9:1.70%
  • ancient_madness_10:1.71%
  • ancient_madness_11:1.72%
  • ancient_madness_12:1.72%
  • ancient_madness_13:1.73%
  • ancient_madness_14:1.73%
  • ancient_madness_15:1.74%
  • ancient_madness_16:1.75%
  • ancient_madness_17:1.75%
  • ancient_madness_18:1.76%
  • ancient_madness_19:1.76%
  • ancient_madness_20:1.77%

Spelldata

  • id:341240
  • name:Ancient Madness
  • tooltip:
  • description:Voidform and Dark Ascension increase your critical strike chance by {$s1=10}% for {$194249d=20 seconds}, reducing by {$=}{{$s3=5}/10}.1% every sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.9 0.0 123.5sec 123.5sec 14.7sec 14.46% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:120.0s / 132.6s
  • trigger_min/max:120.0s / 132.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.46%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Coalescing Shadows 56.1 146.5 5.4sec 1.5sec 3.4sec 63.89% 75.97% 70.7 (70.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 39.3s
  • trigger_min/max:0.0s / 35.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.4s

Stack Uptimes

  • coalescing_shadows_1:22.38%
  • coalescing_shadows_2:14.50%
  • coalescing_shadows_3:27.01%

Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Coalescing Shadows (_dot) 2.1 53.3 124.8sec 5.4sec 137.4sec 97.99% 98.72% 53.3 (53.3) 1.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows_dot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.1s / 356.5s
  • trigger_min/max:0.0s / 39.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.8s

Stack Uptimes

  • coalescing_shadows_dot_1:97.99%

Spelldata

  • id:391244
  • name:Coalescing Shadows
  • tooltip:Your periodic damage is increased by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Ascension 5.3 0.0 61.9sec 61.9sec 19.4sec 34.29% 42.12% 97.8 (97.8) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_ascension
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.2s / 71.7s
  • trigger_min/max:61.2s / 71.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • dark_ascension_1:34.29%

Spelldata

  • id:391109
  • name:Dark Ascension
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Dark Evangelism 1.0 200.9 208.0sec 1.4sec 292.9sec 97.69% 98.14% 196.9 (196.9) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_evangelism
  • max_stacks:5
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:77.1s / 328.3s
  • trigger_min/max:0.3s / 31.1s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 353.8s

Stack Uptimes

  • dark_evangelism_1:0.12%
  • dark_evangelism_2:0.12%
  • dark_evangelism_3:0.12%
  • dark_evangelism_4:0.80%
  • dark_evangelism_5:96.52%

Spelldata

  • id:391099
  • name:Dark Evangelism
  • tooltip:Periodic Shadow damage increased by {$=}w1%.
  • description:{$@spelldesc391095=Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391095
  • name:Dark Evangelism
  • tooltip:
  • description:Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Death and Madness (_insanity_gain) 0.4 0.0 0.0sec 0.0sec 0.0sec 0.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_insanity_gain
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s

Stack Uptimes

Spelldata

  • id:321973
  • name:Death and Madness
  • tooltip:{$=}{{$m1=750}/100} Insanity generated every {$t1=1} sec.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_reset) 2.8 0.0 22.5sec 22.5sec 16.9sec 15.51% 0.00% 0.0 (0.0) 1.9

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_reset
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.9s / 39.0s
  • trigger_min/max:20.9s / 39.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • death_and_madness_reset_1:15.51%

Spelldata

  • id:390628
  • name:Death and Madness
  • tooltip:
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:321291
  • name:Death and Madness
  • tooltip:
  • description:If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Desperate Prayer 0.3 0.0 0.0sec 0.0sec 9.1sec 0.83% 0.00% 2.2 (2.2) 0.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • desperate_prayer_1:0.83%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Devoured Pride 1.5 0.0 61.0sec 0.0sec 22.8sec 10.85% 12.90% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 63.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.0s / 32.0s

Stack Uptimes

  • devoured_pride_1:10.85%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=15}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=15}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 309.4sec 309.4sec 27.3sec 12.52% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:306.1s / 320.0s
  • trigger_min/max:306.1s / 320.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.52%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mental Fortitude 4.4 331.5 82.8sec 0.9sec 64.3sec 95.17% 100.00% 331.5 (331.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.1s / 334.3s
  • trigger_min/max:0.0s / 31.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 328.2s

Stack Uptimes

  • mental_fortitude_1:95.17%

Spelldata

  • id:377065
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Mind Devourer 6.1 0.1 41.8sec 40.7sec 2.1sec 4.22% 11.92% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_devourer
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 311.4s
  • trigger_min/max:0.8s / 311.4s
  • trigger_pct:10.00%
  • duration_min/max:0.0s / 12.2s

Stack Uptimes

  • mind_devourer_1:4.22%

Spelldata

  • id:373204
  • name:Mind Devourer
  • tooltip:Your next Devouring Plague or Mind Sear costs 0 insanity.
  • description:{$@spelldesc373202=Mind Blast has a {$s1=15}% chance to make your next Devouring Plague or Mind Sear cost no insanity.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373202
  • name:Mind Devourer
  • tooltip:
  • description:Mind Blast has a {$s1=15}% chance to make your next Devouring Plague or Mind Sear cost no insanity.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Mind Flay: Insanity 41.0 9.7 7.3sec 5.9sec 3.2sec 44.17% 0.00% 9.7 (9.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_flay_insanity
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 33.0s
  • trigger_min/max:0.8s / 22.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.5s

Stack Uptimes

  • mind_flay_insanity_1:44.17%

Spelldata

  • id:391401
  • name:Mind Flay: Insanity
  • tooltip:Mind Flay is temporarily empowered.
  • description:{$@spelldesc391399=Devouring Plague transforms your next Mind Flay into Mind Flay: Insanity. Lasts {$391401d=10 seconds}. {$@=}spellicon391403 {$@=}spellname391403 {$@spelldesc391403=Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Infusion 2.9 0.0 123.7sec 123.7sec 19.4sec 18.93% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:122.4s / 132.6s
  • trigger_min/max:122.4s / 132.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • power_infusion_1:18.93%

Spelldata

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 17.3 0.7 16.9sec 16.2sec 1.3sec 7.68% 27.14% 0.7 (0.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:2.40
  • modifier:1.00

Trigger Details

  • interval_min/max:0.9s / 70.8s
  • trigger_min/max:0.9s / 70.8s
  • trigger_pct:8.90%
  • duration_min/max:0.0s / 8.5s

Stack Uptimes

  • shadowy_insight_1:7.68%

Spelldata

  • id:375981
  • name:Shadowy Insight
  • tooltip:Your next Mind Blast is instant cast.
  • description:{$@spelldesc375888=Mind Blast gains an additional charge. Shadow Word: Pain periodic damage has a chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 61.0sec 45.9sec 16.5sec 23.70% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 206.1s
  • trigger_min/max:0.0s / 202.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 92.1s

Stack Uptimes

  • sophic_devotion_1:23.70%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.7 0.0 155.0sec 155.0sec 19.4sec 4.69% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 253.1s
  • trigger_min/max:122.4s / 253.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:4.69%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.7 0.0 155.7sec 155.7sec 19.4sec 4.69% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 254.0s
  • trigger_min/max:122.4s / 254.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:4.69%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.7 0.0 156.2sec 156.2sec 19.4sec 4.68% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 254.7s
  • trigger_min/max:122.4s / 254.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:4.68%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.7 0.0 156.9sec 156.9sec 19.4sec 4.86% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 253.6s
  • trigger_min/max:122.4s / 253.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:4.86%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Surge of Darkness 12.9 14.9 23.0sec 10.4sec 12.4sec 53.37% 100.00% 3.6 (3.6) 7.5

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_surge_of_darkness
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 140.8s
  • trigger_min/max:0.0s / 130.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 103.3s

Stack Uptimes

  • surge_of_darkness_1:25.91%
  • surge_of_darkness_2:14.47%
  • surge_of_darkness_3:12.99%

Spelldata

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike is instant cast, and deals {$s2=200}% additional damage.
  • description:{$@spelldesc162448=Your Vampiric Touch and Devouring Plague damage has a chance to cause your next Mind Spike to be instant cast and deal {$87160s2=200}% additional damage. Stacks up to {$87160u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Twist of Fate 1.0 205.1 0.0sec 0.5sec 104.4sec 34.79% 32.75% 205.1 (205.1) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 4.8s
  • trigger_pct:100.00%
  • duration_min/max:82.2s / 125.9s

Stack Uptimes

  • twist_of_fate_1:34.79%

Spelldata

  • id:390978
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$=}w1%.
  • description:{$@spelldesc390972=After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390972
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Shadowy Apparition from Devouring Plague 50.7 33.0 69.0 5.9s 0.8s 22.0s
Shadowy Apparition from Mind Blast 62.9 44.0 84.0 4.8s 0.0s 15.4s
Mind Devourer free Devouring Plague proc 6.3 0.0 17.0 40.7s 0.8s 311.4s
Void Tendril proc from Idol of C'Thun 11.2 4.0 25.0 25.0s 0.3s 121.2s
Shadowy Insight procs 17.3 7.0 32.0 16.9s 0.9s 70.8s
Shadowy Insight procs lost to overflow 0.7 0.0 7.0 89.3s 0.9s 338.2s
Coalescing Shadows from Mind Fay 50.5 23.0 84.0 5.7s 0.3s 81.1s
Coalescing Shadows from Shadow Word: Pain 12.0 1.0 28.0 23.1s 0.9s 247.7s
Coalescing Shadows from Shadowy Apparition 8.8 1.0 21.0 29.5s 0.0s 261.4s
Surge of Darkness from Vampiric Touch 13.4 2.0 28.0 20.9s 0.8s 258.7s
Surge of Darkness from Devouring Plague 14.3 1.0 39.0 19.6s 0.0s 200.7s
Mind Flay: Insanity casts that did not channel for full ticks 0.3 0.0 1.0 0.0s 0.0s 0.0s
Idol of Y'Shaarj Devoured Violence procs 4.0 3.0 5.0 60.7s 60.0s 63.4s
Mindgames casts without full Mastery value 0.5 0.0 5.0 107.8s 35.4s 303.2s
Inescapable Torment expired when Mind Blast was ready 3.1 0.0 8.0 96.1s 0.0s 336.5s
Inescapable Torment expired when Shadow Word: Death was ready 0.7 0.0 5.0 157.6s 0.0s 335.8s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 81.13% 74.27% 85.55% 10.4s 0.0s 47.1s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Auspicious SpiritsInsanity109.98109.694.82%1.000.280.26%
Insanity Gained from Idol of C'thun Mind Flay'sInsanity164.52327.1514.38%1.991.890.57%
MindbenderInsanity131.26391.8417.22%2.991.950.49%
Throes of PainInsanity1.004.950.22%4.950.050.93%
Dark AscensionInsanity5.31154.376.79%29.055.023.15%
mana_regenMana834.4766631.01100.00%79.85412720.3886.10%
Mind BlastInsanity62.85375.6016.51%5.981.520.40%
Mind FlayInsanity40.4880.683.55%1.990.280.35%
Mind Flay: InsanityInsanity161.42645.0228.35%4.000.670.10%
Mind SpikeInsanity10.2841.121.81%4.000.000.00%
Shadow CrashInsanity9.63144.426.35%15.000.000.00%
Vampiric TouchInsanity0.000.000.00%4.000.000.00%
Usage Type Count Total Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 50.692229.1643.9843.981239.88
HaloMana 4.9312322.362500.002500.0110.62
MindgamesMana 7.7538751.505000.005000.0410.71
Shadow Word: DeathMana 12.7515937.041250.001249.9923.35
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 216100.0 304.84 297.70 2158807.7 212635.4 57616.1 216100.0
Mana 49999.0 222.10 223.37 412720.8 49619.0 43758.6 49999.0
Insanity 15.0 7.58 7.43 11.7 45.7 5.0 100.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 41514.70
Minimum 36579.41
Maximum 47500.58
Spread ( max - min ) 10921.18
Range [ ( max - min ) / 2 * 100% ] 13.15%
Standard Deviation 1445.9957
5th Percentile 39200.80
95th Percentile 43974.87
( 95th Percentile - 5th Percentile ) 4774.07
Mean Distribution
Standard Deviation 16.6980
95.00% Confidence Interval ( 41481.97 - 41547.43 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4661
0.1 Scale Factor Error with Delta=300 17850
0.05 Scale Factor Error with Delta=300 71397
0.01 Scale Factor Error with Delta=300 1784916
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 41514.70
Minimum 36579.41
Maximum 47500.58
Spread ( max - min ) 10921.18
Range [ ( max - min ) / 2 * 100% ] 13.15%
Standard Deviation 1445.9957
5th Percentile 39200.80
95th Percentile 43974.87
( 95th Percentile - 5th Percentile ) 4774.07
Mean Distribution
Standard Deviation 16.6980
95.00% Confidence Interval ( 41481.97 - 41547.43 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4661
0.1 Scale Factor Error with Delta=300 17850
0.05 Scale Factor Error with Delta=300 71397
0.01 Scale Factor Error with Delta=300 1784916
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 41514.70
Minimum 36579.41
Maximum 47500.58
Spread ( max - min ) 10921.18
Range [ ( max - min ) / 2 * 100% ] 13.15%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 9914581.40
Minimum 7493665.55
Maximum 12343777.17
Spread ( max - min ) 4850111.62
Range [ ( max - min ) / 2 * 100% ] 24.46%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 297.92
Minimum 0.00
Maximum 1152.24
Spread ( max - min ) 1152.24
Range [ ( max - min ) / 2 * 100% ] 193.38%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 304.55
Minimum 0.00
Maximum 1146.57
Spread ( max - min ) 1146.57
Range [ ( max - min ) / 2 * 100% ] 188.24%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 arcane_torrent
7 0.00 use_item,name=shadowed_orb_of_torment
8 0.00 variable,name=mind_sear_cutoff,op=set,value=2
9 0.00 shadow_crash,if=talent.shadow_crash.enabled
A 0.00 mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
B 0.00 vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled
Default action list Executed every time the actor is available.
# count action,conditions
C 1.40 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
0.00 variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
0.00 variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
0.00 variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
0.00 variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
0.00 variable,name=is_vt_possible,op=set,value=0,default=1
0.00 variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
0.00 variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
0.00 variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
D 2.94 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 variable,name=pool_amount,op=set,value=60
E 0.00 run_action_list,name=main
actions.cds
# count action,conditions
F 2.92 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
G 5.33 dark_ascension,if=pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
H 0.00 call_action_list,name=trinkets
I 5.45 mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
J 0.27 desperate_prayer,if=health.pct<=75
actions.main
# count action,conditions
K 0.00 call_action_list,name=cds
0.00 mind_blast,if=cooldown.mind_blast.charges>=2&talent.mind_devourer&spell_targets.mind_sear>=3&spell_targets.mind_sear<=7&!buff.mind_devourer.up
Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
L 3.75 shadow_word_death,if=pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
M 5.07 mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
0.00 damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
0.00 void_bolt,if=variable.dots_up&insanity<=85
0.00 mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
0.00 mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
N 50.69 devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
O 9.00 shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
P 0.00 vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
0.00 shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
Q 56.74 mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
R 7.78 mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
S 8.63 shadow_crash,if=raid_event.adds.in>10
0.00 dark_void,if=raid_event.adds.in>20
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
0.00 void_torrent,if=insanity<=35,target_if=variable.dots_up
T 1.23 mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
0.00 vampiric_touch,if=buff.unfurling_darkness.up
U 40.53 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
V 4.95 halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
0.00 divine_star,if=spell_targets.divine_star>1
Use when it will hit at least 2 targets.
0.00 lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75
W 10.28 mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
X 6.78 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>30
Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain
Use Shadow Word: Pain while moving as a low-priority action
actions.trinkets
# count action,conditions
0.00 use_item,name=scars_of_fraternal_strife,if=(!buff.scars_of_fraternal_strife_4.up&time>1)|(buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10)
0.00 use_item,name=macabre_sheet_music,if=cooldown.void_eruption.remains>10|cooldown.dark_ascension.remains>10
0.00 use_item,name=soulletting_ruby,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10,target_if=min:target.health.pct
0.00 use_item,name=architects_ingenuity_core
Use this on CD for max CDR
Y 2.92 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10
Default fallback for usable items: Use on cooldown in order by trinket slot.

Sample Sequence

012589IMGCFDYNOQRUTVNUNQUNUNQUNMUNUQWNUWQSNQQUTWNRUNQUNQUNUQQNIOGNQSUNNQUVNQRULNQQUWQNQUSNQUWNUQQWNUQRWIOQGFDYNUSNQUVWNQUXNOQMUNNQQUNQRSUNNQTUNQUNQUNIOQNGUNQSNNQRQUNNOQQUNQUNUQVXNQSUNUQRXILLJNQGFDYQUNQUQNQSUNQULLNNMUNQRUNQQUWOOQNSUNQUN

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 5 shadowform Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 8 mind_sear_cutoff Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 9 shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
0:00.000 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
bloodlust, static_empowerment
0:00.940 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
bloodlust, coalescing_shadows, static_empowerment
0:01.881 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
bloodlust, coalescing_shadows_dot, static_empowerment(2)
0:02.822 default C potion Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3)
0:02.822 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.822 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.822 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.822 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(3), elemental_potion_of_ultimate_power
0:03.577 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(4), elemental_potion_of_ultimate_power
0:04.330 main Q mind_blast Fluffy_Pillow 49953.8/49999: 100% mana
13.0/100: 13% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(19), mental_fortitude, coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.085 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
22.0/100: 22% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(18), mind_devourer, mental_fortitude, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.840 main U mind_flay Fluffy_Pillow 45010.2/49999: 90% mana
25.0/100: 25% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(17), mind_devourer, mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.339 main T mind_blast Fluffy_Pillow 47408.6/49999: 95% mana
49.0/100: 49% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(16), mind_devourer, mental_fortitude, dark_evangelism(4), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.094 main V halo Fluffy_Pillow 48616.6/49999: 97% mana
58.0/100: 58% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(15), surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(4), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.849 main N devouring_plague Fluffy_Pillow 47324.6/49999: 95% mana
65.0/100: 65% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(14), surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(4), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.602 main U mind_flay Fluffy_Pillow 48529.4/49999: 97% mana
72.0/100: 72% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.102 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
98.0/100: 98% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(12), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.854 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(11), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.607 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(11), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.108 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
96.0/100: 96% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(9), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.863 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(8), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.363 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
86.0/100: 86% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(7), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.117 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(6), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.873 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
bloodlust, power_infusion, ancient_madness(5), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.374 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
bloodlust, power_infusion, ancient_madness(4), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.129 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
bloodlust, power_infusion, ancient_madness(3), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.883 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
bloodlust, power_infusion, ancient_madness(2), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.385 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
91.0/100: 91% insanity
bloodlust, power_infusion, ancient_madness, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_vers, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.139 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
bloodlust, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.011 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
bloodlust, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.951 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
bloodlust, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.891 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.830 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.704 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
bloodlust, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.643 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.584 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
65.0/100: 65% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.523 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
bloodlust, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.462 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
bloodlust, surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:34.402 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
bloodlust, surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:35.342 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
bloodlust, surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:37.216 main T mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
bloodlust, surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:38.155 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
bloodlust, surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:39.093 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
bloodlust, surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:40.034 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:41.255 main U mind_flay Fluffy_Pillow 45007.0/49999: 90% mana
71.0/100: 71% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:43.692 main N devouring_plague Fluffy_Pillow 48906.2/49999: 98% mana
90.0/100: 90% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:44.912 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:46.133 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:48.571 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:49.791 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:51.012 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:53.448 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
0:54.667 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:57.104 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
0:58.325 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
0:59.545 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:00.766 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:01.988 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
22.0/100: 22% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:03.209 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:04.429 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:05.647 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
ancient_madness(19), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:06.867 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
ancient_madness(18), surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:08.086 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
ancient_madness(17), surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:10.522 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
ancient_madness(14), surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
1:11.742 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
77.0/100: 77% insanity
ancient_madness(13), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:12.961 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
ancient_madness(12), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:14.182 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
ancient_madness(11), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:16.619 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
ancient_madness(8), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:17.840 main N devouring_plague Fluffy_Pillow 47507.0/49999: 95% mana
66.0/100: 66% insanity
ancient_madness(7), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:19.061 main Q mind_blast Fluffy_Pillow 49460.6/49999: 99% mana
19.0/100: 19% insanity
ancient_madness(6), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:20.281 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity
ancient_madness(5), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:21.501 main U mind_flay Fluffy_Pillow 45005.4/49999: 90% mana
32.0/100: 32% insanity
ancient_madness(3), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:23.937 main L shadow_word_death Fluffy_Pillow 48903.0/49999: 98% mana
55.0/100: 55% insanity
ancient_madness, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:25.158 main N devouring_plague Fluffy_Pillow 49606.6/49999: 99% mana
59.0/100: 59% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
1:26.378 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:27.598 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:28.817 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
22.0/100: 22% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:31.253 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:32.473 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:33.696 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:34.917 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
7.0/100: 7% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:36.136 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:38.571 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:39.794 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:41.014 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:42.234 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:44.671 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:45.893 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:47.113 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
6.0/100: 6% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:49.549 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
1:50.770 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:51.991 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:53.211 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:54.433 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
1:56.869 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
1:58.089 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:59.310 main W mind_spike Fluffy_Pillow 45007.0/49999: 90% mana
35.0/100: 35% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:00.531 cds I mindbender Fluffy_Pillow 46960.6/49999: 94% mana
39.0/100: 39% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:01.987 main O shadow_word_death Fluffy_Pillow 49290.2/49999: 99% mana
44.0/100: 44% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
2:03.208 main Q mind_blast Fluffy_Pillow 49993.8/49999: 100% mana
47.0/100: 47% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:04.428 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:05.648 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(5)
2:05.648 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
power_infusion, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(5)
2:05.648 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
blood_fury, power_infusion, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(5)
2:05.648 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
blood_fury, power_infusion, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:06.625 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
blood_fury, power_infusion, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:08.572 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
blood_fury, power_infusion, ancient_madness(18), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:09.549 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
blood_fury, power_infusion, ancient_madness(17), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:10.526 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
blood_fury, power_infusion, ancient_madness(16), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:11.505 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
blood_fury, power_infusion, ancient_madness(15), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:13.453 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
65.0/100: 65% insanity
blood_fury, power_infusion, ancient_madness(13), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:14.433 main W mind_spike Fluffy_Pillow 47510.2/49999: 95% mana
69.0/100: 69% insanity
blood_fury, power_infusion, ancient_madness(12), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:15.411 main N devouring_plague Fluffy_Pillow 49075.0/49999: 98% mana
76.0/100: 76% insanity
blood_fury, power_infusion, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:16.388 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
blood_fury, power_infusion, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:17.368 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
blood_fury, power_infusion, ancient_madness(9), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:19.317 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
blood_fury, power_infusion, ancient_madness(7), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:22.239 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
power_infusion, ancient_madness(4), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:23.214 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
power_infusion, ancient_madness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:24.191 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
power_infusion, ancient_madness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:25.168 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
power_infusion, ancient_madness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
2:26.146 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:28.583 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
82.0/100: 82% insanity
mind_devourer, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:29.803 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:31.024 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:32.244 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:33.463 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:35.900 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
2:37.122 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:38.342 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:39.563 main S shadow_crash Fluffy_Pillow 45007.0/49999: 90% mana
40.0/100: 40% insanity
surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:40.784 main U mind_flay Fluffy_Pillow 46960.6/49999: 94% mana
60.0/100: 60% insanity
surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:43.222 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
2:44.443 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity
surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:45.662 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:46.883 main T mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:48.103 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:50.540 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:51.759 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:52.979 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:55.415 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
2:56.636 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:57.857 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:00.292 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:01.512 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:02.731 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:03.951 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:05.174 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:06.393 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:07.615 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:10.051 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
91.0/100: 91% insanity
ancient_madness(18), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
3:11.273 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
ancient_madness(17), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:12.495 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
ancient_madness(16), surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:13.715 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity
ancient_madness(14), surge_of_darkness(2), mind_devourer, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:14.936 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity
ancient_madness(13), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:16.155 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
twist_of_fate, ancient_madness(12), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:17.376 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
twist_of_fate, ancient_madness(11), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:18.778 main Q mind_blast Fluffy_Pillow 45005.4/49999: 90% mana
50.0/100: 50% insanity
twist_of_fate, ancient_madness(9), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:19.999 main U mind_flay Fluffy_Pillow 46959.0/49999: 94% mana
59.0/100: 59% insanity
twist_of_fate, ancient_madness(8), surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:22.436 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
82.0/100: 82% insanity
twist_of_fate, ancient_madness(6), surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
3:23.655 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
86.0/100: 86% insanity
twist_of_fate, ancient_madness(4), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:24.876 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
twist_of_fate, ancient_madness(3), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:26.098 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
twist_of_fate, ancient_madness(2), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:27.320 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
twist_of_fate, ancient_madness, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:28.541 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:30.978 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
3:32.199 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:33.662 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
twist_of_fate, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:36.099 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
3:37.321 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
5.0/100: 5% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:39.757 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:40.975 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:42.196 main X mind_flay Fluffy_Pillow 47507.0/49999: 95% mana
37.0/100: 37% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:45.849 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:47.067 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
11.0/100: 11% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:48.289 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:49.508 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:51.943 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:53.163 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
11.0/100: 11% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:55.599 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:56.820 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:58.041 main X mind_flay Fluffy_Pillow 45007.0/49999: 90% mana
34.0/100: 34% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:01.693 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:02.913 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:04.132 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:05.352 cds J desperate_prayer PR_Priest_Shadow 49999.0/49999: 100% mana
57.0/100: 57% insanity
twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:05.352 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:06.572 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:07.792 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:09.012 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
desperate_prayer, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:09.012 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:09.012 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
4:09.012 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:09.989 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:11.936 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, ancient_madness(18), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:12.914 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, ancient_madness(17), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:13.891 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
blood_fury, power_infusion, desperate_prayer, twist_of_fate, death_and_madness_reset, ancient_madness(16), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:15.841 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, sophic_devotion, static_empowerment(5)
4:16.818 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
77.0/100: 77% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(13), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:17.795 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(12), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:18.774 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:19.752 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:21.701 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
91.0/100: 91% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:22.679 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(7), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:23.656 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
blood_fury, power_infusion, twist_of_fate, ancient_madness(6), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:25.606 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
85.0/100: 85% insanity
power_infusion, twist_of_fate, ancient_madness(4), surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:26.583 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(3), surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:27.560 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
97.0/100: 97% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(2), surge_of_darkness(2), mind_devourer, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:28.537 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness, surge_of_darkness(2), dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:29.514 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:30.735 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:33.171 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:34.392 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:35.613 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:36.832 main U mind_flay Fluffy_Pillow 45003.8/49999: 90% mana
46.0/100: 46% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:39.270 main N devouring_plague Fluffy_Pillow 48904.6/49999: 98% mana
64.0/100: 64% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
4:40.491 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:41.712 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:42.933 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:45.371 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:46.591 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
twist_of_fate, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:47.811 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:49.031 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:50.252 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, death_and_madness_reset, mind_devourer, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:51.473 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:52.693 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:55.128 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:56.348 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:57.569 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
5:00.006 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3463 1 10805 10291 6827
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 216100 205820 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +687 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +515 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +687 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +687 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +89 Sta (frozen_spellthread_2) }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +515 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +386 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +386 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +687 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIk04ABAAAAAAAAAAAAQikkSESRLJRSJhEBpRSSiECSQIFpFSCA
class_talents=dispel_magic:1/improved_flash_heal:1/protective_light:1/angelic_feather:1/phantasm:1/death_and_madness:1/leap_of_faith:1/dominate_mind:1/mass_dispel:1/power_infusion:1/vampiric_embrace:1/tithe_evasion:1/improved_mass_dispel:1/body_and_soul:1/twins_of_the_sun_priestess:1/sanlayn:1/twist_of_fate:2/throes_of_pain:2/halo:1/translucent_image:1/mindgames:1/lights_inspiration:2/improved_fade:2/manipulation:2/angelic_bulwark:1/shattered_perceptions:1
spec_talents=devouring_plague:1/dispersion:1/shadowy_apparitions:1/silence:1/mental_fortitude:1/misery:1/coalescing_shadows:1/mind_spike:1/puppet_master:1/mental_decay:1/dark_ascension:1/surge_of_darkness:1/harnessed_shadows:1/shadowy_insight:1/ancient_madness:2/shadow_crash:1/dark_evangelism:2/auspicious_spirits:1/mindbender:1/mind_flay_insanity:1/encroaching_shadows:1/inescapable_torment:2/screams_of_the_void:2/mind_devourer:1/idol_of_yshaarj:1/idol_of_cthun:1

