SimulationCraft 1000-01

for World of Warcraft 10.0.2.46801 PTR (hotfix 2022-11-27/46801, git build cf100c8a43)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

PR_Death_Knight_Frost : 45239 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45239.4 45239.4 53.2 / 0.118% 9282.3 / 20.5% 3528.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.5 12.8 Runic Power 7.17% 49.8 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Death_Knight_Frost 45239
Abomination Limb 0 (582) 0.0% (1.3%) 3.0 120.53sec 57779 46553

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.2413 0.0000 0.00 0.00 0.00% 46552.54 46552.54

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [Z]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [a]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 582 1.3% 38.2 6.91sec 4522 0 Direct 38.2 3583 7194 4522 26.0% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.25 38.25 0.00 0.00 0.00 0.0000 0.0000 172942.67 172942.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.00% 28.30 14 37 3582.59 2324 6779 3582.64 2891 4277 101396 101396 0.00%
crit 26.00% 9.95 1 21 7193.79 4647 13388 7195.73 5061 9867 71547 71547 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 2707 6.0% 189.4 1.85sec 4284 2332 Direct 189.4 3885 7780 4284 26.5% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 189.36 189.36 0.00 0.00 0.00 1.8372 0.0000 811259.24 1158971.32 30.00% 2332.03 2332.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 57.12% 108.16 63 154 3885.16 2482 7514 3885.66 3617 4279 420223 600334 30.00%
crit 26.54% 50.26 24 82 7780.43 4964 15028 7781.10 6941 8746 391036 558637 30.00%
miss 16.34% 30.94 12 57 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 1320 2.9% 185.1 1.85sec 2137 1163 Direct 185.1 1942 3889 2137 26.6% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 185.11 185.11 0.00 0.00 0.00 1.8369 0.0000 395590.35 565143.49 30.00% 1163.42 1163.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.70% 104.95 65 156 1942.37 1241 3757 1942.71 1818 2075 203851 291223 30.00%
crit 26.63% 49.30 24 79 3889.30 2482 7514 3889.64 3414 4390 191739 273920 30.00%
miss 16.67% 30.86 12 53 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Breath of Sindragosa 0 (11717) 0.0% (25.9%) 2.9 120.64sec 1193919 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [d]:2.94
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 11717 25.9% 196.7 1.43sec 17858 0 Direct 196.7 14107 28205 17858 26.6% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 196.68 196.68 0.00 0.00 0.00 0.0000 0.0000 3512182.57 3512182.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.40% 144.35 69 216 14106.61 8053 29392 14122.07 12895 15632 2036311 2036311 0.00%
crit 26.60% 52.33 21 86 28205.49 16105 60150 28235.56 25402 32117 1475871 1475871 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 623 1.4% 2.9 119.58sec 63490 0 Direct 2.8 52972 106445 67314 26.8% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.78 0.00 0.00 0.00 0.0000 0.0000 187006.20 187006.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.18% 2.03 0 3 52971.79 20014 60041 51327.07 0 60041 107707 107707 0.00%
crit 26.82% 0.75 0 3 106444.92 40027 120082 61171.78 0 120082 79299 79299 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8961.60
  • base_dd_max:8961.60
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=25627} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 22 0.0% 1.1 115.34sec 6094 4580 Direct 11.6 445 890 562 26.4% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.07 11.60 0.00 0.00 0.00 1.3312 0.0000 6521.61 6521.61 0.00% 4579.78 4579.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.59% 8.54 0 31 444.91 317 743 332.67 0 652 3797 3797 0.00%
crit 26.41% 3.06 0 15 889.54 635 1438 646.10 0 1287 2724 2724 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [R]:1.07
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Dragon Games Equipment 969 2.1% 6.9 47.12sec 42141 0 Direct 6.9 33171 66341 42175 27.2% 0.0%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.00 0.0000 0.0000 290839.67 415495.84 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.85% 5.02 0 9 33170.70 33171 33171 33135.31 0 33171 166623 238039 29.97%
crit 27.15% 1.87 0 7 66341.40 66341 66341 57707.02 0 66341 124217 177457 26.10%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Frost Fever 1987 4.4% 66.3 4.51sec 8998 0 Periodic 98.7 4766 9539 6037 26.6% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.25 0.00 98.74 98.74 65.25 0.0000 2.9999 596147.38 596147.38 0.00% 2012.51 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 73.37% 72.45 47 98 4766.16 259 10717 4766.18 4435 5124 345302 345302 0.00%
crit 26.63% 26.30 9 50 9539.37 139 20221 9539.56 8127 10971 250845 250845 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 884 (1325) 2.0% (2.9%) 24.6 7.17sec 16235 12085 Direct 24.6 (49.2) 8552 17104 10825 26.6% (26.5%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.59 24.59 0.00 0.00 0.00 1.3434 0.0000 266187.56 266187.56 0.00% 12084.87 12084.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.42% 18.05 1 44 8551.76 5533 15157 8524.30 6421 10361 154399 154399 0.00%
crit 26.58% 6.54 0 21 17104.00 10882 28012 16925.19 0 24234 111789 111789 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:25.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [C]:14.27
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [i]:3.23
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [m]:7.09
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 442 1.0% 24.6 7.17sec 5410 0 Direct 24.6 4276 8554 5410 26.5% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.59 24.59 0.00 0.00 0.00 0.0000 0.0000 133036.22 133036.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.48% 18.07 0 44 4275.54 2721 7579 4261.46 0 5071 77257 77257 0.00%
crit 26.52% 6.52 0 21 8553.88 5625 14390 8471.40 0 12117 55779 55779 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 6888 (8330) 15.2% (18.4%) 66.3 4.51sec 37662 30625 Direct 66.3 (132.4) 24602 49173 31140 26.6% (26.6%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.25 66.25 0.00 0.00 0.00 1.2298 0.0000 2063112.90 2063112.90 0.00% 30624.65 30624.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.39% 48.62 23 76 24601.66 4294 53560 24605.14 21720 27745 1196215 1196215 0.00%
crit 26.61% 17.63 5 38 49173.40 8588 105174 49188.70 39776 59631 866898 866898 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [N]:49.36
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [S]:0.55
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [U]:0.73
  • if_expr:buff.rime.react
    single_target
    [h]:15.61
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1443 3.2% 66.1 4.52sec 6537 0 Direct 66.1 5167 10327 6537 26.5% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.10 66.10 0.00 0.00 0.00 0.0000 0.0000 432091.83 432091.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.46% 48.56 25 76 5167.10 2773 11253 5168.04 4680 5747 250909 250909 0.00%
crit 26.54% 17.55 3 34 10326.62 5547 20277 10327.83 8212 12615 181182 181182 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 1656 (8680) 3.7% (19.2%) 64.5 4.60sec 40335 19855 Direct 64.5 (212.6) 6078 12177 7696 26.5% (55.5%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.50 64.50 0.00 0.00 0.00 2.0315 0.0000 496349.82 709089.25 30.00% 19854.89 19854.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.47% 47.39 22 73 6077.51 3943 12239 6080.88 5555 6737 288004 411445 30.00%
crit 26.53% 17.11 4 33 12177.46 7886 23934 12181.30 9245 15158 208346 297644 30.00%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [P]:23.86
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Q]:47.09
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [T]:9.32
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [g]:11.41
  • if_expr:!variable.pooling_runes&buff.killing_machine.react
    single_target
    [j]:14.63
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 829 1.8% 64.5 4.60sec 3850 0 Direct 64.5 3040 6083 3850 26.6% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.50 64.50 0.00 0.00 0.00 0.0000 0.0000 248334.83 354773.08 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.37% 47.32 22 72 3039.77 1971 6119 3041.36 2740 3362 143842 205494 30.00%
crit 26.63% 17.18 4 36 6083.11 3943 11967 6084.72 4825 7644 104493 149279 30.00%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 4131 9.1% 41.8 7.07sec 29610 0 Direct 41.8 0 29610 29610 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.81 41.81 0.00 0.00 0.00 0.0000 0.0000 1237881.84 1237881.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 41.81 23 65 29610.08 16073 61523 29600.90 26649 33105 1237882 1237882 0.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 2065 4.6% 41.8 7.07sec 14805 0 Direct 41.8 0 14805 14805 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.81 41.81 0.00 0.00 0.00 0.0000 0.0000 618940.92 618940.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 41.81 23 65 14805.04 8036 30761 14800.45 13324 16553 618941 618941 0.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (5527) 0.0% (12.2%) 15.0 20.59sec 110344 87490