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/use_item,name=shadowed_orb_of_torment
actions.precombat+=/variable,name=mind_sear_cutoff,op=set,value=2
actions.precombat+=/shadow_crash,if=talent.shadow_crash.enabled
actions.precombat+=/mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
actions.precombat+=/vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled

# Executed every time the actor is available.
actions=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
actions+=/variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions+=/variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
actions+=/variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
actions+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
actions+=/variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
actions+=/variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
actions+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
actions+=/variable,name=pool_amount,op=set,value=60
actions+=/run_action_list,name=main

actions.cds=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
actions.cds+=/call_action_list,name=trinkets
actions.cds+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.main=call_action_list,name=cds
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
actions.main+=/mind_blast,if=cooldown.mind_blast.charges>=2&talent.mind_devourer&spell_targets.mind_sear>=3&spell_targets.mind_sear<=7&!buff.mind_devourer.up
actions.main+=/shadow_word_death,if=pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
actions.main+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
actions.main+=/damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
actions.main+=/void_bolt,if=variable.dots_up&insanity<=85
# Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
actions.main+=/mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
# Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
actions.main+=/mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.main+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
actions.main+=/shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
actions.main+=/vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
actions.main+=/shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
actions.main+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
actions.main+=/mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
actions.main+=/shadow_crash,if=raid_event.adds.in>10
actions.main+=/dark_void,if=raid_event.adds.in>20
actions.main+=/devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
actions.main+=/void_torrent,if=insanity<=35,target_if=variable.dots_up
actions.main+=/mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
actions.main+=/vampiric_touch,if=buff.unfurling_darkness.up
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
# Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
actions.main+=/halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
# Use when it will hit at least 2 targets.
actions.main+=/divine_star,if=spell_targets.divine_star>1
actions.main+=/lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75
actions.main+=/mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
actions.main+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
actions.main+=/shadow_crash,if=raid_event.adds.in>30
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.main+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.main+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.main+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.main+=/shadow_word_pain

actions.trinkets=use_item,name=scars_of_fraternal_strife,if=(!buff.scars_of_fraternal_strife_4.up&time>1)|(buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10)
actions.trinkets+=/use_item,name=macabre_sheet_music,if=cooldown.void_eruption.remains>10|cooldown.dark_ascension.remains>10
actions.trinkets+=/use_item,name=soulletting_ruby,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10,target_if=min:target.health.pct
# Use this on CD for max CDR
actions.trinkets+=/use_item,name=architects_ingenuity_core
# Default fallback for usable items: Use on cooldown in order by trinket slot.
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant=devotion_of_haste_3
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant=devotion_of_haste_3
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=6827
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 47149 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
47149.0 47149.0 42.9 / 0.091% 7407.4 / 15.7% 61.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
733.5 731.5 Mana 0.65% 52.5 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 47149
Elemental Blast 8141 17.3% 22.1 13.49sec 110380 95395 Direct 22.1 90844 182978 110428 21.3% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.10 22.10 0.00 0.00 0.00 1.1571 0.0000 2439928.16 2439928.16 0.00% 95395.40 95395.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.74% 17.40 6 27 90843.76 46980 216777 90876.15 74506 109959 1580533 1580533 0.00%
crit 21.26% 4.70 0 13 182978.15 93961 422919 182002.56 0 314875 859395 859395 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [N]:22.10
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 4857 10.3% 82.1 3.66sec 17745 137082 Direct 82.1 6336 12725 7445 17.4% 0.0%
Periodic 192.2 3737 7514 4396 17.5% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.05 82.05 192.22 192.22 81.05 0.1295 1.5507 1455948.58 1455948.58 0.00% 4716.49 137082.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 67.80 40 99 6335.70 3614 14257 6334.44 5569 7453 429575 429575 0.00%
crit 17.37% 14.25 0 29 12725.29 7228 28107 12721.76 0 17564 181312 181312 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.53% 158.64 108 206 3736.60 1820 8245 3736.32 3345 4236 592788 592788 0.00%
crit 17.47% 33.57 14 62 7514.34 3619 16250 7513.88 6357 9575 252274 252274 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [V]:8.83
Flametongue Weapon 0 (948) 0.0% (2.0%) 1.0 0.00sec 284191 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 948 2.0% 661.5 0.73sec 430 0 Direct 661.5 366 734 430 17.4% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 661.54 661.54 0.00 0.00 0.00 0.0000 0.0000 284190.83 284190.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 546.63 394 722 365.55 303 639 365.56 338 400 199822 199822 0.00%
crit 17.37% 114.91 60 180 734.21 605 1262 734.22 668 806 84368 84368 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1089 2.3% 28.3 7.75sec 11533 0 Direct 28.3 9805 19712 11533 17.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.33 28.33 0.00 0.00 0.00 0.0000 0.0000 326715.35 326715.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 23.39 1 66 9805.03 9732 10030 9805.09 9732 10030 229307 229307 0.00%
crit 17.44% 4.94 0 18 19712.47 19463 20059 19333.54 0 20059 97409 97409 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 5550 11.8% 43.2 6.91sec 38486 33202 Direct 43.2 32786 65512 38487 17.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.23 43.23 0.00 0.00 0.00 1.1592 0.0000 1663732.22 1663732.22 0.00% 33201.60 33201.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 35.70 21 53 32786.11 7897 111051 32845.06 25609 40783 1170448 1170448 0.00%
crit 17.42% 7.53 1 23 65512.41 15795 209058 65626.58 16111 133469 493284 493284 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [M]:38.77
  • if_expr:buff.hailstorm.up
    single
    [T]:4.46
Ice Strike 1994 4.2% 24.7 12.26sec 24204 20820 Direct 24.7 20574 41335 24205 17.5% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.69 24.69 0.00 0.00 0.00 1.1625 0.0000 597627.00 597627.00 0.00% 20820.34 20820.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 20.37 9 29 20573.93 15697 46692 20576.03 17945 24170 419148 419148 0.00%
crit 17.49% 4.32 0 12 41335.11 31393 82982 40876.10 0 80585 178479 178479 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:24.69
  • if_expr:talent.hailstorm.enabled
Lava Lash 9504 20.2% 66.3 4.46sec 42957 36886 Direct 66.3 (66.3) 36526 73436 42957 17.4% (17.4%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.29 66.29 0.00 0.00 0.00 1.1646 0.0000 2847509.22 2847509.22 0.00% 36886.27 36886.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 54.74 27 85 36526.46 18515 118392 36544.73 31762 43367 1999382 1999382 0.00%
crit 17.42% 11.55 1 26 73435.64 37029 213712 73491.50 49306 117506 848128 848128 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [I]:50.72
  • if_expr:buff.hot_hand.up|buff.ashen_catalyst.stack=8
    single
    [Q]:15.57
Lightning Bolt 3933 8.3% 18.6 16.30sec 63420 53261 Direct 18.6 52205 104838 63422 21.3% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.59 18.59 0.00 0.00 0.00 1.1908 0.0000 1178668.59 1178668.59 0.00% 53261.12 53261.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.69% 14.62 6 25 52205.41 29713 133058 52329.25 40918 67853 763459 763459 0.00%
crit 21.31% 3.96 0 12 104837.95 59426 261703 103679.93 0 215273 415210 415210 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [K]:7.00
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [O]:1.66
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [R]:9.93
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1702 3.6% 193.2 1.81sec 2641 1482 Direct 193.2 2612 5253 2641 17.3% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.15 193.15 0.00 0.00 0.00 1.7817 0.0000 510197.51 728872.17 30.00% 1482.49 1482.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.24% 127.94 83 176 2612.20 2204 4389 2612.22 2426 2847 334203 477445 30.00%
crit 17.35% 33.51 13 60 5252.66 4408 8778 5252.12 4675 6043 175995 251427 30.00%
miss 16.42% 31.71 13 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 854 1.8% 193.3 1.80sec 1325 744 Direct 193.3 1308 2629 1325 17.4% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.32 193.32 0.00 0.00 0.00 1.7817 0.0000 256117.21 365891.06 30.00% 743.60 743.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.22% 128.02 80 175 1308.08 1102 2195 1308.12 1212 1451 167457 239231 30.00%
crit 17.45% 33.73 14 58 2628.54 2204 4389 2628.30 2344 2971 88660 126660 30.00%
miss 16.33% 31.57 11 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 165 (2988) 0.3% (6.3%) 7.0 45.72sec 127264 106837 Direct 7.0 (14.0) 5978 12008 7023 17.3% (19.4%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.00 1.1913 0.0000 49378.93 49378.93 0.00% 106836.54 106836.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 5.81 1 8 5978.07 4707 9434 5981.81 4707 7659 34742 34742 0.00%
crit 17.34% 1.22 0 6 12007.68 9413 18868 8692.07 0 18378 14637 14637 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:7.03
  • if_expr:buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
    Lightning Bolt (_pw) 2824 6.0% 7.0 45.90sec 120854 0 Direct 7.0 99497 199149 120854 21.4% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.00 0.0000 0.0000 845590.77 845590.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.57% 5.50 0 8 99497.43 69330 199588 99572.88 0 140564 546949 546949 0.00%
crit 21.43% 1.50 0 6 199148.95 138661 376595 162083.58 0 362605 298642 298642 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (1842) 0.0% (3.9%) 46.5 6.35sec 11886 10155

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.49 0.00 0.00 0.00 0.00 1.1704 0.0000 0.00 0.00 0.00% 10155.15 10155.15

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [P]:46.49
    Stormstrike (_mh) 1228 2.6% 46.5 6.35sec 7920 0 Direct 46.5 6741 13570 7920 17.3% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.49 46.49 0.00 0.00 0.00 0.0000 0.0000 368193.87 526004.66 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 38.47 20 65 6741.01 5715 11523 6740.49 6119 7609 259294 370430 30.00%
crit 17.26% 8.02 0 20 13570.28 11430 23046 13563.10 0 16881 108900 155575 29.99%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 615 1.3% 46.5 6.35sec 3966 0 Direct 46.5 3371 6782 3966 17.4% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.49 46.49 0.00 0.00 0.00 0.0000 0.0000 184378.07 263403.96 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 38.38 17 60 3370.83 2858 5762 3370.63 3069 3774 129372 184822 30.00%
crit 17.44% 8.11 0 22 6782.32 5715 11523 6776.76 0 8614 55006 78582 29.99%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 807 1.7% 5.7 54.04sec 42486 36473 Direct 5.7 36096 72699 42487 17.5% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.69 5.69 0.00 0.00 0.00 1.1649 0.0000 241850.91 241850.91 0.00% 36472.77 36472.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.54% 4.70 0 8 36095.88 27905 73722 36082.89 0 57047 169601 169601 0.00%
crit 17.46% 0.99 0 5 72698.77 55810 140887 48263.33 0 137135 72250 72250 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [S]:5.69
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (735) 0.0% (1.6%) 1.0 0.00sec 220234 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 735 1.6% 148.7 4.16sec 1481 0 Direct 148.7 1259 2532 1481 17.4% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.70 148.70 0.00 0.00 0.00 0.0000 0.0000 220233.86 314627.83 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.58% 122.79 64 194 1259.39 1063 2143 1259.52 1153 1391 154639 220919 30.00%
crit 17.42% 25.91 8 58 2531.83 2125 4241 2531.83 2238 2905 65595 93709 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
pet - greater_earth_elemental 427 / 89
melee 427 0.2% 39.9 2.24sec 663 434 Direct 39.9 564 1128 663 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.85 39.85 0.00 0.00 0.00 1.5276 0.0000 26412.91 37733.68 30.00% 433.87 433.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 32.88 21 64 564.18 490 953 563.12 490 703 18552 26503 30.00%
crit 17.49% 6.97 0 21 1128.01 980 1765 1124.98 0 1480 7861 11231 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2410 / 707
melee 2410 1.5% 89.5 3.39sec 2364 2101 Direct 89.5 2012 4022 2364 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.55 89.55 0.00 0.00 0.00 1.1252 0.0000 211705.18 302443.69 30.00% 2101.15 2101.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.49% 73.86 3 171 2012.08 1660 3306 2009.55 1660 2444 148623 212324 30.00%
crit 17.51% 15.68 0 45 4022.16 3321 6526 4016.06 0 5648 63082 90120 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2408 / 705
melee 2408 1.5% 89.6 3.41sec 2352 2091 Direct 89.6 2002 4001 2352 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.62 89.62 0.00 0.00 0.00 1.1248 0.0000 210831.23 301195.15 30.00% 2091.35 2091.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.47% 73.91 4 184 2002.04 1660 3306 2000.90 1660 2562 147971 211393 30.00%
crit 17.53% 15.71 0 46 4000.52 3321 6526 3995.99 0 5331 62860 89803 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2418 / 706
melee 2418 1.5% 89.4 3.42sec 2365 2102 Direct 89.4 2015 4023 2365 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.40 89.40 0.00 0.00 0.00 1.1255 0.0000 211446.55 302074.20 30.00% 2101.58 2101.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.54% 73.79 7 174 2014.50 1660 3306 2011.63 1674 2542 148644 212353 30.00%
crit 17.46% 15.61 0 44 4023.09 3321 6611 4018.88 0 5236 62803 89721 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 309.56sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.12 0.00 0.00 0.00 0.00 1.0264 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [U]:1.12
Feral Spirit 10.7 30.02sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.74 0.00 0.00 0.00 0.00 1.1815 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:10.74
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.58sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.47
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 65.9 126.3 4.5sec 1.6sec 3.7sec 81.86% 98.20% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.5s

Stack Uptimes

  • ashen_catalyst_1:30.76%
  • ashen_catalyst_2:16.22%
  • ashen_catalyst_3:11.78%
  • ashen_catalyst_4:9.76%
  • ashen_catalyst_5:6.57%
  • ashen_catalyst_6:3.84%
  • ashen_catalyst_7:2.26%
  • ashen_catalyst_8:0.67%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.0 0.0 48.3sec 48.3sec 14.7sec 29.25% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 300.1s
  • trigger_min/max:14.0s / 300.1s
  • trigger_pct:85.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crackling_surge_1:23.40%
  • crackling_surge_2:5.85%
  • crackling_surge_3:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.5sec 12.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.9s
  • trigger_pct:100.00%
  • duration_min/max:16.1s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.35%
  • crumbling_power_3:0.59%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.67%
  • crumbling_power_7:0.66%
  • crumbling_power_8:0.66%
  • crumbling_power_9:0.65%
  • crumbling_power_10:0.63%
  • crumbling_power_11:0.63%
  • crumbling_power_12:0.63%
  • crumbling_power_13:0.63%
  • crumbling_power_14:0.64%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.73%
  • crumbling_power_17:0.79%
  • crumbling_power_18:0.82%
  • crumbling_power_19:1.00%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 6.3 1.0 44.3sec 37.1sec 10.8sec 22.76% 0.00% 1.0 (1.0) 6.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 314.0s
  • trigger_min/max:1.2s / 314.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.5s

Stack Uptimes

  • elemental_blast_critical_strike_1:22.76%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 6.3 1.1 44.5sec 37.2sec 10.9sec 22.82% 0.00% 1.1 (1.1) 6.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 296.9s
  • trigger_min/max:0.8s / 296.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.8s

Stack Uptimes

  • elemental_blast_haste_1:22.82%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 6.3 1.0 44.2sec 37.1sec 10.8sec 22.83% 0.00% 1.0 (1.0) 6.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 280.2s
  • trigger_min/max:1.6s / 280.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.1s

Stack Uptimes

  • elemental_blast_mastery_1:22.83%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 122.6sec 99.6sec 57.8sec 24.70% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:24.70%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 122.4sec 97.9sec 58.2sec 25.44% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 341.2s

Stack Uptimes

  • elemental_chaos_earth_1:25.44%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.6sec 98.7sec 58.0sec 25.16% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.1s

Stack Uptimes

  • elemental_chaos_fire_1:25.16%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 125.9sec 100.8sec 57.7sec 24.70% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:24.70%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.7sec 302.7sec 27.5sec 13.18% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.2s
  • trigger_min/max:300.0s / 328.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.18%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 0.0 29.2sec 30.0sec 14.7sec 52.59% 0.00% 42.0 (42.0) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 48.7s
  • trigger_min/max:16.1s / 46.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.9s

Stack Uptimes

  • feral_spirit_1:52.59%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 50.0 226.5 6.0sec 1.1sec 4.7sec 78.61% 87.71% 226.5 (487.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 49.8s
  • trigger_min/max:0.0s / 21.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.4s

Stack Uptimes

  • flurry_1:22.03%
  • flurry_2:33.64%
  • flurry_3:22.93%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.6sec 46.5sec 13.0sec 19.47% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 196.6s
  • trigger_min/max:0.2s / 195.1s
  • trigger_pct:98.83%
  • duration_min/max:0.0s / 51.2s

Stack Uptimes

  • forgestorm_ignited_1:19.47%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 39.1 1.6 7.7sec 7.4sec 2.4sec 30.89% 89.78% 1.6 (10.4) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 30.6s
  • trigger_min/max:0.8s / 30.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.1s

Stack Uptimes

  • hailstorm_5:9.88%
  • hailstorm_6:6.04%
  • hailstorm_7:3.67%
  • hailstorm_8:2.25%
  • hailstorm_9:1.37%
  • hailstorm_10:7.69%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.5 5.5 27.8sec 17.7sec 9.9sec 34.83% 89.01% 5.5 (5.5) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 207.4s
  • trigger_min/max:0.0s / 207.4s
  • trigger_pct:4.98%
  • duration_min/max:0.0s / 66.3s

Stack Uptimes

  • hot_hand_1:34.83%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.7 0.0 12.3sec 12.3sec 3.6sec 29.68% 56.10% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 30.0s
  • trigger_min/max:7.7s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.2s

Stack Uptimes

  • ice_strike_1:29.68%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 6.0 0.0 48.2sec 48.2sec 14.7sec 29.28% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 296.9s
  • trigger_min/max:14.0s / 296.9s
  • trigger_pct:85.19%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • icy_edge_1:23.49%
  • icy_edge_2:5.78%
  • icy_edge_3:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 41.5 224.3 7.3sec 2.3sec 6.2sec 85.88% 100.00% 17.2 (35.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.7s / 30.2s
  • trigger_min/max:0.0s / 15.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.3s

Stack Uptimes

  • maelstrom_weapon_1:12.21%
  • maelstrom_weapon_2:13.63%
  • maelstrom_weapon_3:14.15%
  • maelstrom_weapon_4:14.25%
  • maelstrom_weapon_5:9.91%
  • maelstrom_weapon_6:6.62%
  • maelstrom_weapon_7:4.33%
  • maelstrom_weapon_8:2.79%
  • maelstrom_weapon_9:1.74%
  • maelstrom_weapon_10:6.25%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 6.0 0.0 48.4sec 48.4sec 14.7sec 29.19% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 296.6s
  • trigger_min/max:13.1s / 296.6s
  • trigger_pct:84.99%
  • duration_min/max:0.0s / 29.9s

Stack Uptimes

  • molten_weapon_1:23.35%
  • molten_weapon_2:5.83%
  • molten_weapon_4:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Primordial Wave 7.0 0.0 45.7sec 45.7sec 2.0sec 4.61% 38.03% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 51.1s
  • trigger_min/max:45.0s / 51.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.7s

Stack Uptimes

  • primordial_wave_1:4.61%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.2 61.0sec 45.6sec 16.5sec 23.62% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 220.5s
  • trigger_min/max:0.0s / 207.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.8s

Stack Uptimes

  • sophic_devotion_1:23.62%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.2 61.0sec 45.6sec 16.6sec 23.80% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 206.5s
  • trigger_min/max:0.1s / 206.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 86.4s

Stack Uptimes

  • sophic_devotion_oh_1:23.80%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.6sec 45.6sec 32.0sec 38.32% 0.00% 25.6 (25.6) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 309.4s
  • trigger_min/max:0.0s / 202.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 190.9s

Stack Uptimes

  • spiraling_winds_1:2.36%
  • spiraling_winds_2:2.33%
  • spiraling_winds_3:2.32%
  • spiraling_winds_4:2.30%
  • spiraling_winds_5:2.29%
  • spiraling_winds_6:2.27%
  • spiraling_winds_7:2.25%
  • spiraling_winds_8:2.24%
  • spiraling_winds_9:2.22%
  • spiraling_winds_10:17.73%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 7.0 0.0 45.9sec 45.9sec 11.8sec 27.59% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:39.2s / 52.8s
  • trigger_min/max:39.2s / 52.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • splintered_elements_1:27.59%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 28.4 9.5 10.3sec 7.7sec 3.5sec 32.96% 59.28% 9.5 (9.5) 0.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 122.4s
  • trigger_min/max:0.0s / 119.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.9s

Stack Uptimes

  • stormbringer_1:32.96%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.7 10.0 50.0 11.0s 1.1s 128.3s
windfury_totem_extra_attack_oh 26.8 10.0 50.0 10.9s 1.1s 140.9s
Maelstrom Weapon: Feral Spirit 63.0 47.0 81.0 4.8s 0.0s 31.9s
Maelstrom Weapon: Swirling Maelstrom 63.5 46.0 82.0 4.7s 0.8s 21.9s
Maelstrom Weapon: Primordial Wave 70.3 60.0 80.0 45.7s 45.0s 51.1s
Flametongue: Windfury Attack 148.7 82.0 228.0 4.2s 0.0s 56.6s
Stormbringer: Windfury Attack 16.7 4.0 38.0 18.2s 0.0s 196.5s
Maelstrom Weapon: Windfury Attack 29.8 12.0 62.0 11.0s 0.0s 123.5s
Flametongue: main_hand 161.4 111.0 216.0 2.2s 1.1s 18.5s
Hot Hand: main_hand 8.0 0.0 19.0 33.1s 1.1s 295.7s
Maelstrom Weapon: main_hand 32.3 14.0 60.0 9.4s 1.1s 98.5s
Windfury: main_hand 50.4 25.0 84.0 6.2s 1.1s 70.9s
Flametongue: offhand 161.7 112.0 218.0 2.2s 1.1s 19.6s
Hot Hand: offhand 8.0 0.0 20.0 33.1s 1.1s 312.5s
Maelstrom Weapon: offhand 32.3 11.0 54.0 9.4s 1.1s 101.8s
Flametongue: Sundering 5.7 2.0 8.0 54.0s 40.0s 204.5s
Stormbringer: Sundering 0.6 0.0 5.0 114.9s 40.0s 328.9s
Maelstrom Weapon: Sundering 1.1 0.0 6.0 107.5s 40.0s 343.3s
Windfury: Sundering 1.8 0.0 7.0 96.9s 40.0s 329.5s
Flametongue: Lava Lash 66.3 34.0 105.0 4.5s 0.8s 15.6s
Stormbringer: Lava Lash 7.4 0.0 21.0 34.9s 0.8s 301.2s
Maelstrom Weapon: Lava Lash 13.3 0.0 28.0 21.0s 0.8s 244.8s
Flametongue: Ice Strike 24.7 19.0 31.0 12.3s 7.7s 24.2s
Stormbringer: Ice Strike 2.8 0.0 10.0 69.1s 7.7s 323.1s
Maelstrom Weapon: Ice Strike 4.9 0.0 14.0 50.1s 7.7s 322.2s
Windfury: Ice Strike 7.7 1.0 17.0 35.9s 7.7s 287.4s
Flametongue: Stormstrike 46.5 28.0 71.0 6.4s 0.8s 45.7s
Stormbringer: Stormstrike 5.2 0.0 19.0 44.5s 0.8s 301.9s
Maelstrom Weapon: Stormstrike 9.2 0.0 22.0 29.3s 0.8s 297.6s
Windfury: Stormstrike 14.5 2.0 32.0 19.5s 0.8s 182.2s
Flametongue: Stormstrike Off-Hand 46.5 28.0 71.0 6.4s 0.8s 45.7s
Stormbringer: Stormstrike Off-Hand 5.2 0.0 16.0 44.8s 0.8s 313.9s
Maelstrom Weapon: Stormstrike Off-Hand 9.3 0.0 23.0 29.0s 0.8s 287.1s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 23.15% 12.93% 30.58% 0.5s 0.0s 4.7s
Hot Hand 34.83% 8.58% 62.53% 9.9s 0.0s 66.3s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.8550.0011.5177.6101.87113.761
Sundering14.5800.001164.53165.8314.625186.713
Primordial Wave0.8910.0016.1444.3180.00015.016
Lava Lash0.9920.00111.69163.69128.474103.753
Flame Shock23.3410.001259.039180.1860.000307.760
Ice Strike0.6910.00111.60114.2572.17436.325
Frost Shock2.4150.00125.09395.51445.834147.880
Elemental Blast4.3560.00134.82536.3414.883104.297
Stormstrike2.4020.00131.902104.18348.730172.219
Earth Elemental10.5120.01748.6991.1620.00048.699

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana624.16219445.01100.00%351.59259930.9554.22%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 731.48 733.49 259930.7 49397.2 47000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 22.1030393.901375.001374.9980.28
Flame ShockMana 8.836625.12750.0080.74219.76
Frost ShockMana 43.2321614.65500.00499.9976.97
Ice StrikeMana 24.6940740.331650.001650.0114.67
Lava LashMana 66.2926515.72400.00400.01107.39
Lightning BoltMana 18.589292.16500.00499.98126.85
Primordial WaveMana 7.0310548.591500.001500.0084.84
StormstrikeMana 46.4946489.801000.00999.9911.89
SunderingMana 5.6917077.723000.003000.0414.16

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 47149.02
Minimum 41010.11
Maximum 54927.26
Spread ( max - min ) 13917.15
Range [ ( max - min ) / 2 * 100% ] 14.76%
Standard Deviation 1893.3531
5th Percentile 44158.01
95th Percentile 50296.09
( 95th Percentile - 5th Percentile ) 6138.08
Mean Distribution
Standard Deviation 21.8640
95.00% Confidence Interval ( 47106.17 - 47191.87 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6195
0.1 Scale Factor Error with Delta=300 30602
0.05 Scale Factor Error with Delta=300 122408
0.01 Scale Factor Error with Delta=300 3060180
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 47149.02
Minimum 41010.11
Maximum 54927.26
Spread ( max - min ) 13917.15
Range [ ( max - min ) / 2 * 100% ] 14.76%
Standard Deviation 1893.3531
5th Percentile 44158.01
95th Percentile 50296.09
( 95th Percentile - 5th Percentile ) 6138.08
Mean Distribution
Standard Deviation 21.8640
95.00% Confidence Interval ( 47106.17 - 47191.87 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6195
0.1 Scale Factor Error with Delta=300 30602
0.05 Scale Factor Error with Delta=300 122408
0.01 Scale Factor Error with Delta=300 3060180
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 47149.02
Minimum 41010.11
Maximum 54927.26
Spread ( max - min ) 13917.15
Range [ ( max - min ) / 2 * 100% ] 14.76%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 13470261.08
Minimum 9640192.90
Maximum 17683242.63
Spread ( max - min ) 8043049.73
Range [ ( max - min ) / 2 * 100% ] 29.85%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.47 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 10.74 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
G 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
H 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
I 50.72 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
0.00 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
0.00 ice_strike,if=buff.doom_winds_talent.up
0.00 sundering,if=buff.doom_winds_talent.up
J 7.03 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking
K 7.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
L 24.69 ice_strike,if=talent.hailstorm.enabled
M 38.77 frost_shock,if=buff.hailstorm.up
0.00 lava_lash,if=dot.flame_shock.refreshable
0.00 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
0.00 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
N 22.10 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
O 1.66 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
P 46.49 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
Q 15.57 lava_lash
0.00 bag_of_tricks
R 9.93 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
S 5.69 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
T 4.46 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
U 1.12 earth_elemental
V 8.83 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ACDEFBIJIKILIMINPMNPILIMIPIPIRFILIMINIMPRQLMNPSMQPPRLMJFKMIPPNLMPQNMUPPILIRIMIPIRIILFIMINPMJKLMPNQMPRSMLFNMIIPINILMIPIPIOIMLPVTQJFKMPLNMPISTIIPILINMPQPRMVILIFIPINIDEMIJIKLIMINIMIPILFNIMINIMILIPIOMQPSTLPRMJFKIMPLNMPQVNIMILIPPQRMVPLNMPISTFNPJIKILIMNPQMVPLIPIRIFMP

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_fire
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_fire
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_fire
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_fire
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), hot_hand, elemental_chaos_fire
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry, hot_hand, maelstrom_weapon, crumbling_power(20), elemental_chaos_fire
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry, hot_hand, maelstrom_weapon, crumbling_power(20), elemental_chaos_fire
0:00.896 default B potion Fluffy_Pillow 40683.6/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(2), crumbling_power(19), elemental_chaos_fire
0:00.896 single I lava_lash Fluffy_Pillow 40683.6/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(2), crumbling_power(19), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:01.790 single J primordial_wave Fluffy_Pillow 41714.0/50000: 83% mana bloodlust, berserking, flurry(2), feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(2), crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:02.684 single I lava_lash Fluffy_Pillow 41644.4/50000: 83% mana bloodlust, berserking, flurry(3), primordial_wave, feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(10), crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:03.578 single K lightning_bolt Fluffy_Pillow 42674.8/50000: 85% mana bloodlust, berserking, flurry(2), primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(10), crumbling_power(17), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:04.472 single I lava_lash Fluffy_Pillow 43605.2/50000: 87% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, hailstorm(10), crumbling_power(16), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:05.286 single L ice_strike Fluffy_Pillow 44507.6/50000: 89% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(2), hailstorm(10), crumbling_power(15), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:06.100 single I lava_lash Fluffy_Pillow 44160.0/50000: 88% mana bloodlust, berserking, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(10), ice_strike, crumbling_power(14), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:06.912 single M frost_shock Fluffy_Pillow 45059.2/50000: 90% mana bloodlust, berserking, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(10), ice_strike, crumbling_power(13), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:07.726 single I lava_lash Fluffy_Pillow 45861.6/50000: 92% mana bloodlust, berserking, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), crumbling_power(12), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:08.539 single N elemental_blast Fluffy_Pillow 46762.4/50000: 94% mana bloodlust, berserking, splintered_elements, feral_spirit, icy_edge, molten_weapon, stormbringer, maelstrom_weapon(6), crumbling_power(11), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:09.353 single P stormstrike Fluffy_Pillow 46689.8/50000: 93% mana bloodlust, berserking, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(6), crumbling_power(10), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:10.142 single M frost_shock Fluffy_Pillow 46952.2/50000: 94% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(4), hailstorm(6), crumbling_power(9), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:10.932 single N elemental_blast Fluffy_Pillow 47716.2/50000: 95% mana bloodlust, berserking, flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(6), crumbling_power(8), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:11.724 single P stormstrike Fluffy_Pillow 47608.4/50000: 95% mana bloodlust, berserking, elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, hailstorm(6), crumbling_power(7), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:12.513 single I lava_lash Fluffy_Pillow 47870.8/50000: 96% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(6), crumbling_power(6), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:13.382 single L ice_strike Fluffy_Pillow 48861.2/50000: 98% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(6), crumbling_power(5), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:14.251 single I lava_lash Fluffy_Pillow 48601.6/50000: 97% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(6), ice_strike, crumbling_power(4), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:15.119 single M frost_shock Fluffy_Pillow 49590.4/50000: 99% mana bloodlust, flurry, elemental_blast_haste, elemental_blast_mastery, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(6), ice_strike, crumbling_power(3), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:15.987 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), crumbling_power(2), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:16.942 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), crumbling_power, sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:17.897 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, elemental_blast_mastery, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:18.853 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:19.836 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(8), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:20.820 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(8), sophic_devotion_oh, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:21.804 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(2), hailstorm(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:22.788 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:23.771 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:24.755 single I lava_lash Fluffy_Pillow 49924.4/50000: 100% mana bloodlust, flurry, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(8), ice_strike, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:25.741 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), hailstorm(8), ice_strike, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:26.724 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:27.705 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:28.687 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:29.672 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:30.655 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:31.637 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(6), elemental_chaos_fire
0:32.620 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hailstorm(6), elemental_chaos_fire
0:33.603 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hailstorm(6), elemental_chaos_fire
0:34.586 single M frost_shock Fluffy_Pillow 49922.8/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(3), hailstorm(6), ice_strike, elemental_chaos_fire
0:35.572 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(6), elemental_chaos_fire
0:36.554 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon, hailstorm(6), elemental_chaos_fire
0:37.509 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(4), hailstorm(6), elemental_chaos_fire
0:38.463 single M frost_shock Fluffy_Pillow 48526.4/50000: 97% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(5), maelstrom_weapon(4), hailstorm(6), elemental_chaos_fire
0:39.419 single Q lava_lash Fluffy_Pillow 49556.0/50000: 99% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(5), maelstrom_weapon(5), sophic_devotion_oh, elemental_chaos_fire
0:40.376 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon(6), sophic_devotion_oh, elemental_chaos_fire
0:41.616 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), spiraling_winds, sophic_devotion_oh, elemental_chaos_fire
0:42.855 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(7), spiraling_winds, sophic_devotion_oh, elemental_chaos_fire
0:44.096 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(3), hailstorm(7), spiraling_winds(2), sophic_devotion_oh, elemental_chaos_fire
0:45.361 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(3), hailstorm(7), ice_strike, spiraling_winds(2), sophic_devotion_oh, elemental_chaos_fire
0:46.601 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), maelstrom_weapon(4), spiraling_winds(3), sophic_devotion_oh, elemental_chaos_fire
0:48.067 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(6), maelstrom_weapon(10), spiraling_winds(4), sophic_devotion_oh, elemental_chaos_fire
0:49.346 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), maelstrom_weapon(10), spiraling_winds(4), sophic_devotion_oh, elemental_chaos_fire
0:50.625 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), hailstorm(10), spiraling_winds(5), sophic_devotion_oh, elemental_chaos_fire
0:51.786 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), maelstrom_weapon(2), spiraling_winds(6), sophic_devotion_oh, elemental_chaos_fire
0:52.947 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(3), spiraling_winds(6), sophic_devotion_oh, elemental_chaos_fire
0:54.109 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), spiraling_winds(7), sophic_devotion_oh, elemental_chaos_fire
0:55.271 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), spiraling_winds(7), sophic_devotion_oh, elemental_chaos_fire
0:56.433 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), stormbringer, hailstorm(5), spiraling_winds(8), sophic_devotion_oh, elemental_chaos_fire
0:57.594 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), stormbringer, maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(9), sophic_devotion_oh, elemental_chaos_fire
0:58.757 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(4), spiraling_winds(9), sophic_devotion_oh, elemental_chaos_fire
0:59.919 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_fire
1:01.080 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(6), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_air
1:02.207 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hailstorm(6), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_air
1:03.470 single U earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_air
1:04.708 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(2), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_air
1:05.946 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(4), stormbringer, maelstrom_weapon(3), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_air
1:07.185 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(5), hot_hand, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_air
1:08.422 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(4), elemental_chaos_air
1:09.658 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(5), ice_strike, elemental_chaos_air
1:10.896 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(6), ice_strike, elemental_chaos_air
1:12.135 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hot_hand, hailstorm(6), ice_strike, elemental_chaos_air
1:13.373 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(6), ice_strike, elemental_chaos_air
1:14.609 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), elemental_chaos_air
1:15.846 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(4), elemental_chaos_air
1:17.083 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(5), elemental_chaos_air
1:18.320 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(6), elemental_chaos_air
1:19.558 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, hailstorm(6), elemental_chaos_air
1:20.797 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(6), elemental_chaos_air
1:22.035 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(6), elemental_chaos_air
1:23.273 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(6), ice_strike, elemental_chaos_air
1:24.511 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(6), ice_strike, spiraling_winds, sophic_devotion_oh, elemental_chaos_air
1:25.750 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), hailstorm(6), ice_strike, spiraling_winds, sophic_devotion_oh, elemental_chaos_air
1:26.989 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), spiraling_winds(2), sophic_devotion_oh, elemental_chaos_air
1:28.228 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), spiraling_winds(3), sophic_devotion_oh, elemental_chaos_air
1:29.465 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon(2), hailstorm(7), spiraling_winds(3), sophic_devotion_oh, elemental_chaos_air
1:30.703 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), hailstorm(7), spiraling_winds(4), sophic_devotion_oh, elemental_chaos_air
1:31.940 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(5), spiraling_winds(4), sophic_devotion_oh, elemental_chaos_air
1:33.177 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, maelstrom_weapon(10), spiraling_winds(5), sophic_devotion_oh, elemental_chaos_air
1:34.415 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, hailstorm(10), spiraling_winds(6), sophic_devotion_oh, elemental_chaos_air
1:35.540 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, spiraling_winds(7), sophic_devotion_oh, elemental_chaos_air
1:36.664 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), stormbringer, maelstrom_weapon(3), spiraling_winds(7), sophic_devotion, sophic_devotion_oh, elemental_chaos_air
1:37.791 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(7), maelstrom_weapon(5), spiraling_winds(9), sophic_devotion, sophic_devotion_oh, elemental_chaos_air
1:38.916 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, ashen_catalyst(7), maelstrom_weapon(2), hailstorm(5), spiraling_winds(9), sophic_devotion, elemental_chaos_air
1:40.009 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, ashen_catalyst, maelstrom_weapon(3), hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:41.101 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:42.193 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:43.285 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, ashen_catalyst(3), maelstrom_weapon(2), hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:44.376 single M frost_shock Fluffy_Pillow 48745.6/50000: 97% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(4), maelstrom_weapon(3), hailstorm(5), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:45.467 single L ice_strike Fluffy_Pillow 49991.2/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(5), stormbringer, maelstrom_weapon(4), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:46.667 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(6), stormbringer, maelstrom_weapon(6), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:47.868 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:49.103 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), stormbringer, hailstorm(7), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:50.359 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), stormbringer, maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_air
1:51.596 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
1:52.832 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
1:54.068 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
1:55.305 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(7), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
1:56.542 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(7), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
1:57.778 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(7), spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
1:59.014 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(5), hailstorm(7), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_air
2:00.252 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:01.529 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:02.803 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(8), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:04.081 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, hot_hand, stormbringer, maelstrom_weapon(8), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:05.358 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(8), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:06.637 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:07.914 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), hot_hand, hailstorm(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:09.191 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon, hailstorm(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:10.468 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(2), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:11.745 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(3), ice_strike, spiraling_winds(10), elemental_chaos_fire
2:13.024 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(3), ice_strike, spiraling_winds(10), elemental_chaos_fire
2:14.301 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(4), ice_strike, spiraling_winds(10), elemental_chaos_fire
2:15.578 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_fire
2:16.856 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_fire
2:18.217 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(2), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_fire
2:19.495 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(10), spiraling_winds(10), elemental_chaos_fire
2:20.772 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon, hailstorm(10), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:21.934 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:23.097 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:24.258 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
2:25.419 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), stormbringer, hailstorm(8), ice_strike, forgestorm_ignited, elemental_chaos_fire
2:26.546 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), stormbringer, maelstrom_weapon, forgestorm_ignited, elemental_chaos_fire
2:27.673 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_fire
2:28.801 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
2:29.929 single T frost_shock Fluffy_Pillow 48804.8/50000: 98% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
2:31.055 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), forgestorm_ignited, elemental_chaos_fire
2:32.182 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), elemental_chaos_fire
2:33.423 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), elemental_chaos_fire
2:34.665 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(8), elemental_chaos_fire
2:35.943 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), elemental_chaos_fire
2:37.221 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
2:38.499 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
2:39.776 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, stormbringer, hailstorm(10), ice_strike, elemental_chaos_fire
2:41.055 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), elemental_chaos_fire
2:42.333 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_fire
2:43.610 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, stormbringer, maelstrom_weapon(5), elemental_chaos_fire
2:44.889 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(5), elemental_chaos_fire
2:46.167 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), hailstorm(5), elemental_chaos_fire
2:47.444 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), maelstrom_weapon, elemental_chaos_fire
2:48.721 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(4), hot_hand, maelstrom_weapon, elemental_chaos_fire
2:49.998 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), hot_hand, maelstrom_weapon, elemental_chaos_fire
2:51.275 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, maelstrom_weapon(2), ice_strike, elemental_chaos_fire
2:52.554 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), ice_strike, elemental_chaos_fire
2:53.831 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), ice_strike, elemental_chaos_fire
2:55.109 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, hot_hand, maelstrom_weapon(4), ice_strike, elemental_chaos_fire
2:56.387 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, elemental_chaos_fire
2:57.665 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_fire
2:58.942 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(6), ice_strike, elemental_chaos_fire
3:00.220 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon, hailstorm(6), ice_strike, elemental_chaos_fire
3:00.220 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon, hailstorm(6), ice_strike, crumbling_power(20), elemental_chaos_fire
3:00.220 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon, hailstorm(6), ice_strike, crumbling_power(20), elemental_chaos_fire
3:01.380 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), crumbling_power(19), elemental_chaos_fire
3:02.543 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), crumbling_power(18), elemental_chaos_fire
3:03.707 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), crumbling_power(18), elemental_chaos_fire
3:04.870 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge, molten_weapon, stormbringer, maelstrom_weapon(10), crumbling_power(17), elemental_chaos_fire
3:06.031 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, hailstorm(10), crumbling_power(16), elemental_chaos_fire
3:07.089 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(15), elemental_chaos_fire
3:08.146 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, crumbling_power(14), elemental_chaos_fire
3:09.202 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(5), crumbling_power(13), elemental_chaos_fire
3:10.259 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(6), crumbling_power(12), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
3:11.316 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst(2), hot_hand, hailstorm(6), crumbling_power(11), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
3:12.372 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(6), crumbling_power(10), spiraling_winds(2), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:13.535 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(4), crumbling_power(9), spiraling_winds(3), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:14.696 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(4), crumbling_power(8), spiraling_winds(3), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:15.858 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), crumbling_power(7), spiraling_winds(4), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:17.020 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(6), crumbling_power(6), spiraling_winds(4), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:18.297 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(7), ice_strike, crumbling_power(5), spiraling_winds(5), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:19.573 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(9), ice_strike, crumbling_power(4), spiraling_winds(6), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:20.850 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), hot_hand, hailstorm(9), ice_strike, spiraling_winds(6), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:22.128 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(9), ice_strike, spiraling_winds(7), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:23.404 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(4), spiraling_winds(8), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:24.681 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), hot_hand, maelstrom_weapon(6), spiraling_winds(8), sophic_devotion_oh, elemental_chaos_fire
3:25.958 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, hailstorm(6), spiraling_winds(9), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:27.236 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, hailstorm(6), spiraling_winds(9), sophic_devotion, elemental_chaos_fire
3:28.513 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(2), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:29.789 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), hot_hand, maelstrom_weapon(3), spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:31.066 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:32.343 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:33.620 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_fire
3:34.896 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), hot_hand, maelstrom_weapon(10), ice_strike, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
3:36.173 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hailstorm(10), ice_strike, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
3:37.451 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
3:38.728 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon(2), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
3:40.006 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
3:41.281 single T frost_shock Fluffy_Pillow 49040.0/50000: 98% mana ashen_catalyst(2), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
3:42.556 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
3:43.832 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(4), ice_strike, forgestorm_ignited, elemental_chaos_fire
3:45.112 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(6), ice_strike, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:46.389 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), hailstorm(6), ice_strike, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
3:47.666 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(6), maelstrom_weapon, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:48.944 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst(7), maelstrom_weapon(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:50.220 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(7), maelstrom_weapon(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:51.497 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(8), hailstorm(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:52.658 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon, hailstorm(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:53.820 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:54.981 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:56.144 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:57.306 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), stormbringer, hailstorm(5), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:58.467 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), stormbringer, maelstrom_weapon(2), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
3:59.628 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_weapon(4), sophic_devotion, elemental_chaos_fire
4:00.789 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(4), sophic_devotion, elemental_chaos_fire
4:01.951 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(5), elemental_chaos_fire
4:03.112 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), hot_hand, hailstorm(5), elemental_chaos_fire
4:04.390 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, hot_hand, maelstrom_weapon(2), hailstorm(5), elemental_chaos_fire
4:05.667 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(3), elemental_chaos_fire
4:06.945 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(3), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
4:08.267 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), ice_strike, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
4:09.543 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, hot_hand, maelstrom_weapon(4), ice_strike, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
4:10.822 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst, stormbringer, maelstrom_weapon(6), ice_strike, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
4:12.098 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(6), ice_strike, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
4:13.376 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(6), ice_strike, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
4:14.653 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon, hailstorm(6), ice_strike, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
4:15.931 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(3), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
4:17.209 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(3), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
4:18.488 Waiting     1.079 sec 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_fire
4:19.567 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_fire
4:21.001 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(5), maelstrom_weapon(5), ice_strike, sophic_devotion_oh, elemental_chaos_fire
4:22.278 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(6), hailstorm(5), ice_strike, sophic_devotion_oh, elemental_chaos_fire
4:23.556 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(7), maelstrom_weapon, sophic_devotion_oh, elemental_chaos_fire
4:24.854 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(8), maelstrom_weapon, sophic_devotion_oh, elemental_chaos_fire
4:26.131 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_fire
4:27.408 single T frost_shock Fluffy_Pillow 49043.2/50000: 98% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_fire
4:28.684 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon(4), elemental_chaos_fire
4:29.963 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(5), elemental_chaos_fire
4:31.239 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), hailstorm(5), elemental_chaos_fire
4:32.514 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(2), hailstorm(5), elemental_chaos_fire
4:33.944 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(5), hot_hand, maelstrom_weapon(10), hailstorm(5), sophic_devotion_oh, elemental_chaos_fire
4:35.221 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(10), hailstorm(5), sophic_devotion_oh, elemental_chaos_fire
4:36.497 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), sophic_devotion_oh, elemental_chaos_fire
4:37.658 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(10), sophic_devotion_oh, elemental_chaos_fire
4:38.820 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(5), hailstorm(10), ice_strike, sophic_devotion_oh, elemental_chaos_fire
4:39.980 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(10), ice_strike, sophic_devotion_oh, elemental_chaos_fire
4:41.141 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon(7), sophic_devotion_oh, elemental_chaos_fire
4:42.303 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), hailstorm(7), sophic_devotion_oh, elemental_chaos_fire
4:43.431 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon, hailstorm(7), sophic_devotion_oh, elemental_chaos_fire
4:44.558 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, ashen_catalyst, maelstrom_weapon(2), hailstorm(7), sophic_devotion_oh, elemental_chaos_fire
4:45.686 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst, maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_fire
4:46.813 Waiting     1.008 sec 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, ashen_catalyst(2), maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_fire
4:47.821 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_fire
4:49.232 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), stormbringer, maelstrom_weapon(3), elemental_chaos_fire
4:50.474 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(4), hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_fire
4:51.714 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_fire
4:52.990 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(6), ice_strike, elemental_chaos_fire
4:54.268 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), ice_strike, elemental_chaos_fire
4:55.545 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(7), ice_strike, sophic_devotion_oh, elemental_chaos_fire
4:56.823 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(7), ice_strike, sophic_devotion_oh, elemental_chaos_fire
4:58.101 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon(2), hailstorm(7), ice_strike, sophic_devotion_oh, elemental_chaos_fire
4:59.378 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_fire