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.01 0.00 0.00 0.00 0.00 1.2612 0.0000 0.00 0.00 0.00% 87489.58 87489.58

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [M]:9.42
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [f]:5.60
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 5527 12.2% 243.4 1.23sec 6807 0 Direct 243.4 5373 10782 6807 26.5% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 243.38 243.38 0.00 0.00 0.00 0.0000 0.0000 1656790.08 1656790.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.48% 178.84 116 247 5372.80 1112 14876 5371.06 4622 6042 960894 960894 0.00%
crit 26.52% 64.54 26 96 10782.49 2224 28242 10780.11 8400 13007 695896 695896 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 195 0.4% 20.1 14.47sec 2903 0 Direct 20.1 2296 4593 2903 26.4% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.11 20.11 0.00 0.00 0.00 0.0000 0.0000 58382.20 83405.27 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.60% 14.80 4 30 2296.31 2296 2296 2296.31 2296 2296 33993 48562 30.00%
crit 26.40% 5.31 0 15 4592.63 4593 4593 4579.76 0 4593 24389 34843 29.92%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 195 0.4% 20.1 14.48sec 2905 0 Direct 20.1 2296 4593 2905 26.5% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.12 20.12 0.00 0.00 0.00 0.0000 0.0000 58463.04 83520.76 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.48% 14.79 4 30 2296.31 2296 2296 2296.31 2296 2296 33955 48509 30.00%
crit 26.52% 5.34 0 15 4592.63 4593 4593 4576.09 0 4593 24508 35012 29.89%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2937.96
  • base_dd_max:2937.96
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 1944 / 1061
Claw 641 0.8% 52.3 5.39sec 2005 2005 Direct 52.3 1583 3169 2005 26.6% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.27 52.27 0.00 0.00 0.00 1.0000 0.0000 104784.85 149696.46 30.00% 2004.84 2004.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.41% 38.37 19 54 1583.19 999 3011 1585.16 1407 1783 60744 86780 30.00%
crit 26.59% 13.90 3 27 3168.84 1998 5955 3173.23 2506 3958 44041 62917 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:52.27
  • if_expr:energy>70
Gnaw 1 0.0% 2.9 120.69sec 72 72 Direct 2.9 57 115 72 26.1% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.00 1.0000 0.0000 211.58 302.26 30.00% 72.33 72.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.91% 2.16 0 3 57.38 35 80 56.24 0 77 124 177 29.39%
crit 26.09% 0.76 0 3 114.60 71 155 67.01 0 155 87 125 17.55%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.93
main_hand 1302 1.6% 94.6 2.93sec 2250 1444 Direct 94.6 1777 3555 2250 26.6% 0.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.60 94.60 0.00 0.00 0.00 1.5583 0.0000 212826.38 304045.44 30.00% 1443.76 1443.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.41% 69.45 41 93 1777.08 1110 3308 1779.58 1616 1983 123413 176309 30.00%
crit 26.59% 25.15 7 43 3555.25 2220 6617 3560.49 2918 4415 89413 127736 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Frost
Arcane Torrent 2.1 137.94sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.00 1.2966 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [V]:1.44
  • if_expr:runic_power<60
    single_target
    [l]:0.63
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 85.50sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [X]:0.37
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [Y]:3.58
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 4.8 62.58sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.82 0.00 0.00 0.00 0.00 1.2302 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [O]:4.43
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [k]:0.39
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 7.9 40.09sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.86 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [b]:0.32
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [c]:7.54
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.4 307.21sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [W]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.69sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [e]:2.98
Unholy Strength 20.2 14.48sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 20.16 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5sec 120.5sec 11.8sec 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 124.1s
  • trigger_min/max:120.0s / 124.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 12.1 29.7 25.1sec 7.1sec 19.2sec 77.77% 0.00% 0.0 (0.0) 7.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 76.2s
  • trigger_min/max:0.9s / 54.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.1s

Stack Uptimes

  • bonegrinder_crit_1:25.33%
  • bonegrinder_crit_2:18.90%
  • bonegrinder_crit_3:14.15%
  • bonegrinder_crit_4:10.86%
  • bonegrinder_crit_5:8.52%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 3.6 0.0 70.6sec 70.5sec 9.8sec 11.78% 37.41% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.9s / 316.0s
  • trigger_min/max:9.3s / 316.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.3s

Stack Uptimes

  • bonegrinder_frost_1:11.78%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.9 13.7 120.4sec 15.9sec 19.4sec 19.17% 0.00% 1.3 (1.3) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:259.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:259.91

Trigger Details

  • interval_min/max:120.0s / 130.3s
  • trigger_min/max:0.0s / 115.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:1.48%
  • bound_by_fire_and_blaze_2:4.43%
  • bound_by_fire_and_blaze_3:4.28%
  • bound_by_fire_and_blaze_4:3.72%
  • bound_by_fire_and_blaze_5:2.65%
  • bound_by_fire_and_blaze_6:2.60%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=25627} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.9 0.0 120.6sec 120.6sec 66.8sec 65.48% 0.00% 196.1 (196.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 192.2s
  • trigger_min/max:120.0s / 192.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 188.0s

Stack Uptimes

  • breath_of_sindragosa_1:65.48%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.8 0.0 120.6sec 120.6sec 0.8sec 0.72% 0.00% 6.9 (6.9) 2.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.72
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 129.8s
  • trigger_min/max:120.0s / 129.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s

Stack Uptimes

  • dragon_games_equipment_1:0.72%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 307.2sec 307.2sec 26.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 332.1s
  • trigger_min/max:300.0s / 332.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.72%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 85.5sec 85.5sec 19.5sec 25.89% 0.00% 11.6 (11.6) 3.6