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.82% 15.82% 1047
Haste 17.79% 17.79% 3025
Versatility 7.11% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 58.70% 58.70% 3843
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery (devotion_of_mastery_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +386 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery (devotion_of_mastery_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant=devotion_of_mastery_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1047
# gear_haste_rating=3025
# gear_mastery_rating=3843
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Gamba : 48106 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
48105.5 48105.5 87.4 / 0.182% 15188.5 / 31.6% 53.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
844.2 841.5 Mana 1.49% 52.2 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Gamba 48106
Ascendance (_dre) 0 (1061) 0.0% (2.2%) 8.3 30.61sec 38163 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.33 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1061 2.2% 8.3 30.61sec 38163 0 Direct 8.3 31985 64218 38163 19.2% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 0.00 0.00 0.00 0.0000 0.0000 317868.51 317868.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 6.73 0 21 31985.00 26454 56262 31919.22 0 42033 215337 215337 0.00%
crit 19.17% 1.60 0 8 64218.26 52908 108440 50532.78 0 102612 102531 102531 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 84 0.2% 3.7 90.40sec 6686 6113 Direct 3.7 6686 0 6686 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0939 0.0000 24958.62 35656.07 30.00% 6112.81 6112.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 6686.39 3838 13614 6701.05 5289 8928 24959 35656 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 7098 14.8% 25.1 11.77sec 84801 72203 Direct 25.1 70082 140598 84837 20.9% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.09 25.08 0.00 0.00 0.00 1.1745 0.0000 2127764.19 2127764.19 0.00% 72203.47 72203.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.08% 19.83 10 30 70082.25 45017 142681 70099.78 56671 82965 1389944 1389944 0.00%
crit 20.92% 5.25 0 14 140598.42 90033 285362 140145.21 0 285362 737820 737820 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [R]:25.09
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 1551 3.2% 30.2 9.80sec 15418 34823 Direct 30.2 2804 5631 3297 17.4% 0.0%
Periodic 186.8 1666 3345 1956 17.3% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.15 30.15 186.85 186.85 28.86 0.4428 1.5557 464890.43 464890.43 0.00% 1529.06 34823.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 24.89 11 42 2803.77 2342 5016 2805.24 2542 3193 69798 69798 0.00%
crit 17.44% 5.26 0 16 5630.53 4685 9886 5610.46 0 8225 29603 29603 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.73% 154.57 105 206 1666.06 1 2984 1666.64 1545 1853 257524 257524 0.00%
crit 17.27% 32.28 11 57 3344.84 12 5892 3346.03 2932 3809 107965 107965 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [N]:1.29
  • if_expr:!ticking
    single
    [Z]:10.25
Flametongue Weapon 0 (1560) 0.0% (3.2%) 1.0 0.00sec 467194 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1560 3.2% 1128.9 0.67sec 414 0 Direct 1128.9 353 707 414 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1128.86 1128.86 0.00 0.00 0.00 0.0000 0.0000 467193.78 467193.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 933.87 627 1292 352.58 290 614 352.76 325 390 329263 329263 0.00%
crit 17.27% 194.99 117 300 707.36 580 1229 707.82 645 788 137930 137930 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1105 2.3% 28.8 7.55sec 11511 0 Direct 28.8 9807 19717 11511 17.2% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.83 28.83 0.00 0.00 0.00 0.0000 0.0000 331804.09 331804.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.81% 23.87 3 65 9807.07 9732 10030 9806.86 9732 10030 234106 234106 0.00%
crit 17.19% 4.95 0 18 19717.26 19463 20059 19345.06 0 20059 97698 97698 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1056 2.2% 16.7 16.79sec 18911 16146 Direct 16.7 16064 32317 18910 17.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.75 16.75 0.00 0.00 0.00 1.1712 0.0000 316671.32 316671.32 0.00% 16145.99 16145.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.49% 13.81 3 27 16064.22 7567 31999 16135.03 11126 19842 221896 221896 0.00%
crit 17.51% 2.93 0 11 32316.77 15135 58606 30699.85 0 56883 94775 94775 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [X]:16.75
Ice Strike 1450 3.0% 20.3 14.85sec 21367 18442 Direct 20.3 18190 36449 21367 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.33 20.33 0.00 0.00 0.00 1.1586 0.0000 434453.75 434453.75 0.00% 18441.88 18441.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 16.79 8 26 18189.82 15041 31174 18197.43 16242 20651 305496 305496 0.00%
crit 17.40% 3.54 0 12 36448.65 30081 61539 35744.75 0 56777 128958 128958 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:2.57
  • if_expr:buff.doom_winds_talent.up
    single
    [T]:17.77
Lava Lash 1379 2.9% 18.6 15.72sec 22220 18943 Direct 18.6 18896 37992 22220 17.4% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.61 18.61 0.00 0.00 0.00 1.1730 0.0000 413498.64 413498.64 0.00% 18943.50 18943.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.59% 15.37 6 24 18896.41 15840 33688 18901.66 16673 21399 290444 290444 0.00%
crit 17.41% 3.24 0 11 37991.71 31680 65712 36822.18 0 59084 123055 123055 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [O]:4.14
  • if_expr:dot.flame_shock.refreshable
    single
    [U]:14.47
Lightning Bolt 2820 5.9% 16.5 17.04sec 51382 43730 Direct 16.5 42321 84915 51382 21.3% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.46 16.46 0.00 0.00 0.00 1.1750 0.0000 845655.28 845655.28 0.00% 43730.23 43730.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.73% 12.96 2 26 42321.22 28471 89878 42356.28 32495 53551 548361 548361 0.00%
crit 21.27% 3.50 0 12 84914.81 56942 174661 82819.67 0 156383 297294 297294 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [S]:4.12
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [V]:12.34
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1425 3.0% 163.1 2.15sec 2619 1541 Direct 163.1 2591 5208 2619 17.3% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 163.09 163.09 0.00 0.00 0.00 1.6997 0.0000 427071.67 610117.94 30.00% 1540.65 1540.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.26% 108.06 41 162 2591.41 2204 4445 2592.55 2402 2841 280026 400048 30.00%
crit 17.31% 28.24 8 55 5207.55 4408 8778 5210.20 4651 6035 147046 210070 30.00%
miss 16.43% 26.79 7 49 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 729 1.5% 166.6 2.09sec 1311 771 Direct 166.6 1298 2608 1311 17.3% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 166.63 166.63 0.00 0.00 0.00 1.6996 0.0000 218464.76 312100.47 30.00% 771.39 771.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.34% 110.54 45 171 1297.60 1102 2223 1298.20 1202 1429 143435 204912 30.00%
crit 17.26% 28.77 9 51 2608.29 2204 4389 2609.52 2323 2939 75030 107189 30.00%
miss 16.40% 27.33 8 50 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7851) 0.0% (16.3%) 91.8 3.26sec 25620 22042

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 91.83 0.00 0.00 0.00 0.00 1.1623 0.0000 0.00 0.00 0.00% 22041.79 22041.79

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:12.92
  • if_expr:buff.doom_winds_talent.up
    single
    [Q]:78.92
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Stormstrike (_mh) 4231 (5235) 8.8% (10.9%) 122.5 3.26sec 12804 0 Direct 122.5 (183.6) 8803 17714 10349 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.53 122.53 0.00 0.00 0.00 0.0000 0.0000 1268050.23 1811546.52 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 101.28 50 157 8803.21 2743 23553 8824.59 7501 10582 891554 1273681 30.00%
crit 17.35% 21.25 5 44 17713.52 5486 45342 17762.16 11870 23558 376496 537866 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 1004 2.1% 61.0 5.50sec 4929 0 Direct 61.0 4929 0 4929 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.03 61.03 0.00 0.00 0.00 0.0000 0.0000 300845.55 300845.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.03 20 111 4929.43 1205 19910 4945.03 3921 6296 300846 300846 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2114 (2616) 4.4% (5.4%) 122.5 3.26sec 6397 0 Direct 122.5 (183.6) 4404 8833 5171 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.53 122.53 0.00 0.00 0.00 0.0000 0.0000 633608.91 905178.67 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.68% 101.31 44 161 4404.09 1372 11777 4414.90 3720 5312 446186 637425 30.00%
crit 17.32% 21.22 5 43 8832.74 2743 22586 8852.44 5848 12173 187423 267754 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 502 1.0% 61.0 5.50sec 2462 0 Direct 61.0 2462 0 2462 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 61.03 61.03 0.00 0.00 0.00 0.0000 0.0000 150280.27 150280.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 61.03 20 111 2462.40 602 9918 2470.19 1947 3235 150280 150280 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1052 2.2% 6.4 49.14sec 49169 42388 Direct 6.4 41896 84170 49170 17.2% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 6.41 0.00 0.00 0.00 1.1600 0.0000 315073.09 315073.09 0.00% 42388.42 42388.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.80% 5.31 1 9 41896.21 26739 86018 41934.29 30856 56562 222281 222281 0.00%
crit 17.20% 1.10 0 6 84170.25 53478 167731 58941.19 0 167731 92792 92792 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [M]:1.63
  • if_expr:buff.doom_winds_talent.up
    single
    [W]:4.78
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7142) 0.0% (14.8%) 1.0 0.00sec 2136861 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7142 14.8% 417.2 2.40sec 5122 0 Direct 417.2 4366 8756 5122 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 417.19 417.19 0.00 0.00 0.00 0.0000 0.0000 2136861.13 3052736.59 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.78% 345.37 202 522 4366.29 1488 12279 4364.54 3686 5139 1507962 2154287 30.00%
crit 17.22% 71.82 30 124 8756.43 2976 25050 8755.92 6929 10916 628899 898450 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 503 1.0% 33.6 8.42sec 4486 3195 Direct 33.6 3700 7433 4486 21.1% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.58 33.58 0.00 0.00 0.00 1.4042 0.0000 150638.41 150638.41 0.00% 3194.81 3194.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.93% 26.50 0 80 3699.56 3148 6270 3698.70 0 4830 98047 98047 0.00%
crit 21.07% 7.08 0 27 7433.16 6297 12411 7362.26 0 10900 52591 52591 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 292 0.6% 39.0 7.30sec 2244 1546 Direct 39.0 1850 3719 2244 21.1% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.97 38.97 0.00 0.00 0.00 1.4521 0.0000 87460.16 87460.16 0.00% 1545.53 1545.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.91% 30.75 0 87 1850.16 1574 3135 1849.87 0 2339 56893 56893 0.00%
crit 21.09% 8.22 0 28 3719.12 3148 6285 3697.23 0 5810 30567 30567 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (7051) 0.0% (14.6%) 27.4 8.58sec 76967 66982

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.41 0.00 0.00 0.00 0.00 1.1491 0.0000 0.00 0.00 0.00% 66982.44 66982.44

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:27.35
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [P]:0.06
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1917 (2264) 4.0% (4.7%) 36.6 8.58sec 18524 0 Direct 36.6 (49.0) 13381 26863 15692 17.1% (12.8%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.57 36.55 0.00 0.00 0.00 0.0000 0.0000 573574.53 573574.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.86% 30.29 0 106 13380.56 3919 35201 13363.08 0 21264 405253 405253 0.00%
crit 17.14% 6.27 0 30 26862.69 7838 64663 26294.42 0 49375 168321 168321 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 347 0.7% 12.5 18.17sec 8335 0 Direct 12.5 8335 0 8335 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.46 12.46 0.00 0.00 0.00 0.0000 0.0000 103841.41 103841.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.46 0 42 8335.16 2064 29746 8244.56 0 16203 103841 103841 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 957 (1131) 2.0% (2.3%) 36.6 8.58sec 9254 0 Direct 36.6 (49.0) 6691 13427 7837 17.0% (12.7%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.57 36.55 0.00 0.00 0.00 0.0000 0.0000 286478.14 286478.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.98% 30.33 0 102 6690.70 1959 17600 6680.23 0 10821 202931 202931 0.00%
crit 17.02% 6.22 0 24 13426.79 3919 35451 13150.43 0 31753 83547 83547 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 174 0.4% 12.5 18.17sec 4168 0 Direct 12.5 4168 0 4168 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.46 12.46 0.00 0.00 0.00 0.0000 0.0000 51927.31 51927.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.46 0 42 4168.18 1031 14481 4121.46 0 7527 51927 51927 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3655 7.6% 27.4 8.60sec 39998 0 Direct 27.4 32994 66179 39999 21.1% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.35 27.35 0.00 0.00 0.00 0.0000 0.0000 1093991.47 1093991.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.89% 21.58 0 67 32993.60 15817 60972 33012.35 0 43693 711921 711921 0.00%
crit 21.11% 5.77 0 24 66178.53 31634 117519 64911.92 0 104428 382070 382070 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 424 / 89
melee 424 0.2% 41.0 2.41sec 648 432 Direct 41.0 552 1104 648 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 0.00 1.5005 0.0000 26552.26 37932.77 30.00% 431.60 431.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 33.92 22 65 552.48 490 927 551.83 490 678 18742 26775 30.00%
crit 17.26% 7.08 0 20 1103.74 980 1742 1102.61 0 1607 7810 11157 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4032 / 2808
melee 4032 5.8% 365.3 1.63sec 2301 2015 Direct 365.3 1963 3922 2301 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 365.30 365.30 0.00 0.00 0.00 1.1420 0.0000 840693.73 1201021.67 30.00% 2015.23 2015.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.72% 302.16 184 451 1962.77 1660 3348 1963.74 1808 2152 593073 847269 30.00%
crit 17.28% 63.14 29 106 3921.81 3321 6696 3924.08 3549 4407 247620 353752 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Gamba
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.2 309.39sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.16 0.00 0.00 0.00 0.00 1.0049 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Y]:1.16
Feral Spirit 14.7 21.45sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.69 0.00 0.00 0.00 0.00 1.1536 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:14.69
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.00
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 6.4 0.0 41.6sec 41.6sec 7.7sec 16.47% 91.37% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 316.6s
  • trigger_min/max:6.0s / 316.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.0s

Stack Uptimes

  • ascendance_1:16.47%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.2s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.73%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.74%
  • crumbling_power_19:1.21%
  • crumbling_power_20:0.06%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds (_talent) 3.7 0.0 90.4sec 90.4sec 7.9sec 9.88% 11.43% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_doom_winds_talent
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.3s
  • trigger_min/max:90.0s / 92.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • doom_winds_talent_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 14.7 0.0 24.1sec 21.0sec 17.5sec 69.62% 100.00% 0.0 (0.0) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.7s / 122.0s
  • trigger_min/max:6.7s / 46.0s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 119.8s

Stack Uptimes

  • earthen_weapon_2:67.46%
  • earthen_weapon_4:2.16%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.4 1.0 37.8sec 32.9sec 10.7sec 26.39% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 262.8s
  • trigger_min/max:1.7s / 262.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.4s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.39%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.4 1.0 37.5sec 32.7sec 10.7sec 26.49% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 279.2s
  • trigger_min/max:1.7s / 279.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.3s

Stack Uptimes

  • elemental_blast_haste_1:26.49%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.4 1.0 37.5sec 32.6sec 10.8sec 26.57% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 259.4s
  • trigger_min/max:1.7s / 259.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.5s

Stack Uptimes

  • elemental_blast_mastery_1:26.57%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.2sec 99.1sec 58.1sec 25.14% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.2s

Stack Uptimes

  • elemental_chaos_air_1:25.15%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.9sec 99.4sec 58.0sec 24.76% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:24.77%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 122.8sec 99.0sec 57.8sec 24.79% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_fire_1:24.79%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.0sec 98.7sec 58.0sec 25.30% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.30%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0sec 0.0sec 29.4sec 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.6s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 11.9 2.8 26.1sec 21.5sec 17.5sec 69.62% 0.00% 59.3 (59.3) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 122.0s
  • trigger_min/max:7.3s / 46.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 119.8s

Stack Uptimes

  • feral_spirit_1:69.62%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.7 387.2 6.9sec 0.7sec 5.8sec 85.18% 90.84% 387.2 (919.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 60.5s
  • trigger_min/max:0.0s / 17.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 59.3s

Stack Uptimes

  • flurry_1:19.89%
  • flurry_2:34.69%
  • flurry_3:30.60%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 121.7 17.7sec 2.1sec 14.6sec 84.88% 100.00% 58.3 (58.3) 16.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 46.8s
  • trigger_min/max:0.0s / 35.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.48%
  • forceful_winds_2:13.78%
  • forceful_winds_3:12.39%
  • forceful_winds_4:10.64%
  • forceful_winds_5:33.58%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.4sec 46.5sec 12.9sec 19.43% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 210.5s
  • trigger_min/max:0.2s / 210.5s
  • trigger_pct:98.85%
  • duration_min/max:0.0s / 47.2s

Stack Uptimes

  • forgestorm_ignited_1:19.43%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 19.2 1.1 15.8sec 14.8sec 7.7sec 49.13% 79.39% 1.1 (1.1) 5.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.3s / 87.9s
  • trigger_min/max:8.3s / 87.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.2s

Stack Uptimes

  • ice_strike_1:49.13%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 23.3 20.2 12.8sec 6.8sec 7.9sec 61.57% 0.00% 20.2 (20.2) 22.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 99.8s
  • trigger_min/max:0.8s / 37.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 96.1s

Stack Uptimes

  • legacy_of_the_frost_witch_1:61.57%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 50.0 419.3 6.0sec 1.2sec 5.2sec 86.88% 100.00% 65.8 (70.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 55.0s
  • trigger_min/max:0.0s / 8.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.5s

Stack Uptimes

  • maelstrom_weapon_1:8.99%
  • maelstrom_weapon_2:10.47%
  • maelstrom_weapon_3:12.20%
  • maelstrom_weapon_4:12.71%
  • maelstrom_weapon_5:8.50%
  • maelstrom_weapon_6:7.22%
  • maelstrom_weapon_7:5.61%
  • maelstrom_weapon_8:4.75%
  • maelstrom_weapon_9:3.80%
  • maelstrom_weapon_10:12.62%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.9sec 45.4sec 16.6sec 23.81% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 207.3s
  • trigger_min/max:0.0s / 207.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.8s

Stack Uptimes

  • sophic_devotion_1:23.81%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.2 61.1sec 45.8sec 16.5sec 23.69% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 216.3s
  • trigger_min/max:0.1s / 216.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 81.1s

Stack Uptimes

  • sophic_devotion_oh_1:23.69%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.8 75.9sec 45.9sec 32.0sec 38.06% 0.00% 25.4 (25.4) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 237.0s
  • trigger_min/max:0.0s / 205.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 178.7s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.28%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.57%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 6.5 1.8 40.7sec 30.8sec 7.1sec 15.49% 100.00% 41.2 (41.2) 6.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 316.6s
  • trigger_min/max:0.8s / 311.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.8s

Stack Uptimes

  • static_accumulation_1:15.49%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 62.9 19.3 4.7sec 3.6sec 1.1sec 23.63% 52.39% 19.3 (19.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 75.3s
  • trigger_min/max:0.0s / 74.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • stormbringer_1:23.63%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.8 36.0 69.0 17.8s 15.0s 59.1s
Windfury-ForcefulWinds: 2 51.4 33.0 69.0 18.0s 0.4s 72.8s
Windfury-ForcefulWinds: 3 49.9 30.0 69.0 18.5s 0.1s 72.5s
Windfury-ForcefulWinds: 4 46.8 27.0 72.0 19.7s 0.1s 92.3s
Windfury-ForcefulWinds: 5 217.3 99.0 378.0 4.6s 0.0s 88.6s
windfury_totem_extra_attack_mh 28.1 5.0 52.0 10.4s 1.2s 128.6s
windfury_totem_extra_attack_oh 29.4 9.0 51.0 9.9s 0.1s 118.9s
Windfury: Unruly Winds 139.1 80.0 207.0 2.4s 0.0s 35.2s
Maelstrom Weapon: Feral Spirit 79.8 53.0 109.0 3.8s 0.0s 31.0s
Maelstrom Weapon: Elemental Assault 119.2 76.0 173.0 2.5s 0.8s 9.6s
Maelstrom Weapon: Static Accumulation 89.0 0.0 244.0 5.3s 1.0s 306.1s
Stormflurry 39.9 11.0 83.0 9.8s 0.8s 124.8s
Flametongue: Windfury Attack 417.2 240.0 621.0 2.4s 0.0s 35.2s
Stormbringer: Windfury Attack 43.9 16.0 79.0 7.7s 0.0s 102.1s
Maelstrom Weapon: Windfury Attack 83.4 41.0 143.0 4.6s 0.0s 75.1s
Flametongue: main_hand 136.3 49.0 199.0 2.6s 1.2s 76.3s
Maelstrom Weapon: main_hand 27.4 10.0 52.0 11.0s 1.2s 144.9s
Windfury: main_hand 52.1 18.0 91.0 6.2s 1.2s 99.5s
Flametongue: Windlash 33.6 0.0 98.0 8.5s 1.2s 305.0s
Maelstrom Weapon: Windlash 6.8 0.0 25.0 32.2s 1.2s 319.9s
Windfury: Windlash 12.6 0.0 44.0 19.6s 1.2s 328.3s
Flametongue: offhand 139.3 60.0 203.0 2.6s 1.2s 75.2s
Maelstrom Weapon: offhand 27.8 7.0 57.0 10.8s 1.2s 148.3s
Flametongue: Windlash Off-Hand 39.0 0.0 110.0 7.3s 0.1s 305.0s
Maelstrom Weapon: Windlash Off-Hand 7.8 0.0 27.0 29.0s 0.3s 326.3s
Flametongue: Sundering 6.4 3.0 9.0 49.1s 40.0s 140.7s
Stormbringer: Sundering 0.7 0.0 4.0 112.6s 40.0s 321.5s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 104.3s 40.0s 344.2s
Windfury: Sundering 3.1 0.0 8.0 87.9s 40.0s 352.9s
Flametongue: Windstrike 36.6 0.0 123.0 8.6s 0.8s 306.5s
Stormbringer: Windstrike 3.8 0.0 20.0 45.4s 0.8s 338.6s
Maelstrom Weapon: Windstrike 7.3 0.0 27.0 30.5s 0.8s 326.6s
Windfury: Windstrike 14.0 0.0 54.0 18.7s 0.8s 322.4s
Flametongue: Windstrike Off-Hand 36.6 0.0 123.0 8.6s 0.8s 306.5s
Stormbringer: Windstrike Off-Hand 3.8 0.0 18.0 45.6s 0.8s 327.1s
Maelstrom Weapon: Windstrike Off-Hand 7.3 0.0 27.0 30.7s 0.8s 325.7s
Flametongue: Lava Lash 18.6 11.0 26.0 15.7s 8.4s 74.1s
Stormbringer: Lava Lash 2.0 0.0 9.0 77.4s 8.5s 334.0s
Maelstrom Weapon: Lava Lash 3.7 0.0 11.0 59.1s 8.6s 329.8s
Flametongue: Ice Strike 20.3 11.0 28.0 14.8s 8.3s 87.9s
Stormbringer: Ice Strike 2.1 0.0 9.0 77.1s 8.3s 341.0s
Maelstrom Weapon: Ice Strike 4.1 0.0 12.0 57.2s 8.3s 332.6s
Windfury: Ice Strike 8.0 1.0 18.0 37.2s 8.3s 343.8s
Flametongue: Stormstrike 122.5 57.0 193.0 3.3s 0.8s 77.8s
Stormbringer: Stormstrike 12.9 2.0 31.0 22.2s 0.8s 255.0s
Maelstrom Weapon: Stormstrike 24.4 8.0 50.0 12.7s 0.8s 159.0s
Windfury: Stormstrike 49.3 23.0 91.0 7.1s 0.8s 118.7s
Flametongue: Stormstrike Off-Hand 122.5 57.0 193.0 3.3s 0.8s 77.8s
Stormbringer: Stormstrike Off-Hand 12.9 1.0 30.0 22.1s 0.8s 239.3s
Maelstrom Weapon: Stormstrike Off-Hand 24.4 6.0 47.0 12.7s 0.8s 155.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 26.34% 13.65% 47.95% 0.8s 0.0s 46.0s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7910.0011.48610.2251.90419.637
Doom Winds0.5280.0012.3101.1210.0004.978
Sundering9.5430.001100.71749.1342.046147.479
Windstrike1.0510.0013.93428.5470.00086.288
Lava Lash4.0760.00164.75169.85223.867154.640
Flame Shock20.9960.001236.115219.27270.071317.716
Ice Strike3.3750.00175.69062.76713.465141.556
Frost Shock12.4480.001187.622189.88156.143297.501
Elemental Blast3.9560.00151.0983.2180.00058.439
Stormstrike1.0490.0014.95591.77344.517148.552
Earth Elemental9.7210.01147.9151.4540.00047.915

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Gamba
mana_regenMana669.70252457.88100.00%376.97226936.4247.34%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 841.52 844.19 226939.3 49198.1 41569.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Gamba
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 25.0934500.381375.001374.9961.67
Flame ShockMana 11.548657.45750.00287.1353.70
Frost ShockMana 16.758372.88500.00500.0037.82
Ice StrikeMana 20.3333549.491650.001650.0012.95
Lava LashMana 18.617443.75400.00400.0055.55
Lightning BoltMana 16.468229.17500.00500.00102.76
StormstrikeMana 122.53122534.061000.001334.3019.20
SunderingMana 6.4119223.043000.002999.8916.39

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Gamba Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Gamba Damage Per Second
Count 7499
Mean 48105.51
Minimum 37521.26
Maximum 71168.48
Spread ( max - min ) 33647.22
Range [ ( max - min ) / 2 * 100% ] 34.97%
Standard Deviation 3860.2156
5th Percentile 42179.10
95th Percentile 54867.60
( 95th Percentile - 5th Percentile ) 12688.49
Mean Distribution
Standard Deviation 44.5769
95.00% Confidence Interval ( 48018.14 - 48192.88 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 248
0.1% Error 24737
0.1 Scale Factor Error with Delta=300 127206
0.05 Scale Factor Error with Delta=300 508824
0.01 Scale Factor Error with Delta=300 12720577
Priority Target DPS
PR_Shaman_Enhancement_Gamba Priority Target Damage Per Second
Count 7499
Mean 48105.51
Minimum 37521.26
Maximum 71168.48
Spread ( max - min ) 33647.22
Range [ ( max - min ) / 2 * 100% ] 34.97%
Standard Deviation 3860.2156
5th Percentile 42179.10
95th Percentile 54867.60
( 95th Percentile - 5th Percentile ) 12688.49
Mean Distribution
Standard Deviation 44.5769
95.00% Confidence Interval ( 48018.14 - 48192.88 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 248
0.1% Error 24737
0.1 Scale Factor Error with Delta=300 127206
0.05 Scale Factor Error with Delta=300 508824
0.01 Scale Factor Error with Delta=300 12720577
DPS(e)
PR_Shaman_Enhancement_Gamba Damage Per Second (Effective)
Count 7499
Mean 48105.51
Minimum 37521.26
Maximum 71168.48
Spread ( max - min ) 33647.22
Range [ ( max - min ) / 2 * 100% ] 34.97%
Damage
PR_Shaman_Enhancement_Gamba Damage
Count 7499
Mean 13542925.63
Minimum 8681677.05
Maximum 19601421.00
Spread ( max - min ) 10919743.95
Range [ ( max - min ) / 2 * 100% ] 40.32%
DTPS
PR_Shaman_Enhancement_Gamba Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Gamba Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Gamba Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Gamba Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Gamba Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Gamba Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_GambaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Gamba Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.00 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 14.69 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
G 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 27.35 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
K 12.92 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
L 2.57 ice_strike,if=buff.doom_winds_talent.up
M 1.63 sundering,if=buff.doom_winds_talent.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
N 1.29 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 frost_shock,if=buff.hailstorm.up
O 4.14 lava_lash,if=dot.flame_shock.refreshable
P 0.06 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
Q 78.92 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 25.09 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
S 4.12 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
0.00 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
T 17.77 ice_strike
U 14.47 lava_lash
0.00 bag_of_tricks
V 12.34 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 4.78 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
X 16.75 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Y 1.16 earth_elemental
Z 10.25 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGKKLMNRKUXRYQQQTVQUVXQZXTQFQRQURQXTZVQXZUQQRQTWXZQUVQFXTZQRXUQQQRQJJJJFTRQUVQXVQWTGKRKKUKVQFJJJRQQQTURQXVQFQXTURQQVQWQXTURQQXZVQTURFQXVZVQTQJRJUSQFVTWQQRDEQGUKKKKKKQFRQTQUQRQQVQXTQQRQJFJJOQSQTWXZQRUXZQTQQFQQRQUXTRQQVXZQJJFJQQRQQTBRGKKMOKFQQQJRJTSQOXZRQFXT

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 2 augmentation PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_frost
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_frost
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_frost
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), forceful_winds, elemental_chaos_frost
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), forceful_winds, maelstrom_weapon, crumbling_power(20), elemental_chaos_frost
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry(2), forceful_winds, maelstrom_weapon, crumbling_power(20), elemental_chaos_frost
0:00.867 default G doom_winds Fluffy_Pillow 40637.2/50000: 81% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), crumbling_power(19), elemental_chaos_frost
0:01.734 single K stormstrike Fluffy_Pillow 42024.4/50000: 84% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), doom_winds_talent, crumbling_power(19), elemental_chaos_frost
0:02.602 single K stormstrike Fluffy_Pillow 42413.2/50000: 85% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds_talent, crumbling_power(18), elemental_chaos_frost
0:03.470 single L ice_strike Fluffy_Pillow 42802.0/50000: 86% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), doom_winds_talent, crumbling_power(17), elemental_chaos_frost
0:04.337 single M sundering Fluffy_Pillow 42539.2/50000: 85% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), doom_winds_talent, ice_strike, crumbling_power(16), elemental_chaos_frost
0:05.204 single N flame_shock Fluffy_Pillow 40926.4/50000: 82% mana bloodlust, berserking, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), doom_winds_talent, ice_strike, crumbling_power(15), forgestorm_ignited, elemental_chaos_frost
0:06.071 single R elemental_blast Fluffy_Pillow 41563.6/50000: 83% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(14), forgestorm_ignited, elemental_chaos_frost
0:06.938 single K stormstrike Fluffy_Pillow 41575.8/50000: 83% mana bloodlust, berserking, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), forgestorm_ignited, elemental_chaos_frost
0:07.779 single U lava_lash Fluffy_Pillow 41921.4/50000: 84% mana bloodlust, berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), forgestorm_ignited, elemental_chaos_frost
0:08.621 single X frost_shock Fluffy_Pillow 42868.6/50000: 86% mana bloodlust, berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), forgestorm_ignited, elemental_chaos_frost
0:09.464 single R elemental_blast Fluffy_Pillow 43717.4/50000: 87% mana bloodlust, berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, crumbling_power(10), forgestorm_ignited, elemental_chaos_frost
0:10.307 single Y earth_elemental Fluffy_Pillow 43691.2/50000: 87% mana bloodlust, berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(9), forgestorm_ignited, elemental_chaos_frost
0:11.149 single Q stormstrike Fluffy_Pillow 45038.4/50000: 90% mana bloodlust, berserking, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), crumbling_power(8), forgestorm_ignited, elemental_chaos_frost
0:11.991 single Q stormstrike Fluffy_Pillow 45385.6/50000: 91% mana bloodlust, berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, crumbling_power(7), forgestorm_ignited, elemental_chaos_frost
0:12.833 single Q stormstrike Fluffy_Pillow 44732.8/50000: 89% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), crumbling_power(6), spiraling_winds, forgestorm_ignited, elemental_chaos_frost
0:13.761 single T ice_strike Fluffy_Pillow 45217.6/50000: 90% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), crumbling_power(5), spiraling_winds, forgestorm_ignited, elemental_chaos_frost
0:14.687 single V lightning_bolt Fluffy_Pillow 45049.2/50000: 90% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, crumbling_power(4), spiraling_winds(2), forgestorm_ignited, elemental_chaos_frost
0:15.613 single Q stormstrike Fluffy_Pillow 46030.8/50000: 92% mana bloodlust, elemental_blast_haste, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power(3), spiraling_winds(2), forgestorm_ignited, elemental_chaos_frost
0:16.538 single U lava_lash Fluffy_Pillow 46510.8/50000: 93% mana bloodlust, elemental_blast_haste, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(2), spiraling_winds(3), elemental_chaos_frost
0:17.503 single V lightning_bolt Fluffy_Pillow 47654.8/50000: 95% mana bloodlust, flurry(2), elemental_blast_haste, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, crumbling_power, spiraling_winds(4), elemental_chaos_frost
0:18.428 single X frost_shock Fluffy_Pillow 48634.8/50000: 97% mana bloodlust, flurry, elemental_blast_haste, ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_frost
0:19.352 single Q stormstrike Fluffy_Pillow 49613.2/50000: 99% mana bloodlust, flurry(2), elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_frost
0:20.277 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), forceful_winds, maelstrom_weapon(3), spiraling_winds(5), elemental_chaos_frost
0:21.231 Waiting     0.713 sec 50000.0/50000: 100% mana bloodlust, flurry, forceful_winds, maelstrom_weapon(3), spiraling_winds(5), elemental_chaos_frost
0:21.944 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, forceful_winds(2), maelstrom_weapon(4), spiraling_winds(6), elemental_chaos_frost
0:23.147 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, forceful_winds(2), maelstrom_weapon(4), spiraling_winds(6), elemental_chaos_frost
0:24.102 single Q stormstrike Fluffy_Pillow 49878.0/50000: 100% mana bloodlust, forceful_winds(2), maelstrom_weapon(4), ice_strike, spiraling_winds(7), elemental_chaos_frost
0:25.055 default F feral_spirit Fluffy_Pillow 48402.8/50000: 97% mana bloodlust, flurry(3), forceful_winds(3), stormbringer, maelstrom_weapon(8), ice_strike, spiraling_winds(7), elemental_chaos_frost
0:26.009 single Q stormstrike Fluffy_Pillow 49929.2/50000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, spiraling_winds(8), elemental_chaos_frost
0:26.963 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(8), elemental_chaos_frost
0:27.915 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_frost
0:28.869 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_frost
0:29.823 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:31.026 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:31.980 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:32.930 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:33.885 single Z flame_shock Fluffy_Pillow 49878.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:34.838 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:35.792 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), ice_strike, spiraling_winds(10), elemental_chaos_frost
0:36.747 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, spiraling_winds(10), elemental_chaos_frost
0:37.700 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_frost
0:38.653 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_frost
0:39.606 Waiting     0.933 sec 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), spiraling_winds(10), elemental_chaos_frost
0:40.539 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, maelstrom_weapon(4), spiraling_winds(10), elemental_chaos_frost
0:41.941 single Q stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_frost
0:43.180 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(8), spiraling_winds(10), elemental_chaos_frost
0:44.418 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:45.657 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:46.896 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:48.136 single X frost_shock Fluffy_Pillow 48984.0/50000: 98% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
0:49.373 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, spiraling_winds(10), elemental_chaos_frost
0:50.612 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, elemental_chaos_frost
0:51.850 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(4), elemental_chaos_frost
0:53.089 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_frost
0:54.326 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
0:55.565 default F feral_spirit Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
0:56.804 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
0:58.042 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
0:59.280 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, forgestorm_ignited, elemental_chaos_frost
1:00.519 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, forgestorm_ignited, elemental_chaos_fire
1:01.757 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), ice_strike, forgestorm_ignited, elemental_chaos_fire
1:02.995 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, forgestorm_ignited, elemental_chaos_fire
1:04.197 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, elemental_chaos_fire
1:05.398 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(3), elemental_chaos_fire
1:06.600 single Q stormstrike Fluffy_Pillow 48923.2/50000: 98% mana flurry(3), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), elemental_chaos_fire
1:07.804 single Q stormstrike Fluffy_Pillow 48849.6/50000: 98% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(9), elemental_chaos_fire
1:09.005 single R elemental_blast Fluffy_Pillow 49771.2/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_fire
1:10.208 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
1:11.411 single J windstrike Fluffy_Pillow 49924.8/50000: 100% mana ascendance, elemental_blast_haste, stormbringer, maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
1:12.614 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_haste, maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
1:13.816 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
1:15.016 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
1:16.220 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
1:17.421 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_fire
1:18.623 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:19.825 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:21.026 single U lava_lash Fluffy_Pillow 49921.6/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:22.229 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:23.429 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:24.632 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, elemental_chaos_fire
1:25.833 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_fire
1:27.037 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
1:28.239 single W sundering Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
1:29.440 single T ice_strike Fluffy_Pillow 48844.8/50000: 98% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_fire
1:30.679 default G doom_winds Fluffy_Pillow 49177.2/50000: 98% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:32.105 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, stormbringer, maelstrom_weapon(5), doom_winds_talent, ice_strike, elemental_chaos_fire
1:33.343 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(4), maelstrom_weapon(9), doom_winds_talent, ice_strike, elemental_chaos_fire
1:34.580 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:35.817 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(2), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:37.055 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(6), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
1:38.294 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(7), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
1:39.532 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(9), ice_strike, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:40.772 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:42.011 default F feral_spirit Fluffy_Pillow 49982.4/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:43.249 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:44.487 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:45.727 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:46.966 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:48.205 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:49.445 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:50.685 single Q stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:51.924 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:53.161 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), ice_strike, spiraling_winds, forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:54.400 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(2), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:55.639 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_fire
1:56.877 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion, elemental_chaos_fire
1:58.115 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, elemental_chaos_fire
1:59.353 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(4), legacy_of_the_frost_witch, spiraling_winds(4), sophic_devotion, elemental_chaos_fire
2:00.592 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, elemental_chaos_earth
2:01.829 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion, elemental_chaos_earth
2:03.068 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(6), sophic_devotion, elemental_chaos_earth
2:04.308 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(7), sophic_devotion, elemental_chaos_earth
2:05.547 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(7), sophic_devotion, elemental_chaos_earth
2:06.785 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), ice_strike, spiraling_winds(8), sophic_devotion, elemental_chaos_earth
2:08.024 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, spiraling_winds(9), sophic_devotion, elemental_chaos_earth
2:09.228 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(9), sophic_devotion, elemental_chaos_earth
2:10.429 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
2:11.631 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
2:12.834 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
2:14.036 single Q stormstrike Fluffy_Pillow 48923.2/50000: 98% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
2:15.242 single X frost_shock Fluffy_Pillow 49852.8/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, elemental_chaos_earth
2:16.445 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(5), spiraling_winds(10), sophic_devotion, elemental_chaos_earth
2:17.648 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(6), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:18.884 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(5), maelstrom_weapon(6), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:20.124 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:21.363 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:22.600 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
2:23.839 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
2:25.079 Waiting     0.209 sec 50000.0/50000: 100% mana elemental_blast_mastery, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_earth
2:25.288 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(5), sophic_devotion_oh, elemental_chaos_earth
2:26.525 Waiting     0.789 sec 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, sophic_devotion_oh, elemental_chaos_earth
2:27.314 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, maelstrom_weapon, sophic_devotion_oh, elemental_chaos_earth
2:28.773 single T ice_strike Fluffy_Pillow 49980.8/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_earth
2:30.015 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, maelstrom_weapon(4), ice_strike, sophic_devotion_oh, elemental_chaos_earth
2:31.253 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(5), ice_strike, sophic_devotion_oh, elemental_chaos_earth
2:32.492 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:33.830 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:35.067 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:36.304 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_earth
2:37.541 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_earth
2:38.778 Waiting     0.199 sec 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_earth
2:38.977 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_earth
2:40.215 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
2:41.454 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth
2:42.693 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:43.933 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:45.171 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, ice_strike, elemental_chaos_earth
2:46.409 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:47.647 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
2:48.887 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
2:50.123 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
2:51.362 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
2:52.601 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
2:53.842 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
2:55.080 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, sophic_devotion, elemental_chaos_earth
2:56.317 single Q stormstrike Fluffy_Pillow 48979.2/50000: 98% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, sophic_devotion, elemental_chaos_earth
2:57.556 single Q stormstrike Fluffy_Pillow 49961.6/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_earth
2:58.794 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(7), ice_strike, sophic_devotion, elemental_chaos_earth
3:00.031 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
3:00.031 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(20), sophic_devotion, elemental_chaos_earth
3:00.031 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(20), sophic_devotion, elemental_chaos_earth
3:01.124 default G doom_winds Fluffy_Pillow 49748.8/50000: 99% mana berserking, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(19), sophic_devotion, elemental_chaos_earth
3:02.218 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), sophic_devotion, elemental_chaos_earth
3:03.313 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(18), sophic_devotion, elemental_chaos_earth
3:04.404 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds_talent, ice_strike, crumbling_power(17), sophic_devotion, elemental_chaos_earth
3:05.498 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(16), spiraling_winds, sophic_devotion, elemental_chaos_earth
3:06.591 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds_talent, crumbling_power(15), spiraling_winds(2), sophic_devotion, elemental_chaos_earth
3:07.685 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds_talent, crumbling_power(14), spiraling_winds(2), sophic_devotion, elemental_chaos_earth
3:08.778 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds_talent, crumbling_power(13), spiraling_winds(3), sophic_devotion, elemental_chaos_earth
3:09.873 single Q stormstrike Fluffy_Pillow 48752.0/50000: 98% mana berserking, flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), crumbling_power(12), spiraling_winds(3), sophic_devotion, elemental_chaos_earth
3:10.998 default F feral_spirit Fluffy_Pillow 49552.0/50000: 99% mana berserking, flurry(2), forceful_winds(5), maelstrom_weapon(10), crumbling_power(11), spiraling_winds(4), sophic_devotion, elemental_chaos_earth
3:12.125 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), crumbling_power(10), spiraling_winds(4), forgestorm_ignited, sophic_devotion, elemental_chaos_earth
3:13.363 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(5), forgestorm_ignited, elemental_chaos_earth
3:14.601 single T ice_strike Fluffy_Pillow 49980.8/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth
3:15.840 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth
3:17.076 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
3:18.317 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, crumbling_power(5), spiraling_winds(7), forgestorm_ignited, elemental_chaos_earth
3:19.556 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(10), ice_strike, crumbling_power(4), spiraling_winds(8), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
3:20.794 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
3:21.996 single Q stormstrike Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
3:23.201 single V lightning_bolt Fluffy_Pillow 49851.2/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
3:24.403 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion_oh, elemental_chaos_earth
3:25.606 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion_oh, elemental_chaos_earth
3:26.808 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(4), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:28.011 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:29.213 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:30.418 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(7), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:31.654 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:32.892 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:34.132 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, forceful_winds(4), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:35.371 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:36.609 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:37.848 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:39.088 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:40.327 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
3:41.566 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
3:42.804 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
3:44.042 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_earth
3:45.280 single X frost_shock Fluffy_Pillow 48980.8/50000: 98% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_earth
3:46.519 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(2), elemental_chaos_earth
3:47.756 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(3), elemental_chaos_earth
3:48.995 single R elemental_blast Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(3), elemental_chaos_earth
3:50.231 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, maelstrom_weapon, spiraling_winds(4), elemental_chaos_earth
3:51.433 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, maelstrom_weapon(2), spiraling_winds(5), elemental_chaos_earth
3:52.636 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(2), spiraling_winds(5), elemental_chaos_earth
3:53.838 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(2), spiraling_winds(6), elemental_chaos_earth
3:55.040 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(4), spiraling_winds(6), elemental_chaos_earth
3:56.243 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(7), elemental_chaos_earth
3:57.446 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(7), ice_strike, spiraling_winds(8), elemental_chaos_earth
3:58.648 default F feral_spirit Fluffy_Pillow 48923.2/50000: 98% mana flurry, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(8), elemental_chaos_earth
3:59.851 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(9), elemental_chaos_earth
4:01.091 single Q stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(9), elemental_chaos_earth
4:02.329 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, spiraling_winds(10), elemental_chaos_earth
4:03.571 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:04.808 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:06.047 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:07.286 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
4:08.525 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_earth
4:09.764 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:11.001 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:12.239 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:13.475 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:14.713 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_earth
4:15.951 Waiting     1.018 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_earth
4:16.969 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(2), stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_earth
4:18.207 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(6), static_accumulation, forgestorm_ignited, elemental_chaos_earth
4:19.446 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, forceful_winds(3), maelstrom_weapon(7), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:20.685 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds(3), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:21.923 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:23.161 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:24.400 single Q stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:25.640 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_chaos_earth
4:26.877 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_earth
4:28.080 single Q stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_chaos_earth
4:29.281 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, elemental_chaos_earth
4:30.485 default B potion Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:30.485 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:31.685 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:32.886 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(2), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:34.091 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:35.294 single M sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:36.498 single O lava_lash Fluffy_Pillow 48926.4/50000: 98% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(8), doom_winds_talent, ice_strike, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:37.701 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(9), doom_winds_talent, ice_strike, spiraling_winds, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:38.903 default F feral_spirit Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, spiraling_winds(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:40.107 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, spiraling_winds(2), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:41.310 single Q stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:42.549 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:43.790 single J windstrike Fluffy_Pillow 49985.6/50000: 100% mana ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, spiraling_winds(4), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:45.029 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(9), static_accumulation, spiraling_winds(5), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:46.269 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:47.506 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:48.743 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:49.982 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:51.220 single O lava_lash Fluffy_Pillow 49980.8/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:52.460 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:53.698 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:54.937 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(6), spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:56.176 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:57.414 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:58.653 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:59.889 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 19.25% 15.63% 1013
Haste 21.51% 21.51% 3656
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.07% 52.07% 3246
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Gamba"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Phys : 46582 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
46582.3 46582.3 49.8 / 0.107% 8546.5 / 18.3% 51.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
848.5 845.6 Mana 1.91% 52.1 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Phys 46582
Ascendance 0 (352) 0.0% (0.7%) 2.0 180.42sec 52091 48143