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 226.4s
  • trigger_min/max:0.0s / 226.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:25.89%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 7.5 0.0 40.1sec 40.1sec 12.0sec 30.24% 0.00% 0.0 (0.0) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.1s / 57.0s
  • trigger_min/max:28.1s / 57.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • enduring_strength_1:30.24%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 7.7 16.5 40.5sec 12.0sec 9.6sec 24.68% 98.32% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:23.7s / 132.0s
  • trigger_min/max:0.9s / 123.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:9.92%
  • enduring_strength_builder_2:7.71%
  • enduring_strength_builder_3:4.46%
  • enduring_strength_builder_4:1.85%
  • enduring_strength_builder_5:0.57%
  • enduring_strength_builder_6:0.14%
  • enduring_strength_builder_7:0.03%
  • enduring_strength_builder_8:0.00%
  • enduring_strength_builder_9:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gathering Storm 13.4 127.3 23.1sec 2.1sec 15.2sec 68.22% 86.87% 67.4 (105.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.7s / 84.1s
  • trigger_min/max:0.9s / 44.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.5s

Stack Uptimes

  • gathering_storm_1:2.32%
  • gathering_storm_2:4.99%
  • gathering_storm_3:5.35%
  • gathering_storm_4:3.30%
  • gathering_storm_5:5.44%
  • gathering_storm_6:3.92%
  • gathering_storm_7:3.53%
  • gathering_storm_8:3.73%
  • gathering_storm_9:3.05%
  • gathering_storm_10:32.60%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 7.1 213.6 41.8sec 1.3sec 39.6sec 94.32% 76.73% 199.8 (199.8) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 315.1s
  • trigger_min/max:1.0s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 314.1s

Stack Uptimes

  • icy_talons_1:4.01%
  • icy_talons_2:3.42%
  • icy_talons_3:86.89%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 42.1 7.3 7.1sec 6.0sec 1.7sec 24.08% 27.47% 7.3 (7.3) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 50.0s
  • trigger_min/max:0.0s / 50.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.4s

Stack Uptimes

  • killing_machine_1:24.08%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 7.9 0.0 40.1sec 40.1sec 11.8sec 30.83% 30.44% 0.0 (0.0) 7.5

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.1s / 57.0s
  • trigger_min/max:28.1s / 57.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:30.83%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 7.9 57.1 40.1sec 4.4sec 11.6sec 30.35% 51.05% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.9s / 55.7s
  • trigger_min/max:0.9s / 45.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:2.03%
  • pillar_of_frost_bonus_2:2.39%
  • pillar_of_frost_bonus_3:2.87%
  • pillar_of_frost_bonus_4:2.41%
  • pillar_of_frost_bonus_5:2.53%
  • pillar_of_frost_bonus_6:2.88%
  • pillar_of_frost_bonus_7:2.37%
  • pillar_of_frost_bonus_8:2.32%
  • pillar_of_frost_bonus_9:2.15%
  • pillar_of_frost_bonus_10:1.81%
  • pillar_of_frost_bonus_11:1.68%
  • pillar_of_frost_bonus_12:1.45%
  • pillar_of_frost_bonus_13:1.13%
  • pillar_of_frost_bonus_14:0.81%
  • pillar_of_frost_bonus_15:0.46%
  • pillar_of_frost_bonus_16:0.30%
  • pillar_of_frost_bonus_17:0.24%
  • pillar_of_frost_bonus_18:0.19%
  • pillar_of_frost_bonus_19:0.17%
  • pillar_of_frost_bonus_20:0.11%
  • pillar_of_frost_bonus_21:0.04%
  • pillar_of_frost_bonus_22:0.01%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Remorseless Winter 13.5 1.5 23.0sec 20.6sec 16.8sec 75.90% 0.00% 222.3 (222.3) 12.8

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 82.6s
  • trigger_min/max:20.0s / 27.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.5s

Stack Uptimes

  • remorseless_winter_1:75.90%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 66.4 6.1 4.5sec 4.2sec 1.5sec 33.34% 99.78% 6.1 (6.1) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 43.2s
  • trigger_min/max:0.0s / 43.2s
  • trigger_pct:63.06%
  • duration_min/max:0.0s / 17.5s

Stack Uptimes

  • rime_1:33.34%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.8 14.5 21.7sec 10.3sec 11.7sec 53.94% 0.00% 14.5 (14.5) 13.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 123.1s
  • trigger_min/max:0.9s / 118.3s
  • trigger_pct:15.00%
  • duration_min/max:0.0s / 76.4s

Stack Uptimes

  • rune_mastery_1:53.94%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 12.8 7.3 23.3sec 14.5sec 10.2sec 43.24% 42.36% 7.3 (7.3) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 89.5s
  • trigger_min/max:0.0s / 64.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.0s

Stack Uptimes

  • rune_of_hysteria_1:43.24%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Strength 8.4 11.7 36.0sec 14.5sec 23.6sec 66.26% 0.00% 11.7 (11.7) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 164.2s
  • trigger_min/max:0.0s / 64.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 138.1s

Stack Uptimes

  • unholy_strength_1:66.26%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 7.1 213.6 41.8sec 1.3sec 39.6sec 94.32% 89.51% 199.8 (199.8) 6.2

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 315.1s
  • trigger_min/max:1.0s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 314.1s

Stack Uptimes

  • unleashed_frenzy_1:4.01%
  • unleashed_frenzy_2:3.42%
  • unleashed_frenzy_3:86.89%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=6 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.4 10.0 47.0 11.1s 1.3s 131.6s
windfury_totem_extra_attack_oh 22.2 7.0 42.0 13.1s 1.3s 140.5s
Killing Machine spent on Obliterate 41.8 23.0 65.0 7.1s 0.9s 54.9s
Killing Machine: Critical auto attacks 42.1 23.0 66.0 7.1s 1.3s 50.0s
Killing Machine wasted: Critical auto attacks 7.3 0.0 20.0 35.7s 1.3s 295.0s
Rune ready 224.8 159.0 289.0 1.5s 0.0s 13.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 2.97% 0.00% 15.14% 0.7s 0.0s 6.4s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=356849)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0671.249 / 0.9893.10923.106
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
11.81931.44159.418 / 57.81592.105155.913

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Remorseless Winter0.7310.0017.8138.2930.88222.590
Horn of Winter19.1760.001144.82367.1290.000176.701
Death and Decay86.1960.364237.57227.7970.000237.572
Empower Rune Weapon25.79621.38330.2080.0070.00030.208
Abomination Limb0.7800.0014.1330.9240.0004.844
Pillar of Frost1.8910.00116.13811.2570.33628.861
Breath of Sindragosa0.8170.00172.1811.2620.00072.482
Raise Dead0.7630.0015.0651.3600.3065.951

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Frost
Breath of SindragosaRune10.6710.594.71%0.990.080.74%
Empower Rune WeaponRunic Power19.1288.222.29%4.617.387.72%
Empower Rune WeaponRune19.1219.068.48%1.000.060.31%
Frost FeverRunic Power32.20153.233.98%4.767.784.83%
Horn of WinterRunic Power4.82120.503.13%25.000.000.00%
Horn of WinterRune9.649.644.29%1.000.000.00%
Murderous EfficiencyRune20.9120.919.30%1.000.000.00%
Rage of the Frozen ChampionRunic Power66.10513.5513.35%7.7715.292.89%
Rune RegenerationRune89.8389.8339.96%1.000.000.00%
Rune of HysteriaRunic Power162.66332.758.65%2.0528.607.92%
Runic AttenuationRunic Power71.20343.578.93%4.8312.433.49%
Runic EmpowermentRune75.0974.7733.26%1.000.320.42%
Arcane TorrentRunic Power2.0641.261.07%20.000.000.00%
Death and DecayRunic Power1.0710.700.28%10.000.000.00%
Howling BlastRunic Power66.251.490.04%0.020.000.00%
ObliterateRunic Power106.302095.6054.47%19.7130.491.43%
Remorseless WinterRunic Power15.01146.513.81%9.763.632.42%
pet - ghoul
energy_regenEnergy1114.741917.21100.00%1.72169.758.13%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 196.133138.1416.0015.961119.19
Death and DecayRune 1.071.071.001.006094.26
Frost StrikeRunic Power 24.59614.7425.0025.00649.42
Howling BlastRune 66.250.150.000.0016801194.51
ObliterateRune 106.30212.612.003.3012236.10
Remorseless WinterRune 15.0115.011.001.00110343.81
pet - ghoul
ClawEnergy 52.272090.6940.0040.0050.12
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 12.82 12.51 105.6 94.5 0.1 144.0
Rune 6.0 0.75 0.76 0.0 2.0 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Frost Damage Per Second
Count 7499
Mean 45239.41
Minimum 37441.81
Maximum 53939.05
Spread ( max - min ) 16497.24
Range [ ( max - min ) / 2 * 100% ] 18.23%
Standard Deviation 2352.4719
5th Percentile 41255.40
95th Percentile 49100.11
( 95th Percentile - 5th Percentile ) 7844.71
Mean Distribution
Standard Deviation 27.1658
95.00% Confidence Interval ( 45186.17 - 45292.65 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 104
0.1% Error 10388
0.1 Scale Factor Error with Delta=300 47243
0.05 Scale Factor Error with Delta=300 188970
0.01 Scale Factor Error with Delta=300 4724247
Priority Target DPS
PR_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 45239.41
Minimum 37441.81
Maximum 53939.05
Spread ( max - min ) 16497.24
Range [ ( max - min ) / 2 * 100% ] 18.23%
Standard Deviation 2352.4719
5th Percentile 41255.40
95th Percentile 49100.11
( 95th Percentile - 5th Percentile ) 7844.71
Mean Distribution
Standard Deviation 27.1658
95.00% Confidence Interval ( 45186.17 - 45292.65 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 104
0.1% Error 10388
0.1 Scale Factor Error with Delta=300 47243
0.05 Scale Factor Error with Delta=300 188970
0.01 Scale Factor Error with Delta=300 4724247
DPS(e)
PR_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 45239.41
Minimum 37441.81
Maximum 53939.05
Spread ( max - min ) 16497.24
Range [ ( max - min ) / 2 * 100% ] 18.23%
Damage
PR_Death_Knight_Frost Damage
Count 7499
Mean 13242060.95
Minimum 9020437.79
Maximum 17352032.86
Spread ( max - min ) 8331595.07
Range [ ( max - min ) / 2 * 100% ] 31.46%
DTPS
PR_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
5 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
6 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Estimates a trinkets value by comparing the cooldown of the trinket, divided by the duration of the buff it provides. Has a strength modifier to give a higher priority to strength trinkets, as well as a modifier for if a trinket will or will not sync with cooldowns.
7 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
8 0.00 variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
9 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
A 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
C 14.27 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
D 0.00 call_action_list,name=trinkets
Choose Action list to run
E 0.00 call_action_list,name=cooldowns
F 0.00 call_action_list,name=racials
G 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
H 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
I 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
J 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
L 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
M 9.42 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
N 49.36 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
O 4.43 horn_of_winter,if=rune<2&runic_power.deficit>25
P 23.86 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
Q 47.09 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
R 1.07 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
S 0.55 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
T 9.32 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
U 0.73 howling_blast,if=buff.rime.react
V 1.44 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
W 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
X 0.37 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
Y 3.58 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
Z 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
a 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
b 0.32 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
c 7.54 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
d 2.94 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
e 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
f 5.60 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
0.00 frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
g 11.41 obliterate,if=!variable.pooling_runes&buff.killing_machine.react
h 15.61 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
i 3.23 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
j 14.63 obliterate,if=!variable.pooling_runes
k 0.39 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
l 0.63 arcane_torrent,if=runic_power.deficit>20
m 7.09 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
n 2.85 use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
o 2.77 use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
p 0.09 use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
q 0.01 use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABaefhjhjdnYcWNQNPQQNNQQNPQNTNMTTNOoPTNTNQPNQNMYPNcPQQPQNPNQNQNTMPQNQNVOPNQNQNQMcQQPQRSjjhmmjfhmjmjmjhmjhgaCefhdncPNQOQQNQYPMQoNQSPQRQSjjhjmfmjchgmghkgCCCghfijhijhiighigijcfhighijghijghijfijilghigijhahCefdnPcNQNPNQNQNOTQNMoPNQNYPNPNQNQNPQNPcMQNPQNQUP