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0825 0.0000 0.00 0.00 0.00% 48142.85 48142.85

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [G]:2.00
  • if_expr:(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
    Ascendance (_damage) 352 0.7% 2.0 180.42sec 52091 0 Direct 2.0 43789 87954 52088 18.8% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 104181.12 104181.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.20% 1.62 0 2 43789.48 38272 56262 42400.76 0 56262 71118 71118 0.00%
crit 18.80% 0.38 0 2 87953.66 76545 110886 30260.64 0 110886 33063 33063 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 82 0.2% 3.7 90.47sec 6579 6015 Direct 3.7 6579 0 6579 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0939 0.0000 24491.74 34989.09 30.00% 6014.67 6014.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.72 3 4 6579.11 3838 10609 6600.66 5346 8276 24492 34989 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.72
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6668 14.4% 24.7 11.69sec 80861 68194 Direct 24.7 66830 134301 80891 20.8% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.75 24.74 0.00 0.00 0.00 1.1858 0.0000 2001161.58 2001161.58 0.00% 68194.29 68194.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.16% 19.58 10 30 66830.27 45017 135283 66825.55 55321 80069 1308761 1308761 0.00%
crit 20.84% 5.16 0 15 134301.05 90033 263178 133651.01 0 216978 692400 692400 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [S]:24.75
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 1550 3.3% 32.9 8.84sec 14155 28706 Direct 32.9 2774 5575 3260 17.4% 0.0%
Periodic 183.1 1665 3343 1955 17.3% 0.0% 95.5%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.86 32.86 183.08 183.08 31.70 0.4931 1.5646 465128.03 465128.03 0.00% 1536.85 28706.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 27.15 14 44 2773.89 2342 5016 2773.19 2521 3092 75315 75315 0.00%
crit 17.37% 5.71 0 17 5575.03 4685 9300 5549.73 0 8356 31822 31822 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.71% 151.42 108 202 1665.24 1 2984 1664.92 1543 1839 252158 252158 0.00%
crit 17.29% 31.66 11 61 3342.81 15 5892 3342.47 2883 3838 105833 105833 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [O]:1.16
  • if_expr:!ticking
    single
    [b]:12.62
Flametongue Weapon 0 (1524) 0.0% (3.3%) 1.0 0.00sec 456424 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1524 3.3% 1084.1 0.69sec 421 0 Direct 1084.1 359 719 421 17.2% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1084.11 1084.11 0.00 0.00 0.00 0.0000 0.0000 456423.90 456423.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.77% 897.32 613 1217 358.91 290 614 359.04 334 394 322058 322058 0.00%
crit 17.23% 186.79 109 275 719.34 580 1229 719.66 663 799 134366 134366 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1104 2.4% 28.7 7.64sec 11526 0 Direct 28.7 9808 19722 11526 17.3% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.73 28.73 0.00 0.00 0.00 0.0000 0.0000 331108.08 331108.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 23.75 2 78 9807.92 9732 10030 9807.41 9732 10030 232922 232922 0.00%
crit 17.33% 4.98 0 20 19721.91 19463 20059 19339.64 0 20059 98186 98186 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1225 2.6% 20.0 13.80sec 18398 15475 Direct 20.0 15650 31469 18399 17.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.01 20.01 0.00 0.00 0.00 1.1889 0.0000 368142.59 368142.59 0.00% 15475.33 15475.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 16.53 5 30 15649.98 7567 31940 15681.55 12381 19100 258739 258739 0.00%
crit 17.37% 3.48 0 12 31469.19 15135 61884 30564.15 0 47682 109404 109404 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [Z]:20.01
Ice Strike 1501 3.2% 21.2 14.14sec 21244 18181 Direct 21.2 18060 36271 21244 17.5% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.20 21.20 0.00 0.00 0.00 1.1685 0.0000 450409.70 450409.70 0.00% 18181.48 18181.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 17.49 8 26 18059.73 15041 30827 18053.98 15935 20696 315932 315932 0.00%
crit 17.49% 3.71 0 12 36270.78 30081 61655 35502.01 0 56177 134478 134478 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:2.39
  • if_expr:buff.doom_winds_talent.up
    single
    [V]:18.81
Lava Lash 1397 3.0% 19.1 14.97sec 22001 18557 Direct 19.1 18707 37563 22001 17.5% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.08 19.08 0.00 0.00 0.00 1.1856 0.0000 419721.03 419721.03 0.00% 18556.95 18556.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.53% 15.74 7 25 18706.63 15840 33688 18698.57 16789 20804 294520 294520 0.00%
crit 17.47% 3.33 0 12 37562.82 31680 63218 36349.70 0 55522 125201 125201 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [P]:2.56
  • if_expr:dot.flame_shock.refreshable
    single
    [W]:16.52
Lightning Bolt 3030 6.5% 18.1 15.38sec 50237 42549 Direct 18.1 41317 82854 50238 21.5% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.12 18.12 0.00 0.00 0.00 1.1807 0.0000 910465.03 910465.03 0.00% 42549.07 42549.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.52% 14.23 5 25 41317.40 28471 87247 41319.99 32816 51947 587990 587990 0.00%
crit 21.48% 3.89 0 12 82854.44 56942 168031 81339.95 0 150001 322475 322475 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [T]:4.08
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [X]:14.04
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1465 3.2% 172.0 1.93sec 2558 1437 Direct 172.0 2530 5084 2558 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 172.04 172.04 0.00 0.00 0.00 1.7802 0.0000 440076.64 628696.94 30.00% 1436.92 1436.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.23% 113.94 74 161 2529.69 2204 4389 2528.46 2323 2765 288239 411780 30.00%
crit 17.36% 29.86 12 54 5084.16 4408 8778 5081.60 4539 5756 151838 216917 30.00%
miss 16.41% 28.23 9 52 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 743 1.6% 173.8 2.01sec 1285 722 Direct 173.8 1269 2552 1285 17.4% 16.3%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 173.79 173.79 0.00 0.00 0.00 1.7796 0.0000 223261.78 318953.53 30.00% 721.90 721.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.31% 115.23 71 164 1269.39 1102 2195 1268.84 1171 1390 146272 208965 30.00%
crit 17.36% 30.17 9 56 2551.76 2204 4445 2550.56 2281 2870 76990 109988 30.00%
miss 16.33% 28.39 10 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7179) 0.0% (15.5%) 88.6 3.21sec 24331 20534

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 88.63 0.00 0.00 0.00 0.00 1.1849 0.0000 0.00 0.00 0.00% 20534.30 20534.30

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:5.66
  • if_expr:buff.doom_winds_talent.up
    single
    [R]:70.33
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    single
    [U]:12.65
    Stormstrike (_mh) 3885 (4786) 8.4% (10.3%) 118.1 3.21sec 12171 0 Direct 118.1 (176.1) 8403 16904 9879 17.4% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.12 118.12 0.00 0.00 0.00 0.0000 0.0000 1166930.33 1667085.84 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 97.61 54 148 8403.13 2743 21205 8413.95 7217 9917 820247 1171812 30.00%
crit 17.36% 20.51 4 45 16903.55 5486 42410 16923.73 10769 22990 346683 495274 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 901 1.9% 58.0 5.46sec 4669 0 Direct 58.0 4669 0 4669 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.99 57.99 0.00 0.00 0.00 0.0000 0.0000 270752.78 270752.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 57.99 22 105 4669.21 1205 19344 4678.73 3705 6202 270753 270753 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 1943 (2393) 4.2% (5.2%) 118.1 3.21sec 6085 0 Direct 118.1 (176.1) 4201 8460 4940 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 118.12 118.12 0.00 0.00 0.00 0.0000 0.0000 583473.06 833554.19 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 97.63 53 155 4200.64 1372 10602 4206.01 3571 4994 410109 585885 30.00%
crit 17.35% 20.49 3 45 8460.35 2743 20667 8472.87 5638 11012 173364 247669 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 450 1.0% 58.0 5.46sec 2334 0 Direct 58.0 2334 0 2334 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.99 57.99 0.00 0.00 0.00 0.0000 0.0000 135335.93 135335.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 57.99 22 105 2333.93 602 9658 2338.70 1759 3035 135336 135336 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1033 2.2% 6.5 46.66sec 47393 40531 Direct 6.5 40388 80803 47394 17.3% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.54 6.54 0.00 0.00 0.00 1.1694 0.0000 310100.64 310100.64 0.00% 40530.73 40530.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 5.41 0 9 40388.00 26739 83580 40405.62 0 58897 218453 218453 0.00%
crit 17.33% 1.13 0 6 80803.12 53478 165431 57609.44 0 152695 91647 91647 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [N]:0.77
  • if_expr:buff.doom_winds_talent.up
    single
    [Y]:5.78
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7236) 0.0% (15.5%) 1.0 0.00sec 2163148 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7236 15.5% 408.5 2.46sec 5295 0 Direct 408.5 4521 9028 5295 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 408.55 408.55 0.00 0.00 0.00 0.0000 0.0000 2163147.91 3090290.09 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.83% 338.40 217 482 4521.10 1488 12161 4525.83 3937 5399 1529944 2185691 30.00%
crit 17.17% 70.14 29 120 9027.69 2976 23099 9035.74 7161 11805 633204 904600 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 452 1.0% 24.0 10.21sec 5587 4116 Direct 24.0 4624 9301 5587 20.6% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.97 23.97 0.00 0.00 0.00 1.3573 0.0000 133913.31 133913.31 0.00% 4116.48 4116.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.41% 19.03 9 30 4624.16 3540 6270 4624.56 4159 5402 88006 88006 0.00%
crit 20.59% 4.94 0 13 9300.97 7235 12425 9265.48 0 12217 45908 45908 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 239 0.5% 25.2 9.69sec 2808 2056 Direct 25.2 2318 4658 2808 20.9% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.24 25.24 0.00 0.00 0.00 1.3658 0.0000 70863.94 70863.94 0.00% 2056.05 2056.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.06% 19.95 11 29 2318.34 1770 3135 2318.30 2106 2704 46254 46254 0.00%
crit 20.94% 5.28 0 15 4657.64 3618 6270 4640.61 0 5907 24610 24610 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (7005) 0.0% (14.9%) 20.3 10.01sec 102242 104086

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.28 0.00 0.00 0.00 0.00 0.9823 0.0000 0.00 0.00 0.00% 104086.30 104086.30

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [K]:20.27
  • if_expr:talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
    single
    [Q]:0.01
  • if_expr:talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
    Windstrike (_mh) 1935 (2370) 4.1% (5.0%) 27.0 10.01sec 25940 0 Direct 27.0 (38.7) 18117 36393 21180 16.8% (11.7%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.04 27.04 0.00 0.00 0.00 0.0000 0.0000 572792.63 572792.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.24% 22.51 12 41 18117.36 5341 32593 18233.35 13034 23086 407847 407847 0.00%
crit 16.76% 4.53 0 14 36393.24 10886 65037 36230.04 0 60698 164946 164946 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 435 0.9% 11.7 17.78sec 11043 0 Direct 11.7 11043 0 11043 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.66 11.66 0.00 0.00 0.00 0.0000 0.0000 128719.79 128719.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.66 2 20 11043.43 3161 29097 11027.99 7053 17556 128720 128720 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 967 (1185) 2.1% (2.5%) 27.0 10.01sec 12966 0 Direct 27.0 (38.7) 9053 18251 10586 16.7% (11.6%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.04 27.04 0.00 0.00 0.00 0.0000 0.0000 286296.74 286296.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.33% 22.54 10 40 9053.32 2670 16297 9110.49 6619 11632 204023 204023 0.00%
crit 16.67% 4.51 0 14 18250.75 5443 31963 18148.23 0 29282 82273 82273 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 217 0.5% 11.7 17.78sec 5521 0 Direct 11.7 5521 0 5521 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.66 11.66 0.00 0.00 0.00 0.0000 0.0000 64358.21 64358.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.66 2 20 5521.50 1581 14257 5517.55 3837 8556 64358 64358 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3450 7.3% 20.3 10.02sec 50381 0 Direct 20.3 41675 83734 50381 20.7% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.27 20.27 0.00 0.00 0.00 0.0000 0.0000 1021335.84 1021335.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.30% 16.08 7 24 41675.06 18967 60196 41672.53 35668 48589 669962 669962 0.00%
crit 20.70% 4.20 0 12 83733.62 39095 120392 82941.22 0 108361 351373 351373 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 414 / 86
melee 414 0.2% 39.4 2.44sec 650 421 Direct 39.4 555 1108 650 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.38 39.38 0.00 0.00 0.00 1.5458 0.0000 25612.76 36590.59 30.00% 420.72 420.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 32.57 21 56 554.52 490 882 554.02 490 682 18059 25800 30.00%
crit 17.30% 6.81 0 17 1108.37 980 1634 1107.24 0 1422 7553 10791 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4354 / 2710
melee 4354 5.8% 342.7 1.73sec 2364 2109 Direct 342.7 2019 4027 2364 17.2% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 342.70 342.70 0.00 0.00 0.00 1.1210 0.0000 810258.90 1157542.23 30.00% 2109.14 2109.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.79% 283.71 209 369 2018.55 1660 3306 2019.09 1866 2227 572677 818131 30.00%
crit 17.21% 58.99 31 95 4027.34 3321 6611 4028.78 3598 4558 237582 339411 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Phys
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.69sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 306.28sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.15 0.00 0.00 0.00 0.00 1.0098 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [a]:1.15
Feral Spirit 13.5 24.01sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.51 0.00 0.00 0.00 0.00 1.1405 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:13.51
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.50
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 95.58% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.3s
  • trigger_min/max:180.0s / 182.3s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 180.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.2s / 182.6s
  • trigger_min/max:180.2s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.6sec 5.5sec 18.8sec 12.74% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.4s
  • trigger_min/max:0.0s / 164.2s
  • trigger_pct:100.00%
  • duration_min/max:17.1s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.72%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.70%
  • crumbling_power_7:0.70%
  • crumbling_power_8:0.68%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.71%
  • crumbling_power_18:1.24%
  • crumbling_power_19:0.84%
  • crumbling_power_20:0.02%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds (_talent) 3.7 0.0 90.5sec 90.5sec 7.9sec 9.85% 12.51% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_doom_winds_talent
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.6s
  • trigger_min/max:90.0s / 92.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_talent_1:9.85%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 13.5 0.0 26.0sec 22.8sec 17.5sec 62.24% 100.00% 0.0 (0.0) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 76.1s
  • trigger_min/max:6.2s / 44.9s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 53.3s

Stack Uptimes

  • earthen_weapon_2:58.12%
  • earthen_weapon_4:4.13%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.3 1.0 37.3sec 32.5sec 10.8sec 26.10% 0.00% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 279.9s
  • trigger_min/max:1.7s / 279.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.7s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.10%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.3 0.9 37.3sec 32.6sec 10.7sec 26.07% 0.00% 0.9 (0.9) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 255.9s
  • trigger_min/max:1.7s / 248.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.3s

Stack Uptimes

  • elemental_blast_haste_1:26.07%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.3 1.0 37.3sec 32.4sec 10.8sec 26.18% 0.00% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 241.4s
  • trigger_min/max:1.7s / 241.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.7s

Stack Uptimes

  • elemental_blast_mastery_1:26.18%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.5sec 97.8sec 58.2sec 24.95% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:24.95%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 123.7sec 98.2sec 58.0sec 24.67% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 313.6s

Stack Uptimes

  • elemental_chaos_earth_1:24.67%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 121.5sec 97.5sec 57.9sec 25.02% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 330.6s

Stack Uptimes

  • elemental_chaos_fire_1:25.02%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 121.5sec 98.1sec 58.2sec 25.37% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 350.7s

Stack Uptimes

  • elemental_chaos_frost_1:25.37%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 308.0sec 0.0sec 27.4sec 13.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 331.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.41%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 2.9 29.6sec 24.0sec 17.5sec 62.25% 0.00% 53.3 (53.3) 10.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 76.1s
  • trigger_min/max:6.2s / 44.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.3s

Stack Uptimes

  • feral_spirit_1:62.25%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 44.0 367.6 6.9sec 0.7sec 5.7sec 84.16% 90.46% 367.6 (871.4) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 71.7s
  • trigger_min/max:0.0s / 18.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.0s

Stack Uptimes

  • flurry_1:20.29%
  • flurry_2:33.18%
  • flurry_3:30.69%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 119.0 17.8sec 2.2sec 14.6sec 84.01% 100.00% 57.5 (57.5) 16.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 46.9s
  • trigger_min/max:0.0s / 38.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:15.34%
  • forceful_winds_2:14.38%
  • forceful_winds_3:12.75%
  • forceful_winds_4:10.57%
  • forceful_winds_5:30.97%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.3sec 46.3sec 12.9sec 19.50% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 200.8s
  • trigger_min/max:0.3s / 200.8s
  • trigger_pct:98.78%
  • duration_min/max:0.0s / 50.5s

Stack Uptimes

  • forgestorm_ignited_1:19.50%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.5 0.7 14.7sec 14.1sec 7.1sec 48.13% 76.99% 0.7 (0.7) 4.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.9s / 65.1s
  • trigger_min/max:8.4s / 59.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.1s

Stack Uptimes

  • ice_strike_1:48.13%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 24.2 16.0 12.4sec 7.4sec 7.1sec 57.18% 0.00% 16.0 (16.0) 23.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 50.8s
  • trigger_min/max:0.8s / 37.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s

Stack Uptimes

  • legacy_of_the_frost_witch_1:57.18%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 46.7 380.6 6.5sec 1.4sec 5.5sec 85.50% 100.00% 42.9 (47.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 36.9s
  • trigger_min/max:0.0s / 9.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.6s

Stack Uptimes

  • maelstrom_weapon_1:9.73%
  • maelstrom_weapon_2:11.33%
  • maelstrom_weapon_3:13.06%
  • maelstrom_weapon_4:13.68%
  • maelstrom_weapon_5:8.78%
  • maelstrom_weapon_6:7.10%
  • maelstrom_weapon_7:5.28%
  • maelstrom_weapon_8:4.29%
  • maelstrom_weapon_9:3.44%
  • maelstrom_weapon_10:8.80%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.0sec 45.4sec 16.5sec 23.66% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 203.3s
  • trigger_min/max:0.0s / 201.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.2s

Stack Uptimes

  • sophic_devotion_1:23.66%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.2 61.0sec 45.7sec 16.5sec 23.69% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 218.4s
  • trigger_min/max:0.0s / 212.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.1s

Stack Uptimes

  • sophic_devotion_oh_1:23.69%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 76.7sec 46.1sec 32.1sec 37.99% 0.00% 25.5 (25.5) 3.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 232.5s
  • trigger_min/max:0.0s / 216.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 182.8s

Stack Uptimes

  • spiraling_winds_1:2.34%
  • spiraling_winds_2:2.31%
  • spiraling_winds_3:2.30%
  • spiraling_winds_4:2.27%
  • spiraling_winds_5:2.26%
  • spiraling_winds_6:2.25%
  • spiraling_winds_7:2.23%
  • spiraling_winds_8:2.21%
  • spiraling_winds_9:2.19%
  • spiraling_winds_10:17.64%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.3s
  • trigger_min/max:180.0s / 182.3s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 59.8 18.9 4.9sec 3.7sec 1.2sec 23.23% 54.50% 18.9 (18.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 94.0s
  • trigger_min/max:0.0s / 94.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s

Stack Uptimes

  • stormbringer_1:23.23%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.3 36.0 66.0 17.9s 15.0s 56.5s
Windfury-ForcefulWinds: 2 50.6 30.0 69.0 18.1s 0.4s 67.2s
Windfury-ForcefulWinds: 3 48.7 27.0 75.0 18.8s 1.2s 90.9s
Windfury-ForcefulWinds: 4 45.1 21.0 69.0 20.3s 0.9s 106.6s
Windfury-ForcefulWinds: 5 212.9 114.0 357.0 4.7s 0.0s 96.4s
windfury_totem_extra_attack_mh 27.7 11.0 50.0 10.6s 1.2s 121.1s
windfury_totem_extra_attack_oh 28.2 11.0 52.0 10.4s 0.1s 119.3s
Windfury: Unruly Winds 136.2 87.0 193.0 2.5s 0.0s 38.7s
Maelstrom Weapon: Feral Spirit 71.2 52.0 92.0 4.2s 0.0s 29.9s
Maelstrom Weapon: Elemental Assault 108.9 72.0 147.0 2.7s 0.8s 11.1s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.3s
Stormflurry 36.3 11.0 73.0 10.7s 0.8s 118.1s
Flametongue: Windfury Attack 408.5 261.0 579.0 2.5s 0.0s 38.7s
Stormbringer: Windfury Attack 43.1 18.0 82.0 7.9s 0.0s 114.6s
Maelstrom Weapon: Windfury Attack 81.9 41.0 143.0 4.7s 0.0s 91.2s
Flametongue: main_hand 143.8 98.0 197.0 2.5s 1.3s 27.5s
Maelstrom Weapon: main_hand 28.8 9.0 54.0 10.2s 1.3s 129.0s
Windfury: main_hand 48.8 22.0 83.0 6.3s 1.3s 79.5s
Flametongue: Windlash 24.0 19.0 32.0 10.2s 1.2s 170.4s
Maelstrom Weapon: Windlash 4.8 0.0 14.0 44.1s 1.2s 194.7s
Windfury: Windlash 16.2 10.0 25.0 14.7s 1.2s 177.2s
Flametongue: offhand 145.4 96.0 199.0 2.5s 1.3s 29.9s
Maelstrom Weapon: offhand 29.2 12.0 53.0 10.0s 1.3s 131.4s
Flametongue: Windlash Off-Hand 25.2 20.0 32.0 9.7s 1.2s 168.2s
Maelstrom Weapon: Windlash Off-Hand 5.1 0.0 13.0 41.8s 1.2s 194.8s
Flametongue: Sundering 6.5 4.0 9.0 46.7s 40.0s 117.6s
Stormbringer: Sundering 0.7 0.0 5.0 113.6s 40.0s 332.9s
Maelstrom Weapon: Sundering 1.3 0.0 5.0 102.8s 40.0s 324.8s
Windfury: Sundering 2.5 0.0 8.0 87.4s 40.0s 335.6s
Flametongue: Windstrike 27.0 17.0 45.0 10.0s 0.8s 171.5s
Stormbringer: Windstrike 2.8 0.0 10.0 58.1s 0.8s 194.1s
Maelstrom Weapon: Windstrike 5.4 0.0 15.0 40.6s 0.8s 192.9s
Windfury: Windstrike 19.1 10.0 38.0 13.8s 0.8s 177.8s
Flametongue: Windstrike Off-Hand 27.0 17.0 45.0 10.0s 0.8s 171.5s
Stormbringer: Windstrike Off-Hand 2.8 0.0 10.0 59.0s 0.8s 193.7s
Maelstrom Weapon: Windstrike Off-Hand 5.5 0.0 16.0 40.2s 0.8s 193.7s
Flametongue: Lava Lash 19.1 12.0 26.0 15.0s 8.9s 56.5s
Stormbringer: Lava Lash 2.0 0.0 8.0 75.9s 9.1s 331.3s
Maelstrom Weapon: Lava Lash 3.8 0.0 11.0 56.4s 9.0s 314.9s
Flametongue: Ice Strike 21.2 14.0 28.0 14.1s 8.4s 59.5s
Stormbringer: Ice Strike 2.2 0.0 9.0 75.5s 9.0s 331.1s
Maelstrom Weapon: Ice Strike 4.2 0.0 13.0 54.7s 8.9s 317.1s
Windfury: Ice Strike 8.2 1.0 18.0 35.8s 8.5s 285.6s
Flametongue: Stormstrike 118.1 65.0 180.0 3.2s 0.9s 27.4s
Stormbringer: Stormstrike 12.5 1.0 32.0 21.7s 0.9s 275.0s
Maelstrom Weapon: Stormstrike 23.6 2.0 47.0 12.5s 0.9s 186.1s
Windfury: Stormstrike 41.3 15.0 72.0 7.7s 0.9s 100.1s
Flametongue: Stormstrike Off-Hand 118.1 65.0 180.0 3.2s 0.9s 27.4s
Stormbringer: Stormstrike Off-Hand 12.5 1.0 32.0 21.7s 0.9s 256.0s
Maelstrom Weapon: Stormstrike Off-Hand 23.6 6.0 48.0 12.5s 0.9s 147.9s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 24.04% 16.56% 31.67% 0.7s 0.0s 18.6s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7980.0011.4659.2772.63314.899
Ascendance0.5420.0012.3470.4220.0002.347
Doom Winds0.5820.0012.5981.2840.2104.948
Sundering7.1170.00177.56537.1792.011125.920
Windstrike0.8960.0013.96617.7767.81625.164
Lava Lash3.2090.00144.31856.26516.457108.506
Flame Shock16.7180.001204.240211.340100.828300.267
Ice Strike2.5540.00147.11049.40010.522109.250
Frost Shock9.3830.001117.136172.32268.542258.710
Elemental Blast3.2610.00218.2252.0530.00020.061
Stormstrike1.0480.0015.02288.48147.502143.359
Earth Elemental6.8030.01630.7980.9330.00030.798