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 2 augmentation PR_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 4 trinket_1_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 5 trinket_2_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 6 trinket_priority Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 7 rw_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 8 2h_check Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 9 trinket_1_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat A trinket_2_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default B auto_attack Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 cooldowns a abomination_limb Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, static_empowerment
0:01.036 cooldowns e raise_dead Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, rime, static_empowerment(2)
0:01.036 single_target f remorseless_winter Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune
bloodlust, abomination_limb, rime, static_empowerment(2)
0:02.071 single_target h howling_blast Fluffy_Pillow 15.0/144: 10% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, remorseless_winter, rime, static_empowerment(3)
0:03.107 single_target j obliterate Fluffy_Pillow 23.0/144: 16% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, gathering_storm, remorseless_winter, static_empowerment(4)
0:04.145 single_target h howling_blast Fluffy_Pillow 43.0/144: 30% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, gathering_storm(3), remorseless_winter, rime, static_empowerment(5)
0:05.182 single_target j obliterate Fluffy_Pillow 51.0/144: 35% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, gathering_storm(4), remorseless_winter, static_empowerment(5)
0:06.220 cooldowns d breath_of_sindragosa Fluffy_Pillow 77.2/144: 54% runic_power
1.0/6: 17% rune
bloodlust, abomination_limb, gathering_storm(6), remorseless_winter, rime, rune_of_hysteria, static_empowerment(5)
0:06.220 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 77.2/144: 54% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(6), remorseless_winter, rime, rune_of_hysteria, static_empowerment(5)
0:06.220 cooldowns Y empower_rune_weapon Fluffy_Pillow 77.2/144: 54% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(6), remorseless_winter, rime, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
0:06.220 cooldowns c pillar_of_frost Fluffy_Pillow 83.4/144: 58% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), remorseless_winter, rime, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
0:06.220 cooldowns W potion Fluffy_Pillow 83.4/144: 58% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), pillar_of_frost, remorseless_winter, rime, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5)
0:06.220 breath N howling_blast Fluffy_Pillow 83.4/144: 58% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), pillar_of_frost, remorseless_winter, rime, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.121 breath Q obliterate Fluffy_Pillow 93.3/144: 65% runic_power
4.0/6: 67% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.021 breath N howling_blast Fluffy_Pillow 102.1/144: 71% runic_power
2.0/6: 33% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, enduring_strength_builder, unleashed_frenzy, bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.921 breath P obliterate Fluffy_Pillow 102.2/144: 71% runic_power
3.0/6: 50% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, enduring_strength_builder, unleashed_frenzy(2), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.822 breath Q obliterate Fluffy_Pillow 111.0/144: 77% runic_power
5.0/6: 83% rune
bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.723 breath Q obliterate Fluffy_Pillow 126.0/144: 88% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.624 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.526 breath N howling_blast Fluffy_Pillow 121.9/144: 85% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.425 breath Q obliterate Fluffy_Pillow 115.8/144: 80% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.326 breath Q obliterate Fluffy_Pillow 124.6/144: 87% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.225 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.125 breath P obliterate Fluffy_Pillow 137.9/144: 96% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, bonegrinder_crit, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.023 breath Q obliterate Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(19), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.923 breath N howling_blast Fluffy_Pillow 134.2/144: 93% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(21), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.823 Waiting     0.478 sec 128.0/144: 89% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.301 breath T obliterate Fluffy_Pillow 118.2/144: 82% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.202 breath N howling_blast Fluffy_Pillow 143.0/144: 99% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.103 breath M remorseless_winter Fluffy_Pillow 128.0/144: 89% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.004 Waiting     0.301 sec 128.0/144: 89% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:22.305 breath T obliterate Fluffy_Pillow 112.0/144: 78% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:23.205 Waiting     0.092 sec 132.0/144: 92% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:23.297 breath T obliterate Fluffy_Pillow 116.0/144: 81% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:24.196 breath N howling_blast Fluffy_Pillow 136.0/144: 94% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:25.096 Waiting     0.222 sec 133.0/144: 92% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:25.318 breath O horn_of_winter Fluffy_Pillow 117.0/144: 81% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:26.218 Waiting     0.094 sec 144.0/144: 100% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:26.312 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:26.312 breath P obliterate Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.347 Waiting     0.950 sec 128.0/144: 89% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:28.297 breath T obliterate Fluffy_Pillow 112.0/144: 78% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:29.332 breath N howling_blast Fluffy_Pillow 116.0/144: 81% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:30.370 breath T obliterate Fluffy_Pillow 108.0/144: 75% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:31.407 breath N howling_blast Fluffy_Pillow 112.0/144: 78% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:32.443 Waiting     0.799 sec 104.0/144: 72% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:33.242 breath Q obliterate Fluffy_Pillow 93.0/144: 65% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:34.277 Waiting     0.931 sec 97.0/144: 67% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:35.208 breath P obliterate Fluffy_Pillow 107.0/144: 74% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:36.244 breath N howling_blast Fluffy_Pillow 95.0/144: 66% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
0:37.279 breath Q obliterate Fluffy_Pillow 87.0/144: 60% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
0:38.314 breath N howling_blast Fluffy_Pillow 96.0/144: 67% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
0:39.349 Waiting     1.585 sec 88.0/144: 61% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:40.934 breath M remorseless_winter Fluffy_Pillow 72.0/144: 50% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:41.307 cooldowns Y empower_rune_weapon Fluffy_Pillow 68.4/144: 48% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:42.449 breath P obliterate Fluffy_Pillow 58.6/144: 41% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:43.619 breath N howling_blast Fluffy_Pillow 73.6/144: 51% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:44.790 cooldowns c pillar_of_frost Fluffy_Pillow 67.5/144: 47% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:44.790 breath P obliterate Fluffy_Pillow 67.5/144: 47% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:45.960 breath Q obliterate Fluffy_Pillow 76.3/144: 53% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:47.130 breath Q obliterate Fluffy_Pillow 103.7/144: 72% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:48.301 breath P obliterate Fluffy_Pillow 102.7/144: 71% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:49.471 breath Q obliterate Fluffy_Pillow 111.5/144: 77% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:50.640 breath N howling_blast Fluffy_Pillow 120.3/144: 84% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:51.810 breath P obliterate Fluffy_Pillow 120.4/144: 84% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:52.981 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), static_empowerment(5)
0:54.152 breath Q obliterate Fluffy_Pillow 120.0/144: 83% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), static_empowerment(5)
0:55.324 breath N howling_blast Fluffy_Pillow 113.0/144: 78% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(16), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), static_empowerment(5)
0:56.495 breath Q obliterate Fluffy_Pillow 120.0/144: 83% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), static_empowerment(5)
0:57.665 breath N howling_blast Fluffy_Pillow 124.0/144: 86% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:58.836 breath T obliterate Fluffy_Pillow 116.0/144: 81% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:00.007 Waiting     0.940 sec 125.0/144: 87% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:00.947 breath M remorseless_winter Fluffy_Pillow 109.0/144: 76% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:02.274 breath P obliterate Fluffy_Pillow 92.0/144: 64% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:03.620 Waiting     0.285 sec 96.0/144: 67% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:03.905 breath Q obliterate Fluffy_Pillow 96.0/144: 67% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:05.248 breath N howling_blast Fluffy_Pillow 84.0/144: 58% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:06.594 breath Q obliterate Fluffy_Pillow 76.0/144: 53% runic_power
3.0/6: 50% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:07.937 breath N howling_blast Fluffy_Pillow 80.0/144: 56% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:09.281 breath V arcane_torrent Fluffy_Pillow 56.0/144: 39% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:10.627 breath O horn_of_winter Fluffy_Pillow 65.0/144: 45% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:11.972 breath P obliterate Fluffy_Pillow 79.0/144: 55% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:13.317 breath N howling_blast Fluffy_Pillow 67.0/144: 47% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:14.662 breath Q obliterate Fluffy_Pillow 59.0/144: 41% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:16.007 breath N howling_blast Fluffy_Pillow 68.0/144: 47% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
1:17.351 breath Q obliterate Fluffy_Pillow 49.0/144: 34% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:18.695 breath N howling_blast Fluffy_Pillow 57.8/144: 40% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:20.039 breath Q obliterate Fluffy_Pillow 51.7/144: 36% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:21.384 breath M remorseless_winter Fluffy_Pillow 50.7/144: 35% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:22.728 cooldowns c pillar_of_frost Fluffy_Pillow 47.1/144: 33% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:22.790 breath Q obliterate Fluffy_Pillow 47.1/144: 33% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:24.134 breath Q obliterate Fluffy_Pillow 68.3/144: 47% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:25.479 Waiting     0.826 sec 61.1/144: 42% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(4), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
1:26.305 breath P obliterate Fluffy_Pillow 45.1/144: 31% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(4), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
1:27.650 Waiting     1.630 sec 54.1/144: 38% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
1:29.280 breath Q obliterate Fluffy_Pillow 22.1/144: 15% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
1:30.627 breath R death_and_decay Fluffy_Pillow 26.1/144: 18% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
1:31.972 breath S howling_blast Fluffy_Pillow 20.1/144: 14% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
1:33.316 single_target j obliterate Fluffy_Pillow 12.1/144: 8% runic_power
3.0/6: 50% rune
unholy_strength, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:34.661 single_target j obliterate Fluffy_Pillow 36.9/144: 26% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:36.006 single_target h howling_blast Fluffy_Pillow 67.9/144: 47% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:37.349 single_target m frost_strike Fluffy_Pillow 77.8/144: 54% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:38.694 single_target m frost_strike Fluffy_Pillow 59.0/144: 41% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:40.037 single_target j obliterate Fluffy_Pillow 34.0/144: 24% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:41.381 single_target f remorseless_winter Fluffy_Pillow 70.0/144: 49% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:42.729 single_target h howling_blast Fluffy_Pillow 80.0/144: 56% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:44.072 single_target m frost_strike Fluffy_Pillow 88.0/144: 61% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:45.417 single_target j obliterate Fluffy_Pillow 68.0/144: 47% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm, icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:46.764 single_target m frost_strike Fluffy_Pillow 88.0/144: 61% runic_power
0.0/6: 0% rune
unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:48.108 single_target j obliterate Fluffy_Pillow 68.0/144: 47% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:49.452 single_target m frost_strike Fluffy_Pillow 88.0/144: 61% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
1:50.799 single_target j obliterate Fluffy_Pillow 73.0/144: 51% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
1:52.144 single_target h howling_blast Fluffy_Pillow 93.0/144: 65% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:53.488 single_target m frost_strike Fluffy_Pillow 101.0/144: 70% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:54.832 single_target j obliterate Fluffy_Pillow 76.0/144: 53% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
1:56.177 single_target h howling_blast Fluffy_Pillow 96.0/144: 67% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
1:57.522 Waiting     1.932 sec 104.0/144: 72% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
1:59.454 single_target g obliterate Fluffy_Pillow 109.0/144: 76% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:00.798 cooldowns a abomination_limb Fluffy_Pillow 129.0/144: 90% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, rime, bonegrinder_crit(3), static_empowerment(5)
2:02.143 default C frost_strike Fluffy_Pillow 134.0/144: 93% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, rime, bonegrinder_crit(3), static_empowerment(5)
2:03.488 cooldowns e raise_dead Fluffy_Pillow 109.0/144: 76% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons, rime, bonegrinder_crit(3), unleashed_frenzy, static_empowerment(5)
2:03.488 single_target f remorseless_winter Fluffy_Pillow 109.0/144: 76% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons, rime, bonegrinder_crit(3), unleashed_frenzy, static_empowerment(5)
2:04.833 single_target h howling_blast Fluffy_Pillow 119.0/144: 83% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy, static_empowerment(5)
2:06.177 cooldowns d breath_of_sindragosa Fluffy_Pillow 127.0/144: 88% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, gathering_storm, icy_talons, killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy, static_empowerment(5)
2:06.220 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 127.0/144: 88% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons, killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy, static_empowerment(5)
2:06.220 cooldowns c pillar_of_frost Fluffy_Pillow 127.0/144: 88% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons, killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy, bound_by_fire_and_blaze, static_empowerment(5)
2:06.220 breath P obliterate Fluffy_Pillow 127.0/144: 88% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm, icy_talons, killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy, bound_by_fire_and_blaze, static_empowerment(5)
2:07.566 breath N howling_blast Fluffy_Pillow 133.0/144: 92% runic_power
2.0/6: 33% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(2), bound_by_fire_and_blaze(2), static_empowerment(5)
2:08.911 breath Q obliterate Fluffy_Pillow 125.0/144: 87% runic_power
3.0/6: 50% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:10.256 breath O horn_of_winter Fluffy_Pillow 112.0/144: 78% runic_power
1.0/6: 17% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:11.602 breath Q obliterate Fluffy_Pillow 121.0/144: 84% runic_power
4.0/6: 67% rune
unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:12.946 breath Q obliterate Fluffy_Pillow 125.0/144: 87% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
2:14.292 breath N howling_blast Fluffy_Pillow 117.0/144: 81% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:15.636 Waiting     1.684 sec 109.0/144: 76% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:17.320 breath Q obliterate Fluffy_Pillow 77.0/144: 53% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:18.663 Waiting     1.629 sec 86.0/144: 60% runic_power
1.0/6: 17% rune
breath_of_sindragosa, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:20.292 cooldowns Y empower_rune_weapon Fluffy_Pillow 64.0/144: 44% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:20.292 breath P obliterate Fluffy_Pillow 69.0/144: 48% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:21.460 Waiting     1.861 sec 78.0/144: 54% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:23.321 breath M remorseless_winter Fluffy_Pillow 46.0/144: 32% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:24.659 Waiting     0.662 sec 40.0/144: 28% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
2:25.321 breath Q obliterate Fluffy_Pillow 30.2/144: 21% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
2:26.492 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 39.0/144: 27% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:26.492 breath N howling_blast Fluffy_Pillow 39.0/144: 27% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, rune_of_hysteria, static_empowerment(5)
2:27.661 Waiting     0.620 sec 32.9/144: 23% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:28.281 breath Q obliterate Fluffy_Pillow 16.9/144: 12% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:29.451 breath S howling_blast Fluffy_Pillow 31.9/144: 22% runic_power
0.0/6: 0% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:30.621 Waiting     0.777 sec 38.2/144: 27% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:31.398 breath P obliterate Fluffy_Pillow 22.2/144: 15% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:32.568 breath Q obliterate Fluffy_Pillow 31.0/144: 22% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:33.739 Waiting     0.484 sec 35.0/144: 24% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:34.223 breath R death_and_decay Fluffy_Pillow 19.0/144: 13% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:35.394 Waiting     0.726 sec 28.0/144: 19% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:36.120 breath Q obliterate Fluffy_Pillow 28.0/144: 19% runic_power
2.0/6: 33% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:37.290 breath S howling_blast Fluffy_Pillow 16.0/144: 11% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:38.461 single_target j obliterate Fluffy_Pillow 8.0/144: 6% runic_power
3.0/6: 50% rune
unholy_strength, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
2:39.631 single_target j obliterate Fluffy_Pillow 28.0/144: 19% runic_power
2.0/6: 33% rune
unholy_strength, empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:40.801 single_target h howling_blast Fluffy_Pillow 58.0/144: 40% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:42.145 single_target j obliterate Fluffy_Pillow 66.0/144: 46% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:43.489 single_target m frost_strike Fluffy_Pillow 86.0/144: 60% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:44.832 single_target f remorseless_winter Fluffy_Pillow 61.0/144: 42% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:46.178 single_target m frost_strike Fluffy_Pillow 71.0/144: 49% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:47.521 single_target j obliterate Fluffy_Pillow 46.0/144: 32% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:48.865 cooldowns c pillar_of_frost Fluffy_Pillow 71.0/144: 49% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, rime, unleashed_frenzy(3), static_empowerment(5)
2:48.865 single_target h howling_blast Fluffy_Pillow 71.0/144: 49% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(2), icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, rime, unleashed_frenzy(3), static_empowerment(5)
2:50.212 single_target g obliterate Fluffy_Pillow 84.0/144: 58% runic_power
2.0/6: 33% rune
rune_mastery, gathering_storm(3), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
2:51.557 single_target m frost_strike Fluffy_Pillow 104.0/144: 72% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
2:52.903 single_target g obliterate Fluffy_Pillow 79.0/144: 55% runic_power
2.0/6: 33% rune
rune_mastery, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
2:54.246 single_target h howling_blast Fluffy_Pillow 104.0/144: 72% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
2:55.592 single_target k horn_of_winter Fluffy_Pillow 112.0/144: 78% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(8), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
2:56.937 single_target g obliterate Fluffy_Pillow 142.0/144: 99% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
2:58.283 default C frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
3.0/6: 50% rune
pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(3), enduring_strength_builder(3), static_empowerment(5)
2:59.626 default C frost_strike Fluffy_Pillow 124.0/144: 86% runic_power
4.0/6: 67% rune
icy_talons, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy, static_empowerment(5)
3:00.971 default C frost_strike Fluffy_Pillow 99.0/144: 69% runic_power
4.0/6: 67% rune
icy_talons(2), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(2), rune_of_hysteria, static_empowerment(5)
3:02.316 single_target g obliterate Fluffy_Pillow 74.0/144: 51% runic_power
6.0/6: 100% rune
icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:03.659 single_target h howling_blast Fluffy_Pillow 98.8/144: 69% runic_power
4.0/6: 67% rune
icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:05.003 single_target f remorseless_winter Fluffy_Pillow 114.9/144: 80% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:06.347 single_target i frost_strike Fluffy_Pillow 127.3/144: 88% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:07.692 single_target j obliterate Fluffy_Pillow 102.3/144: 71% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:09.038 single_target h howling_blast Fluffy_Pillow 127.1/144: 88% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:10.383 single_target i frost_strike Fluffy_Pillow 135.1/144: 94% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:11.729 single_target j obliterate Fluffy_Pillow 110.1/144: 76% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:13.073 single_target h howling_blast Fluffy_Pillow 130.1/144: 90% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, rime, unleashed_frenzy(3), static_empowerment(5)
3:14.416 single_target i frost_strike Fluffy_Pillow 143.1/144: 99% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(6), icy_talons(3), remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:15.758 single_target i frost_strike Fluffy_Pillow 123.1/144: 86% runic_power
2.0/6: 33% rune
unholy_strength, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:17.103 single_target g obliterate Fluffy_Pillow 98.1/144: 68% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, unleashed_frenzy(3), static_empowerment(5)