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Phys
mana_regenMana674.42253676.20100.00%376.14225709.7447.08%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 845.59 848.49 225710.8 49129.0 42234.6 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Phys
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 24.7534028.911375.001375.0058.81
Flame ShockMana 13.7810336.72750.00314.5845.00
Frost ShockMana 20.0110004.87500.00500.0036.80
Ice StrikeMana 21.2034982.161650.001650.0012.88
Lava LashMana 19.087630.82400.00399.9955.00
Lightning BoltMana 18.129061.33500.00499.98100.48
StormstrikeMana 118.12118123.181000.001332.7318.26
SunderingMana 6.5419629.783000.003000.0615.80

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Phys Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Phys Damage Per Second
Count 7499
Mean 46582.30
Minimum 38820.89
Maximum 57824.50
Spread ( max - min ) 19003.61
Range [ ( max - min ) / 2 * 100% ] 20.40%
Standard Deviation 2198.0996
5th Percentile 43164.92
95th Percentile 50384.28
( 95th Percentile - 5th Percentile ) 7219.37
Mean Distribution
Standard Deviation 25.3832
95.00% Confidence Interval ( 46532.55 - 46632.05 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 86
0.1% Error 8554
0.1 Scale Factor Error with Delta=300 41246
0.05 Scale Factor Error with Delta=300 164983
0.01 Scale Factor Error with Delta=300 4124568
Priority Target DPS
PR_Shaman_Enhancement_Phys Priority Target Damage Per Second
Count 7499
Mean 46582.30
Minimum 38820.89
Maximum 57824.50
Spread ( max - min ) 19003.61
Range [ ( max - min ) / 2 * 100% ] 20.40%
Standard Deviation 2198.0996
5th Percentile 43164.92
95th Percentile 50384.28
( 95th Percentile - 5th Percentile ) 7219.37
Mean Distribution
Standard Deviation 25.3832
95.00% Confidence Interval ( 46532.55 - 46632.05 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 86
0.1% Error 8554
0.1 Scale Factor Error with Delta=300 41246
0.05 Scale Factor Error with Delta=300 164983
0.01 Scale Factor Error with Delta=300 4124568
DPS(e)
PR_Shaman_Enhancement_Phys Damage Per Second (Effective)
Count 7499
Mean 46582.30
Minimum 38820.89
Maximum 57824.50
Spread ( max - min ) 19003.61
Range [ ( max - min ) / 2 * 100% ] 20.40%
Damage
PR_Shaman_Enhancement_Phys Damage
Count 7499
Mean 13102592.36
Minimum 9403254.92
Maximum 16991577.85
Spread ( max - min ) 7588322.92
Range [ ( max - min ) / 2 * 100% ] 28.96%
DTPS
PR_Shaman_Enhancement_Phys Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Phys Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Phys Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Phys Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Phys Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Phys Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_PhysTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Phys Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.50 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 13.51 feral_spirit
G 2.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
H 3.72 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
K 20.27 windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
L 5.66 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
M 2.39 ice_strike,if=buff.doom_winds_talent.up
N 0.77 sundering,if=buff.doom_winds_talent.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
O 1.16 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 frost_shock,if=buff.hailstorm.up
P 2.56 lava_lash,if=dot.flame_shock.refreshable
Q 0.01 windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
R 70.33 stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
S 24.75 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
T 4.08 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
0.00 windstrike
U 12.65 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
V 18.81 ice_strike
W 16.52 lava_lash
0.00 bag_of_tricks
X 14.04 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
Y 5.78 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
Z 20.01 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
a 1.15 earth_elemental
b 12.62 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ABCDFGEHKKKKKKMKFKKKOKKSRVWYZRRRRSFRVWZaRSRZbRVRSRRWZUXRRFRSRRVRWTRXYRUSRVWXZUbFZRSRVWXRZbHLSMLLFRSRWYZVRSRRXRWZbVUSRZbWUFRRSRVXZWRRXRRSRRRFVRTRPRSRRXVYZUSRRRFPDGEHKKKMKKFKKKKSPRRSRVRFRSRWRXRRRTRVYSWUUFXRRSVZWRRXRRSRRVWXRRFXZbRVWSRYZbSUUHMWXLLZbUSRRFRRSRVWZb

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 2 augmentation PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
0:00.000 default B potion Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_fire
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, crumbling_power(20), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:00.953 default G ascendance Fluffy_Pillow 40774.8/50000: 82% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:01.907 default E berserking Fluffy_Pillow 42301.2/50000: 85% mana bloodlust, ascendance, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:01.907 default H doom_winds Fluffy_Pillow 42301.2/50000: 85% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:02.774 single K windstrike Fluffy_Pillow 43688.4/50000: 87% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, doom_winds_talent, crumbling_power(18), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:03.642 single K windstrike Fluffy_Pillow 45077.2/50000: 90% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds_talent, crumbling_power(17), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:04.510 single K windstrike Fluffy_Pillow 46466.0/50000: 93% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds_talent, crumbling_power(16), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:05.378 single K windstrike Fluffy_Pillow 47854.8/50000: 96% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(15), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:06.246 single K windstrike Fluffy_Pillow 49243.6/50000: 98% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:07.114 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:07.982 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:08.849 single K windstrike Fluffy_Pillow 49737.2/50000: 99% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:09.714 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:10.582 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:11.452 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:12.320 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:13.187 single O flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:14.055 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:15.013 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:15.966 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:16.918 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(2), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:17.841 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, crumbling_power, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:18.768 single W lava_lash Fluffy_Pillow 49833.2/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:19.692 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:20.619 single Z frost_shock Fluffy_Pillow 48483.2/50000: 97% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:21.545 single R stormstrike Fluffy_Pillow 49464.8/50000: 99% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:22.471 single R stormstrike Fluffy_Pillow 48946.4/50000: 98% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:23.397 single R stormstrike Fluffy_Pillow 49428.0/50000: 99% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:24.325 single R stormstrike Fluffy_Pillow 48912.8/50000: 98% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:25.250 single S elemental_blast Fluffy_Pillow 49392.8/50000: 99% mana bloodlust, flurry(2), elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:26.176 default F feral_spirit Fluffy_Pillow 49499.4/50000: 99% mana bloodlust, flurry, elemental_blast_critical_strike, forceful_winds(3), stormbringer, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:27.129 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:28.084 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:29.036 single W lava_lash Fluffy_Pillow 49873.2/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:29.990 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:30.945 single a earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
0:31.902 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(6), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
0:32.855 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), sophic_devotion, elemental_chaos_fire
0:33.811 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:34.765 single Z frost_shock Fluffy_Pillow 49526.4/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:35.719 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:36.673 Waiting     0.222 sec 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:36.895 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:37.849 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:38.801 single R stormstrike Fluffy_Pillow 49873.2/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_fire
0:39.756 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_fire
0:40.921 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:42.121 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:43.322 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:44.525 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:45.727 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(6), sophic_devotion, elemental_chaos_fire
0:46.930 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(8), elemental_chaos_fire
0:48.134 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), legacy_of_the_frost_witch, elemental_chaos_fire
0:49.338 single R stormstrike Fluffy_Pillow 49926.4/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_fire
0:50.538 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(5), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
0:51.777 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:53.014 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(9), sophic_devotion, elemental_chaos_fire
0:54.251 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:55.454 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:56.656 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:57.859 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
0:59.061 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_fire
1:00.263 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_frost
1:01.467 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:02.671 single X lightning_bolt Fluffy_Pillow 49926.4/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:03.875 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:05.113 single R stormstrike Fluffy_Pillow 48980.8/50000: 98% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
1:06.352 single U stormstrike Fluffy_Pillow 48963.2/50000: 98% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_frost
1:07.591 single S elemental_blast Fluffy_Pillow 49945.6/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(6), ice_strike, elemental_chaos_frost
1:08.831 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_frost
1:10.069 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
1:11.307 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:12.544 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:13.782 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ice_strike, elemental_chaos_frost
1:15.019 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_chaos_frost
1:16.256 single b flame_shock Fluffy_Pillow 49979.2/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon(2), elemental_chaos_frost
1:17.494 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(2), elemental_chaos_frost
1:18.732 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_frost
1:19.970 Waiting     1.024 sec 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_frost
1:20.994 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_frost
1:22.430 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_frost
1:23.669 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
1:24.871 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_frost
1:26.072 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:27.274 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:28.476 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:29.677 single Z frost_shock Fluffy_Pillow 49921.6/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:30.880 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
1:32.082 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
1:33.284 Waiting     1.025 sec 50000.0/50000: 100% mana forceful_winds(3), maelstrom_weapon(4), doom_winds_talent, elemental_chaos_frost
1:34.309 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(4), maelstrom_weapon(4), doom_winds_talent, elemental_chaos_frost
1:35.767 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(9), doom_winds_talent, elemental_chaos_frost
1:37.006 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), doom_winds_talent, elemental_chaos_frost
1:38.245 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon, doom_winds_talent, ice_strike, elemental_chaos_frost
1:39.482 single L stormstrike Fluffy_Pillow 47979.2/50000: 96% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(8), doom_winds_talent, ice_strike, elemental_chaos_frost
1:40.721 default F feral_spirit Fluffy_Pillow 46961.6/50000: 94% mana flurry(2), elemental_blast_mastery, stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_frost
1:41.960 single R stormstrike Fluffy_Pillow 48944.0/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_frost
1:43.199 single S elemental_blast Fluffy_Pillow 49926.4/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_frost
1:44.439 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:45.679 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:46.918 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:48.156 single Z frost_shock Fluffy_Pillow 48980.8/50000: 98% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:49.394 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_frost
1:50.631 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_frost
1:51.868 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(8), ice_strike, elemental_chaos_frost
1:53.205 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:54.442 single R stormstrike Fluffy_Pillow 49979.2/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:55.680 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:56.918 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
1:58.156 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds, elemental_chaos_frost
1:59.395 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_frost
2:00.634 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(2), forgestorm_ignited, elemental_chaos_frost
2:01.873 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(4), spiraling_winds(3), forgestorm_ignited, elemental_chaos_frost
2:03.110 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(4), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(3), forgestorm_ignited, elemental_chaos_frost
2:04.348 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(4), maelstrom_weapon(8), ice_strike, spiraling_winds(4), forgestorm_ignited, elemental_chaos_frost
2:05.586 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_frost
2:06.823 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_frost
2:08.062 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(6), forgestorm_ignited, elemental_chaos_frost
2:09.300 Waiting     0.996 sec 50000.0/50000: 100% mana flurry, elemental_blast_mastery, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(7), forgestorm_ignited, elemental_chaos_frost
2:10.296 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), spiraling_winds(7), forgestorm_ignited, elemental_chaos_frost
2:11.741 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds, maelstrom_weapon(4), spiraling_winds(8), forgestorm_ignited, elemental_chaos_frost
2:12.996 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, stormbringer, maelstrom_weapon(6), spiraling_winds(8), forgestorm_ignited, elemental_chaos_frost
2:14.236 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), spiraling_winds(9), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
2:15.475 single R stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), spiraling_winds(10), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
2:16.712 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), spiraling_winds(10), forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:17.951 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:19.190 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:20.427 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:21.666 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:22.904 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:24.143 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:25.381 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(4), sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:26.620 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:27.859 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:29.098 single R stormstrike Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), forceful_winds, stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:30.336 single S elemental_blast Fluffy_Pillow 48963.2/50000: 98% mana flurry(2), forceful_winds(3), maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:31.573 single R stormstrike Fluffy_Pillow 49567.4/50000: 99% mana flurry, elemental_blast_mastery, forceful_winds(4), stormbringer, legacy_of_the_frost_witch, elemental_chaos_frost
2:32.811 single R stormstrike Fluffy_Pillow 49548.2/50000: 99% mana flurry(2), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
2:34.050 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
2:35.288 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_frost
2:36.524 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_frost
2:37.764 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_frost
2:39.002 single T lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_frost
2:40.242 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:41.480 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:42.720 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:43.958 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:45.196 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:46.396 single R stormstrike Fluffy_Pillow 49920.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:47.598 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:48.800 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
2:50.003 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, forgestorm_ignited, elemental_chaos_frost
2:51.206 single Z frost_shock Fluffy_Pillow 48924.8/50000: 98% mana flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(3), ice_strike, forgestorm_ignited, elemental_chaos_frost
2:52.409 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(4), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_frost
2:53.610 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(4), maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_frost
2:54.811 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(4), legacy_of_the_frost_witch, elemental_chaos_frost
2:56.014 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
2:57.218 single R stormstrike Fluffy_Pillow 49926.4/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_chaos_frost
2:58.420 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_chaos_frost
2:59.623 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_frost
3:00.824 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), elemental_chaos_frost
3:00.824 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), crumbling_power(20), elemental_chaos_frost
3:02.156 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, crumbling_power(19), elemental_chaos_frost
3:02.156 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, crumbling_power(19), elemental_chaos_frost
3:03.251 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, crumbling_power(19), elemental_chaos_frost
3:04.343 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, crumbling_power(18), elemental_chaos_frost
3:05.468 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(17), elemental_chaos_frost
3:06.594 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(16), elemental_chaos_frost
3:07.721 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), elemental_chaos_frost
3:08.847 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_frost
3:09.974 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_frost
3:11.101 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_frost
3:12.227 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_frost
3:13.354 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_frost
3:14.480 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), sophic_devotion_oh, elemental_chaos_frost
3:15.719 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_frost
3:16.956 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(7), forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:18.161 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:19.364 single R stormstrike Fluffy_Pillow 48924.8/50000: 98% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, crumbling_power(5), forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:20.567 single S elemental_blast Fluffy_Pillow 49849.6/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, crumbling_power(4), forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:21.769 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:22.970 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:24.172 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:25.373 default F feral_spirit Fluffy_Pillow 49921.6/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:26.575 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:27.814 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:29.206 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
3:30.445 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
3:31.683 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:32.920 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:34.159 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:35.397 single R stormstrike Fluffy_Pillow 47980.8/50000: 96% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:36.636 single R stormstrike Fluffy_Pillow 48963.2/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:37.875 single T lightning_bolt Fluffy_Pillow 48945.6/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_chaos_frost
3:39.114 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:40.352 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:41.591 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds, forgestorm_ignited, elemental_chaos_frost
3:42.832 single S elemental_blast Fluffy_Pillow 48985.6/50000: 98% mana flurry(2), forceful_winds(5), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds, forgestorm_ignited, elemental_chaos_frost
3:44.070 single W lava_lash Fluffy_Pillow 49591.4/50000: 99% mana elemental_blast_mastery, forceful_winds(5), ice_strike, spiraling_winds(2), forgestorm_ignited, elemental_chaos_frost
3:45.309 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(2), ice_strike, spiraling_winds(3), forgestorm_ignited, elemental_chaos_frost
3:46.549 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, spiraling_winds(3), forgestorm_ignited, elemental_chaos_frost
3:47.788 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(6), ice_strike, spiraling_winds(4), forgestorm_ignited, elemental_chaos_frost
3:49.027 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), ice_strike, spiraling_winds(5), forgestorm_ignited, elemental_chaos_frost
3:50.265 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, elemental_chaos_frost
3:51.505 single R stormstrike Fluffy_Pillow 49984.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_frost
3:52.743 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_frost
3:53.982 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_frost
3:55.220 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(8), elemental_chaos_frost
3:56.456 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, spiraling_winds(8), forgestorm_ignited, elemental_chaos_frost
3:57.695 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), spiraling_winds(9), forgestorm_ignited, elemental_chaos_frost
3:58.934 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), spiraling_winds(9), forgestorm_ignited, elemental_chaos_frost
4:00.172 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(6), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
4:01.410 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
4:02.649 single R stormstrike Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
4:03.887 single S elemental_blast Fluffy_Pillow 48963.2/50000: 98% mana flurry, forceful_winds(5), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
4:05.206 single R stormstrike Fluffy_Pillow 49698.6/50000: 99% mana elemental_blast_haste, forceful_winds(5), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
4:06.407 single R stormstrike Fluffy_Pillow 49620.2/50000: 99% mana flurry(2), elemental_blast_haste, stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
4:07.611 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_fire
4:08.814 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:10.015 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(6), ice_strike, elemental_chaos_fire
4:11.217 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:12.418 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:13.620 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:14.990 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:16.229 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), ice_strike, elemental_chaos_fire
4:17.468 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, elemental_chaos_fire
4:18.705 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, elemental_chaos_fire
4:19.943 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_fire
4:21.181 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, elemental_chaos_fire
4:22.419 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, elemental_chaos_fire
4:23.657 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:24.895 single Y sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:26.133 single Z frost_shock Fluffy_Pillow 48980.8/50000: 98% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
4:27.371 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_fire
4:28.609 Waiting     0.214 sec 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_fire
4:28.823 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, maelstrom_weapon(5), elemental_chaos_fire
4:30.062 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, elemental_chaos_fire
4:31.265 single U stormstrike Fluffy_Pillow 48924.8/50000: 98% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(4), elemental_chaos_fire
4:32.467 default H doom_winds Fluffy_Pillow 49848.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(5), spiraling_winds, elemental_chaos_fire
4:33.670 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(5), doom_winds_talent, spiraling_winds, elemental_chaos_fire
4:34.873 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(4), maelstrom_weapon(6), doom_winds_talent, ice_strike, spiraling_winds(2), elemental_chaos_fire
4:36.077 single X lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(7), doom_winds_talent, ice_strike, spiraling_winds(3), elemental_chaos_fire
4:37.280 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_fire
4:38.483 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(2), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_fire
4:39.684 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(5), maelstrom_weapon(4), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_fire
4:40.922 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(5), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_fire
4:42.161 Waiting     2.293 sec 50000.0/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_weapon(4), spiraling_winds(6), elemental_chaos_fire
4:44.454 single U stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(5), maelstrom_weapon(4), spiraling_winds(7), elemental_chaos_fire
4:45.883 single S elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(8), spiraling_winds(7), forgestorm_ignited, elemental_chaos_fire
4:47.120 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, legacy_of_the_frost_witch, spiraling_winds(8), forgestorm_ignited, elemental_chaos_fire
4:48.323 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_fire
4:49.526 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(9), forgestorm_ignited, elemental_chaos_fire
4:50.729 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
4:51.932 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), spiraling_winds(10), forgestorm_ignited, elemental_chaos_fire
4:53.134 single S elemental_blast Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
4:54.338 single R stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
4:55.542 single V ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
4:56.746 single W lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
4:57.949 single Z frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_fire
4:59.152 single b flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.51% 21.51% 3656
Versatility 7.11% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.07% 52.07% 3246
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt (waking_stats_2) }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi (frosted_armor_kit_2) }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste (devotion_of_haste_2) }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Phys"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike,if=talent.thorims_invocation.enabled&buff.maelstrom_weapon.stack>=1
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/windstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/stormstrike,if=talent.deeply_rooted_elements.enabled|buff.earthen_weapon.up|buff.legacy_of_the_frost_witch.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/windstrike
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant=frosted_armor_kit_2
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant=devotion_of_haste_2
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant=devotion_of_haste_2
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 311925817
Max Event Queue: 419
Sim Seconds: 2250297
CPU Seconds: 459.5243
Physical Seconds: 232.6997
Speed Up: 4897