3:18.447 single_target h howling_blast Fluffy_Pillow 123.1/144: 86% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:19.791 single_target i frost_strike Fluffy_Pillow 133.0/144: 92% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:21.136 single_target g obliterate Fluffy_Pillow 108.0/144: 75% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:22.480 single_target i frost_strike Fluffy_Pillow 132.8/144: 92% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:23.826 single_target j obliterate Fluffy_Pillow 114.0/144: 79% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:25.171 cooldowns c pillar_of_frost Fluffy_Pillow 138.8/144: 96% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:25.171 single_target f remorseless_winter Fluffy_Pillow 138.8/144: 96% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), pillar_of_frost, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:26.515 single_target h howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:27.859 single_target i frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:29.203 single_target g obliterate Fluffy_Pillow 125.2/144: 87% runic_power
4.0/6: 67% rune
unholy_strength, gathering_storm, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
3:30.548 single_target h howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:31.892 single_target i frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:33.237 single_target j obliterate Fluffy_Pillow 119.0/144: 83% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, gathering_storm(4), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:34.583 single_target g obliterate Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, gathering_storm(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
3:35.926 single_target h howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
3:37.271 single_target i frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
rune_mastery, gathering_storm(9), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:38.615 single_target j obliterate Fluffy_Pillow 119.0/144: 83% runic_power
4.0/6: 67% rune
rune_mastery, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:39.960 single_target g obliterate Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), killing_machine, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:41.305 single_target h howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:42.649 single_target i frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:43.995 single_target j obliterate Fluffy_Pillow 119.0/144: 83% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:45.340 single_target f remorseless_winter Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:46.684 single_target i frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
0.0/6: 0% rune
icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:48.027 single_target j obliterate Fluffy_Pillow 119.0/144: 83% runic_power
2.0/6: 33% rune
icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
3:49.372 single_target i frost_strike Fluffy_Pillow 139.0/144: 97% runic_power
0.0/6: 0% rune
gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
3:50.718 single_target l arcane_torrent Fluffy_Pillow 114.0/144: 79% runic_power
1.0/6: 17% rune
gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:52.060 single_target g obliterate Fluffy_Pillow 134.0/144: 93% runic_power
2.0/6: 33% rune
gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, unleashed_frenzy(3), static_empowerment(5)
3:53.404 single_target h howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:54.751 single_target i frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:56.096 single_target g obliterate Fluffy_Pillow 124.0/144: 86% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
3:57.442 single_target i frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
3:58.788 single_target j obliterate Fluffy_Pillow 119.0/144: 83% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:00.133 single_target h howling_blast Fluffy_Pillow 139.0/144: 97% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:01.477 cooldowns a abomination_limb Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:02.823 single_target h howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:04.168 default C frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, abomination_limb, killing_machine, bonegrinder_crit(2), static_empowerment(5)
4:05.512 cooldowns e raise_dead Fluffy_Pillow 119.0/144: 83% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons, killing_machine, bonegrinder_crit(2), unleashed_frenzy, static_empowerment(5)
4:05.512 single_target f remorseless_winter Fluffy_Pillow 119.0/144: 83% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons, killing_machine, bonegrinder_crit(2), unleashed_frenzy, static_empowerment(5)
4:06.855 cooldowns d breath_of_sindragosa Fluffy_Pillow 129.0/144: 90% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, icy_talons, killing_machine, remorseless_winter, unleashed_frenzy, static_empowerment(5)
4:06.855 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 129.0/144: 90% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons, killing_machine, remorseless_winter, unleashed_frenzy, static_empowerment(5)
4:06.855 breath P obliterate Fluffy_Pillow 129.0/144: 90% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons, killing_machine, remorseless_winter, unleashed_frenzy, bound_by_fire_and_blaze, static_empowerment(5)
4:08.199 cooldowns c pillar_of_frost Fluffy_Pillow 133.0/144: 92% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(2), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(2), bound_by_fire_and_blaze(2), static_empowerment(5)
4:08.199 breath N howling_blast Fluffy_Pillow 133.0/144: 92% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(2), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(2), bound_by_fire_and_blaze(2), static_empowerment(5)
4:09.543 breath Q obliterate Fluffy_Pillow 125.0/144: 87% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
4:10.888 breath N howling_blast Fluffy_Pillow 112.0/144: 78% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
4:12.232 breath P obliterate Fluffy_Pillow 104.0/144: 72% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:13.575 breath N howling_blast Fluffy_Pillow 113.0/144: 78% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:14.920 breath Q obliterate Fluffy_Pillow 94.0/144: 65% runic_power
5.0/6: 83% rune
unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:16.265 breath N howling_blast Fluffy_Pillow 98.0/144: 68% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
4:17.610 breath Q obliterate Fluffy_Pillow 90.0/144: 62% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:18.956 breath N howling_blast Fluffy_Pillow 82.8/144: 57% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:20.300 breath O horn_of_winter Fluffy_Pillow 89.1/144: 62% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:21.644 breath T obliterate Fluffy_Pillow 104.1/144: 72% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:22.989 breath Q obliterate Fluffy_Pillow 96.9/144: 67% runic_power
3.0/6: 50% rune
breath_of_sindragosa, icy_talons(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:24.332 breath N howling_blast Fluffy_Pillow 111.9/144: 78% runic_power
3.0/6: 50% rune
breath_of_sindragosa, icy_talons(3), rime, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), rune_of_hysteria, static_empowerment(5)
4:25.675 breath M remorseless_winter Fluffy_Pillow 105.8/144: 74% runic_power
4.0/6: 67% rune
breath_of_sindragosa, icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:27.020 trinkets o use_item_dragon_games_equipment Fluffy_Pillow 83.8/144: 58% runic_power
3.0/6: 50% rune
breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:27.020 breath P obliterate Fluffy_Pillow 83.8/144: 58% runic_power
3.0/6: 50% rune
breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, enduring_strength, unleashed_frenzy(3), dragon_games_equipment, static_empowerment(5)
4:28.365 breath N howling_blast Fluffy_Pillow 87.8/144: 61% runic_power
1.0/6: 17% rune
breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:29.710 breath Q obliterate Fluffy_Pillow 89.8/144: 62% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(3), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:31.054 breath N howling_blast Fluffy_Pillow 77.8/144: 54% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:31.891 cooldowns Y empower_rune_weapon Fluffy_Pillow 69.8/144: 49% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:32.399 breath P obliterate Fluffy_Pillow 74.8/144: 52% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, unleashed_frenzy(3), static_empowerment(5)
4:33.571 breath N howling_blast Fluffy_Pillow 78.8/144: 55% runic_power
3.0/6: 50% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:34.739 breath P obliterate Fluffy_Pillow 75.8/144: 53% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:35.909 breath N howling_blast Fluffy_Pillow 68.8/144: 48% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
4:37.079 breath Q obliterate Fluffy_Pillow 70.8/144: 49% runic_power
5.0/6: 83% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
4:38.250 breath N howling_blast Fluffy_Pillow 84.8/144: 59% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
4:39.419 breath Q obliterate Fluffy_Pillow 76.8/144: 53% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
4:40.592 breath N howling_blast Fluffy_Pillow 80.8/144: 56% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
4:41.763 breath P obliterate Fluffy_Pillow 77.8/144: 54% runic_power
4.0/6: 67% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
4:42.934 breath Q obliterate Fluffy_Pillow 70.8/144: 49% runic_power
3.0/6: 50% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:44.104 breath N howling_blast Fluffy_Pillow 79.8/144: 55% runic_power
1.0/6: 17% rune
unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:45.275 breath P obliterate Fluffy_Pillow 71.8/144: 50% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
4:46.445 cooldowns c pillar_of_frost Fluffy_Pillow 75.8/144: 53% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
4:46.445 Waiting     0.503 sec 75.8/144: 53% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
4:46.948 breath M remorseless_winter Fluffy_Pillow 66.0/144: 46% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:48.117 Waiting     1.508 sec 62.4/144: 43% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:49.625 breath Q obliterate Fluffy_Pillow 46.4/144: 32% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:50.794 breath N howling_blast Fluffy_Pillow 55.2/144: 38% runic_power
0.0/6: 0% rune
rune_mastery, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:51.966 Waiting     0.811 sec 45.6/144: 32% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:52.777 breath P obliterate Fluffy_Pillow 45.6/144: 32% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:54.122 breath Q obliterate Fluffy_Pillow 38.4/144: 27% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
4:55.466 breath N howling_blast Fluffy_Pillow 47.2/144: 33% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
4:56.810 breath Q obliterate Fluffy_Pillow 44.2/144: 31% runic_power
2.0/6: 33% rune
breath_of_sindragosa, gathering_storm(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
4:58.155 breath U howling_blast Fluffy_Pillow 32.2/144: 22% runic_power
1.0/6: 17% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
4:59.500 breath P obliterate Fluffy_Pillow 29.2/144: 20% runic_power
2.0/6: 33% rune
rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 5903 5598 3141 (2247)
Agility 1734 1 1821 1735 0
Stamina 3463 0 13076 12453 6915
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 261520 249060 0
Runic Power 144 144 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 24.64% 24.64% 2995
Haste 11.86% 11.86% 2016
Versatility 6.34% 3.34% 685
Attack Power 6198 5598 0
Mastery 45.29% 45.29% 2636
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Cuirass of Irreparable Madness
ilevel: 372, stats: { 929 Armor, +687 Sta, +344 Haste, +243 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi }
Local Feet Twenty-Two-League Striders
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Crit, +154 Vers, +237 StrInt }, enchant: { +89 Sta }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Crit }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Crit }
Local Trinket1 Blazebinder's Hoof
ilevel: 372, stats: { +420 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Cloak of Lost Devotion
ilevel: 372, stats: { 168 Armor, +386 Sta, +194 Crit, +137 Haste, +177 StrAgiInt }, enchant: { +100 Leech }
Local Main Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 372, weapon: { 349 - 584, 2.6 }, stats: { +158 Str, +343 Sta, +122 Crit, +172 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Profile