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.55sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 172856 576 7.65 3580 7183 38.2 38.2 26.1% 0.0% 0.0% 0.0% 6.91sec 172856 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 138.43sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 810404 2701 37.84 3887 7779 189.2 189.2 26.5% 16.4% 0.0% 0.0% 1.85sec 1157750 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 395127 1317 37.01 1943 3891 185.1 185.1 26.5% 16.7% 0.0% 0.0% 1.85sec 564481 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.64sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 3508531 11695 39.30 14108 28220 196.5 196.5 26.5% 0.0% 0.0% 0.0% 1.43sec 3508531 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 206453 688 0.56 58537 116938 2.9 2.8 26.9% 0.0% 0.0% 0.0% 119.59sec 206453 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 6462 22 2.29 445 891 1.1 11.5 26.6% 0.0% 0.0% 0.0% 116.32sec 6462 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 232903 776 1.11 33171 66341 5.5 5.5 26.8% 0.0% 0.0% 0.0% 47.12sec 332727 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 85.46sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 596650 1989 19.75 4768 9536 66.3 98.7 26.7% 0.0% 0.0% 0.0% 4.50sec 596650 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 266819 889 4.93 8556 17123 24.7 24.7 26.4% 0.0% 0.0% 0.0% 7.10sec 266819 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 133262 444 4.93 4280 8551 24.7 24.7 26.3% 0.0% 0.0% 0.0% 7.10sec 133262 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 62.51sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 2064985 6883 13.26 24591 49195 66.3 66.3 26.6% 0.0% 0.0% 0.0% 4.50sec 2064985 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 432557 1442 13.23 5163 10340 66.2 66.2 26.6% 0.0% 0.0% 0.0% 4.51sec 432557 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 496698 1656 12.91 6082 12176 64.5 64.5 26.5% 0.0% 0.0% 0.0% 4.60sec 709586 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 248588 829 12.91 3041 6090 64.5 64.5 26.6% 0.0% 0.0% 0.0% 4.60sec 355135 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1234649 4116 8.34 0 29603 41.7 41.7 100.0% 0.0% 0.0% 0.0% 7.08sec 1234649 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 617324 2058 8.34 0 14802 41.7 41.7 100.0% 0.0% 0.0% 0.0% 7.08sec 617324 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 7.8 0.0 0.0% 0.0% 0.0% 0.0% 40.10sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 307.26sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.69sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 20.59sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1658181 5527 48.67 5374 10784 243.4 243.4 26.6% 0.0% 0.0% 0.0% 1.23sec 1658181 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 58443 195 4.02 2296 4593 20.1 20.1 26.5% 0.0% 0.0% 0.0% 14.49sec 83493 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 58410 195 4.02 2296 4593 20.1 20.1 26.5% 0.0% 0.0% 0.0% 14.45sec 83445 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.2 0.0 0.0% 0.0% 0.0% 0.0% 14.46sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 104781 640 19.15 1583 3168 52.3 52.3 26.6% 0.0% 0.0% 0.0% 5.39sec 149691 163.78sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 212 1 1.07 57 115 2.9 2.9 26.2% 0.0% 0.0% 0.0% 120.69sec 302 163.78sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul main_hand 0 212923 1300 34.65 1777 3558 94.6 94.6 26.6% 0.0% 0.0% 0.0% 2.93sec 304183 163.78sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.69sec 0 163.78sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 67255 224 1.40 8339 16676 7.0 7.0 15.6% 0.0% 0.0% 0.0% 45.50sec 67255 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 857000 2857 29.61 5021 10042 148.0 148.0 15.3% 0.0% 0.0% 0.0% 2.44sec 1224317 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.77sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 59674 199 1.40 7385 14762 7.0 7.0 15.4% 0.0% 0.0% 0.0% 45.62sec 59674 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1256306 4188 19.14 11377 22744 95.8 95.7 15.4% 0.0% 0.0% 0.0% 3.09sec 1256306 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 371812 1239 26.43 2813 0 0.0 132.2 0.0% 0.0% 0.0% 0.0% 0.00sec 371812 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 210252 701 1.09 33373 66746 5.5 5.5 15.4% 0.0% 0.0% 0.0% 46.84sec 300367 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 166.15sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 351236 1171 5.24 11614 23221 26.2 26.2 15.4% 0.0% 0.0% 0.0% 11.52sec 501779 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 559951 1867 20.78 4675 9347 103.9 103.9 15.3% 0.0% 0.0% 0.0% 3.51sec 559951 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 25105 84 2.37 1836 3677 11.9 11.9 15.2% 0.0% 0.0% 0.0% 26.32sec 25105 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.36sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike 55090 291148 970 15.42 3272 6546 77.1 77.1 15.4% 0.0% 0.0% 0.0% 3.75sec 415936 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike_shadow 70890 382618 1275 15.42 4301 8602 0.0 77.1 15.4% 0.0% 0.0% 0.0% 0.00sec 382618 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy solved_the_puzzle 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.79sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 133316 444 3.14 7358 14722 15.7 15.7 15.5% 0.0% 0.0% 0.0% 6.86sec 133316 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 639937 2133 3.13 35341 70730 15.7 15.7 15.5% 0.0% 0.0% 0.0% 6.86sec 639937 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.80sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 63215 211 0.73 14982 30000 3.7 3.7 15.1% 0.0% 0.0% 0.0% 90.74sec 63215 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_pact 319236 400810 1336 24.63 2823 5644 123.1 123.1 15.3% 0.0% 0.0% 0.0% 2.63sec 400810 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 21.5 0.0 0.0% 0.0% 0.0% 0.0% 13.58sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 264485 882 19.83 2312 4624 11.9 99.2 15.4% 0.0% 0.0% 0.0% 26.32sec 264485 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 93914 313 7.58 2146 4290 37.9 37.9 15.4% 0.0% 0.0% 0.0% 7.86sec 134166 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 220 1 0.52 73 146 2.6 2.6 15.4% 0.0% 0.0% 0.0% 90.04sec 315 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul main_hand 0 1288725 4296 38.37 5825 11659 191.8 191.8 15.3% 0.0% 0.0% 0.0% 1.55sec 1841083 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul monstrous_blow 91797 3114 10 0.22 2458 4929 1.1 1.1 15.8% 0.0% 0.0% 0.0% 91.11sec 4449 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul spawn_travel 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 411317 1371 13.60 5244 10490 68.0 68.0 15.3% 0.0% 0.0% 0.0% 4.29sec 411317 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1555736 31123 47.71 33931 67687 39.8 39.8 15.4% 0.0% 0.0% 0.0% 5.31sec 1555736 49.99sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.80sec 0 49.99sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_risen_skulker skulker_shot 212423 354171 1181 30.75 1998 3996 153.8 153.7 15.3% 0.0% 0.0% 0.0% 1.94sec 505972 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 300468 3778 25.98 7553 15117 34.4 34.4 15.5% 0.0% 0.0% 0.0% 8.54sec 300468 79.52sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 708855 8914 62.07 7468 14938 82.3 82.3 15.4% 0.0% 0.0% 0.0% 3.51sec 708855 79.52sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 268380 4474 212.16 1097 2194 212.1 212.1 15.4% 0.0% 0.0% 0.0% 1.02sec 383410 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1370116 22842 347.74 3416 6834 347.6 347.6 15.4% 0.0% 0.0% 0.0% 0.62sec 1957359 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.96sec 0 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.68sec 0 59.97sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.40sec 0 59.97sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.11sec 0 59.96sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.83sec 0 59.95sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.55sec 0 59.94sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.26sec 0 59.94sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.62sec 0 59.93sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 173653 1777 93.99 983 1966 153.1 153.1 15.4% 0.0% 0.0% 0.0% 1.83sec 248081 97.72sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 639406 6544 111.80 3043 6083 182.1 182.1 15.4% 0.0% 0.0% 0.0% 1.53sec 913460 97.72sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 47.54sec 0 97.72sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 46.88sec 0 99.14sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 46.94sec 0 99.07sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 47.69sec 0 97.57sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.48sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow dark_ascension 391109 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.88sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 1183245 3944 10.14 19174 40998 50.7 50.7 19.1% 0.0% 0.0% 0.0% 5.91sec 2763886 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 1580641 5269 25.71 10363 21158 50.7 128.6 17.9% 0.0% 0.0% 0.0% 5.91sec 2763886 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 179.3 0.0 0.0% 0.0% 0.0% 0.0% 1.66sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo 120644 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 62.60sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_heal 390971 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 62.60sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_damage 390964 130834 436 0.98 22066 47643 4.9 4.9 18.1% 0.0% 0.0% 0.0% 62.60sec 130834 300.00sec
PR_Priest_Shadow PR_Priest_Shadow idol_of_cthun 377349 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_void_tendril mind_flay ticks -193473 962440 3208 32.90 5009 10156 22.0 164.5 16.3% 0.0% 0.0% 0.0% 12.73sec 962440 24.03sec
PR_Priest_Shadow PR_Priest_Shadow mental_fortitude 377065 153649 512 69.54 442 0 335.9 347.7 0.0% 0.0% 0.0% 0.0% 0.88sec 7076358 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 1208636 4029 12.57 15776 34577 62.9 62.9 18.4% 0.0% 0.0% 0.0% 4.77sec 1208636 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay ticks -15407 176109 587 8.10 3750 7689 6.8 40.5 15.3% 0.0% 0.0% 0.0% 38.69sec 176109 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay_insanity ticks -391403 1661235 5537 32.28 8694 17771 40.5 161.4 17.6% 0.0% 0.0% 0.0% 7.30sec 1661235 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 258812 863 2.06 21172 46047 10.3 10.3 16.1% 0.0% 0.0% 0.0% 24.93sec 258812 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.65sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames 375901 414962 1383 1.55 43526 95289 7.8 7.8 19.3% 0.0% 0.0% 0.0% 40.41sec 414962 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames_damage_reversal 323706 0 0 0.00 0 0 7.8 0.0 0.0% 0.0% 0.0% 0.0% 40.41sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 309.43sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow power_infusion 10060 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.69sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.92sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_damage 205386 358556 1195 1.92 30835 65803 9.6 9.6 18.8% 0.0% 0.0% 0.0% 32.84sec 358556 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_dots 391286 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.92sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 197179 657 26.05 1514 0 131.3 130.3 0.0% 0.0% 0.0% 0.0% 2.22sec 197179 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 372189 1241 2.55 24264 50589 12.7 12.7 18.7% 0.0% 0.0% 0.0% 24.34sec 372189 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 89311 298 2.53 4660 17757 12.7 12.7 18.3% 0.0% 0.0% 0.0% 24.34sec 250788 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain ticks -589 662468 2208 40.27 2775 5675 9.6 201.3 17.8% 0.0% 0.0% 0.0% 32.84sec 662468 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparitions 341491 0 0 0.00 0 0 113.5 0.0 0.0% 0.0% 0.0% 0.0% 2.63sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparition 148859 364226 1214 22.00 3312 0 111.8 110.0 0.0% 0.0% 0.0% 0.0% 2.63sec 364226 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 343063 1144 17.33 3959 0 7.3 86.7 0.0% 0.0% 0.0% 0.0% 36.76sec 343063 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.69sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 1002425 3341 33.41 5061 10357 9.6 167.1 17.7% 0.0% 0.0% 0.0% 32.84sec 1002425 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 167.1 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment 373427 0 0 0.00 0 0 41.8 0.0 0.0% 0.0% 0.0% 0.0% 6.99sec 0 138.61sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment_damage 373442 846644 6108 18.09 16163 34021 41.8 41.8 22.9% 0.0% 0.0% 0.0% 6.99sec 846644 138.61sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender melee 0 722483 5212 56.82 4471 9094 131.3 131.3 22.3% 0.0% 0.0% 0.0% 2.22sec 722483 138.61sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 309.56sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2439928 8133 4.42 90844 182978 22.1 22.1 21.3% 0.0% 0.0% 0.0% 13.49sec 2439928 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 30.02sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 610887 2036 16.41 6336 12725 82.1 82.1 17.4% 0.0% 0.0% 0.0% 3.66sec 1455949 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 845062 2817 38.44 3737 7514 82.1 192.2 17.5% 0.0% 0.0% 0.0% 3.66sec 1455949 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 284191 947 132.31 366 734 661.5 661.5 17.4% 0.0% 0.0% 0.0% 0.73sec 284191 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 326715 1089 5.67 9805 19712 28.3 28.3 17.4% 0.0% 0.0% 0.0% 7.75sec 326715 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 1663732 5546 8.65 32786 65512 43.2 43.2 17.4% 0.0% 0.0% 0.0% 6.91sec 1663732 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 597627 1992 4.94 20574 41335 24.7 24.7 17.5% 0.0% 0.0% 0.0% 12.26sec 597627 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 2847509 9492 13.26 36526 73436 66.3 66.3 17.4% 0.0% 0.0% 0.0% 4.46sec 2847509 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 1178669 3929 3.72 52205 104838 18.6 18.6 21.3% 0.0% 0.0% 0.0% 16.30sec 1178669 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 0 510198 1701 38.63 2612 5253 193.2 193.2 17.3% 16.4% 0.0% 0.0% 1.81sec 728872 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 1 256117 854 38.66 1308 2629 193.3 193.3 17.4% 16.3% 0.0% 0.0% 1.80sec 365891 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.58sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement primordial_wave 375982 49379 165 1.41 5978 12008 7.0 7.0 17.3% 0.0% 0.0% 0.0% 45.72sec 49379 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_pw 188196 845591 2819 1.40 99497 199149 7.0 7.0 21.4% 0.0% 0.0% 0.0% 45.90sec 845591 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 46.5 0.0 0.0% 0.0% 0.0% 0.0% 6.35sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 368194 1227 9.30 6741 13570 46.5 46.5 17.3% 0.0% 0.0% 0.0% 6.35sec 526005 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 184378 615 9.30 3371 6782 46.5 46.5 17.4% 0.0% 0.0% 0.0% 6.35sec 263404 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 241851 806 1.14 36096 72699 5.7 5.7 17.5% 0.0% 0.0% 0.0% 54.04sec 241851 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 220234 734 29.74 1259 2532 148.7 148.7 17.4% 0.0% 0.0% 0.0% 4.16sec 314628 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26413 427 38.69 564 1128 39.9 39.9 17.5% 0.0% 0.0% 0.0% 2.24sec 37734 61.80sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_frost_wolf melee 0 211705 4219 107.07 2012 4022 89.5 89.5 17.5% 0.0% 0.0% 0.0% 3.39sec 302444 50.18sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_lightning_wolf melee 0 210831 7024 179.16 2002 4001 89.6 89.6 17.5% 0.0% 0.0% 0.0% 3.41sec 301195 30.01sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_fiery_wolf melee 0 211447 6178 156.72 2015 4023 89.4 89.4 17.5% 0.0% 0.0% 0.0% 3.42sec 302074 34.23sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_dre 114051 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 30.61sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_damage_dre 344548 317869 1060 1.67 31985 64218 8.3 8.3 19.2% 0.0% 0.0% 0.0% 30.61sec 317869 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba doom_winds 384352 24959 83 0.75 6686 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.40sec 35656 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 309.39sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba elemental_blast 117014 2127764 7093 5.02 70082 140598 25.1 25.1 20.9% 0.0% 0.0% 0.0% 11.77sec 2127764 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba feral_spirit 51533 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 21.45sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock 188389 99401 331 6.03 2804 5631 30.2 30.2 17.4% 0.0% 0.0% 0.0% 9.80sec 464890 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock ticks -188389 365490 1218 37.37 1666 3345 30.2 186.8 17.3% 0.0% 0.0% 0.0% 9.80sec 464890 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_attack 10444 467194 1557 225.77 353 707 1128.9 1128.9 17.3% 0.0% 0.0% 0.0% 0.67sec 467194 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba forgestorm_ignited_damage 381700 331804 1106 5.77 9807 19717 28.8 28.8 17.2% 0.0% 0.0% 0.0% 7.55sec 331804 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba frost_shock 196840 316671 1056 3.35 16064 32317 16.7 16.7 17.5% 0.0% 0.0% 0.0% 16.79sec 316671 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ice_strike 342240 434454 1448 4.07 18190 36449 20.3 20.3 17.4% 0.0% 0.0% 0.0% 14.85sec 434454 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lava_lash 60103 413499 1378 3.72 18896 37992 18.6 18.6 17.4% 0.0% 0.0% 0.0% 15.72sec 413499 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt 188196 845655 2819 3.29 42321 84915 16.5 16.5 21.3% 0.0% 0.0% 0.0% 17.04sec 845655 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba main_hand 0 427072 1424 32.62 2591 5208 163.1 163.1 17.3% 16.4% 0.0% 0.0% 2.15sec 610118 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba offhand 1 218465 728 33.33 1298 2608 166.6 166.6 17.3% 16.4% 0.0% 0.0% 2.09sec 312100 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike 17364 0 0 0.00 0 0 91.8 0.0 0.0% 0.0% 0.0% 0.0% 3.26sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_mh 32175 1268050 4227 24.51 8803 17714 122.5 122.5 17.3% 0.0% 0.0% 0.0% 3.26sec 1811547 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_mh 390287 300846 1003 12.21 4929 0 61.0 61.0 0.0% 0.0% 0.0% 0.0% 5.50sec 300846 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_offhand 32176 633609 2112 24.51 4404 8833 122.5 122.5 17.3% 0.0% 0.0% 0.0% 3.26sec 905179 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_offhand 390287 150280 501 12.21 2462 0 61.0 61.0 0.0% 0.0% 0.0% 0.0% 5.50sec 150280 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba sundering 197214 315073 1050 1.28 41896 84170 6.4 6.4 17.2% 0.0% 0.0% 0.0% 49.14sec 315073 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_attack 25504 2136861 7123 83.44 4366 8756 417.2 417.2 17.2% 0.0% 0.0% 0.0% 2.40sec 3052737 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash 114089 150638 502 6.72 3700 7433 33.6 33.6 21.1% 0.0% 0.0% 0.0% 8.42sec 150638 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash_offhand 114093 87460 292 7.79 1850 3719 39.0 39.0 21.1% 0.0% 0.0% 0.0% 7.30sec 87460 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike 115356 0 0 0.00 0 0 27.4 0.0 0.0% 0.0% 0.0% 0.0% 8.58sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_mh 115357 573575 1912 7.31 13381 26863 36.6 36.6 17.1% 0.0% 0.0% 0.0% 8.58sec 573575 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_mh 390287 103841 346 2.49 8335 0 12.5 12.5 0.0% 0.0% 0.0% 0.0% 18.17sec 103841 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_offhand 115360 286478 955 7.31 6691 13427 36.6 36.6 17.0% 0.0% 0.0% 0.0% 8.58sec 286478 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_offhand 390287 51927 173 2.49 4168 0 12.5 12.5 0.0% 0.0% 0.0% 0.0% 18.17sec 51927 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt_ti 188196 1093991 3647 5.47 32994 66179 27.4 27.4 21.1% 0.0% 0.0% 0.0% 8.60sec 1093991 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_greater_earth_elemental melee 0 26552 425 39.37 552 1104 41.0 41.0 17.3% 0.0% 0.0% 0.0% 2.41sec 37933 62.49sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_spirit_wolf melee 0 840694 7869 205.15 1963 3922 365.3 365.3 17.3% 0.0% 0.0% 0.0% 1.63sec 1201022 106.84sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.42sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance_damage 344548 104181 347 0.40 43789 87954 2.0 2.0 18.8% 0.0% 0.0% 0.0% 180.42sec 104181 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.69sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys doom_winds 384352 24492 82 0.74 6579 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.47sec 34989 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 306.28sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys elemental_blast 117014 2001162 6671 4.95 66830 134301 24.7 24.7 20.8% 0.0% 0.0% 0.0% 11.69sec 2001162 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys feral_spirit 51533 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 24.01sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock 188389 107137 357 6.57 2774 5575 32.9 32.9 17.4% 0.0% 0.0% 0.0% 8.84sec 465128 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock ticks -188389 357991 1193 36.62 1665 3343 32.9 183.1 17.3% 0.0% 0.0% 0.0% 8.84sec 465128 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_attack 10444 456424 1521 216.82 359 719 1084.1 1084.1 17.2% 0.0% 0.0% 0.0% 0.69sec 456424 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys forgestorm_ignited_damage 381700 331108 1104 5.75 9808 19722 28.7 28.7 17.3% 0.0% 0.0% 0.0% 7.64sec 331108 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys frost_shock 196840 368143 1227 4.00 15650 31469 20.0 20.0 17.4% 0.0% 0.0% 0.0% 13.80sec 368143 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ice_strike 342240 450410 1501 4.24 18060 36271 21.2 21.2 17.5% 0.0% 0.0% 0.0% 14.14sec 450410 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lava_lash 60103 419721 1399 3.82 18707 37563 19.1 19.1 17.5% 0.0% 0.0% 0.0% 14.97sec 419721 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt 188196 910465 3035 3.62 41317 82854 18.1 18.1 21.5% 0.0% 0.0% 0.0% 15.38sec 910465 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys main_hand 0 440077 1467 34.41 2530 5084 172.0 172.0 17.4% 16.4% 0.0% 0.0% 1.93sec 628697 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys offhand 1 223262 744 34.76 1269 2552 173.8 173.8 17.4% 16.3% 0.0% 0.0% 2.01sec 318954 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike 17364 0 0 0.00 0 0 88.6 0.0 0.0% 0.0% 0.0% 0.0% 3.21sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_mh 32175 1166930 3890 23.62 8403 16904 118.1 118.1 17.4% 0.0% 0.0% 0.0% 3.21sec 1667086 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_mh 390287 270753 903 11.60 4669 0 58.0 58.0 0.0% 0.0% 0.0% 0.0% 5.46sec 270753 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_offhand 32176 583473 1945 23.62 4201 8460 118.1 118.1 17.3% 0.0% 0.0% 0.0% 3.21sec 833554 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_offhand 390287 135336 451 11.60 2334 0 58.0 58.0 0.0% 0.0% 0.0% 0.0% 5.46sec 135336 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys sundering 197214 310101 1034 1.31 40388 80803 6.5 6.5 17.3% 0.0% 0.0% 0.0% 46.66sec 310101 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_attack 25504 2163148 7211 81.71 4521 9028 408.5 408.5 17.2% 0.0% 0.0% 0.0% 2.46sec 3090290 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash 114089 133913 446 4.79 4624 9301 24.0 24.0 20.6% 0.0% 0.0% 0.0% 10.21sec 133913 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash_offhand 114093 70864 236 5.05 2318 4658 25.2 25.2 20.9% 0.0% 0.0% 0.0% 9.69sec 70864 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike 115356 0 0 0.00 0 0 20.3 0.0 0.0% 0.0% 0.0% 0.0% 10.01sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_mh 115357 572793 1909 5.41 18117 36393 27.0 27.0 16.8% 0.0% 0.0% 0.0% 10.01sec 572793 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_mh 390287 128720 429 2.33 11043 0 11.7 11.7 0.0% 0.0% 0.0% 0.0% 17.78sec 128720 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_offhand 115360 286297 954 5.41 9053 18251 27.0 27.0 16.7% 0.0% 0.0% 0.0% 10.01sec 286297 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_offhand 390287 64358 215 2.33 5521 0 11.7 11.7 0.0% 0.0% 0.0% 0.0% 17.78sec 64358 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt_ti 188196 1021336 3404 4.05 41675 83734 20.3 20.3 20.7% 0.0% 0.0% 0.0% 10.02sec 1021336 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_greater_earth_elemental melee 0 25613 414 38.22 555 1108 39.4 39.4 17.3% 0.0% 0.0% 0.0% 2.44sec 36591 61.83sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_spirit_wolf melee 0 810259 8183 207.65 2019 4027 342.7 342.7 17.2% 0.0% 0.0% 0.0% 1.73sec 1157542 99.02sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
269873.5 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.7 2.2 22.2sec 18.6sec 5.5sec 23.11% 23.38% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 177.0s
  • trigger_min/max:3.0s / 177.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.11%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3sec 18.8sec 5.5sec 23.10% 23.32% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 225.0s
  • trigger_min/max:3.0s / 225.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.10%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_death_check) 10.1 2.7 31.4sec 24.4sec 7.2sec 24.21% 0.00% 2.7 (2.7) 9.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_death_check
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.6s / 68.8s
  • trigger_min/max:0.9s / 68.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.7s

Stack Uptimes

  • death_and_madness_death_check_1:24.21%

Spelldata

  • id:322098
  • name:Death and Madness
  • tooltip:If the target dies within {$d=7 seconds}, the Priest gains {$321291m2=20} Insanity.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 2.2 113.9 130.3sec 2.5sec 136.0sec 97.91% 0.00% 95.0 (95.0) 1.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.1s / 341.4s
  • trigger_min/max:0.0s / 18.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.7s

Stack Uptimes

  • death_rot_1:1.06%
  • death_rot_2:1.65%
  • death_rot_3:1.23%
  • death_rot_4:1.24%
  • death_rot_5:1.16%
  • death_rot_6:1.28%
  • death_rot_7:1.24%
  • death_rot_8:1.32%
  • death_rot_9:1.35%
  • death_rot_10:86.38%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 4.7 238.6 68.8sec 1.2sec 62.1sec 97.94% 98.03% 196.9 (196.9) 3.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 347.6s
  • trigger_min/max:0.0s / 16.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.3s

Stack Uptimes

  • everfrost_1:1.58%
  • everfrost_2:1.57%
  • everfrost_3:1.57%
  • everfrost_4:1.56%
  • everfrost_5:1.55%
  • everfrost_6:1.55%
  • everfrost_7:1.54%
  • everfrost_8:1.54%
  • everfrost_9:1.53%
  • everfrost_10:83.96%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 24.5 37.1 12.3sec 4.9sec 10.1sec 82.87% 100.00% 5.1 (5.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 90.0s
  • trigger_min/max:0.0s / 29.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 87.3s

Stack Uptimes

  • festering_wound_1:18.86%
  • festering_wound_2:23.71%
  • festering_wound_3:18.67%
  • festering_wound_4:8.39%
  • festering_wound_5:6.28%
  • festering_wound_6:6.96%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 65.3 5.9sec 4.5sec 295.0sec 98.30% 97.90% 65.3 (65.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 5.9s
  • trigger_min/max:0.8s / 15.6s
  • trigger_pct:100.00%
  • duration_min/max:231.1s / 359.0s

Stack Uptimes

  • lashing_flames_1:98.30%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 65.1 191.0sec 4.5sec 287.8sec 99.19% 0.00% 61.0 (61.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 351.9s
  • trigger_min/max:0.9s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 357.9s

Stack Uptimes

  • razorice_1:1.01%
  • razorice_2:0.83%
  • razorice_3:0.92%
  • razorice_4:0.86%
  • razorice_5:95.57%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 272310.48
Minimum 250123.77
Maximum 298693.10
Spread ( max - min ) 48569.32
Range [ ( max - min ) / 2 * 100% ] 8.92%
Standard Deviation 6994.0289
5th Percentile 261095.04
95th Percentile 284154.47
( 95th Percentile - 5th Percentile ) 23059.43
Mean Distribution
Standard Deviation 80.7655
95.00% Confidence Interval ( 272152.18 - 272468.77 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2535
0.1 Scale Factor Error with Delta=300 417579
0.05 Scale Factor Error with Delta=300 1670316
0.01 Scale Factor Error with Delta=300 41757888
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3767
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 100126805 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.