deathknight="PR_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
# Estimates a trinkets value by comparing the cooldown of the trinket, divided by the duration of the buff it provides. Has a strength modifier to give a higher priority to strength trinkets, as well as a modifier for if a trinket will or will not sync with cooldowns.
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets=use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1594,enchant_id=6597
chest=cuirass_of_irreparable_madness,id=193644,bonus_id=6808/4786/1594,enchant_id=6624
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant_id=6579
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant_id=6489
feet=twentytwoleague_striders,id=193630,bonus_id=6808/4786/1594,enchant_id=6612
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant_id=6549
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant_id=6549
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_hysteria
off_hand=strike_twice,id=193700,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3141
# gear_stamina=6915
# gear_crit_rating=2995
# gear_haste_rating=2016
# gear_mastery_rating=2636
# gear_versatility_rating=685
# gear_leech_rating=275
# gear_armor=5338

PR_Death_Knight_Unholy : 44085 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
44085.0 44085.0 43.6 / 0.099% 7472.4 / 17.0% 2664.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.5 7.7 Runic Power 2.59% 51.9 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Death_Knight_Unholy 44085
Apocalypse 221 0.5% 7.0 45.48sec 9530 7463 Direct 7.0 8256 16519 9530 15.4%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.97 6.97 0.00 0.00 0.00 1.2771 0.0000 66380.52 66380.52 0.00% 7462.68 7462.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.58% 5.89 1 8 8255.55 6617 11372 8248.09 7080 9583 48638 48638 0.00%
crit 15.42% 1.07 0 6 16519.24 13235 21955 11262.39 0 21955 17742 17742 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=15 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [O]:6.17
  • if_expr:active_enemies<=3&cooldown.dark_transformation.remains
  • target_if_expr:debuff.festering_wound.stack
    opener
    [Z]:0.80
  • if_expr:buff.commander_of_the_dead_window.up
auto_attack_mh 2859 6.5% 148.0 2.44sec 5791 2407 Direct 148.0 5018 10039 5791 15.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.05 148.05 0.00 0.00 0.00 2.4058 0.0000 857358.53 1224829.13 30.00% 2407.10 2407.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.61% 125.26 88 166 5018.22 3791 6917 5017.38 4801 5261 628600 898023 30.00%
crit 15.39% 22.79 6 45 10039.40 7582 13835 10036.29 9027 11028 228759 326806 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Dark Transformation 199 0.5% 7.0 45.67sec 8531 6678 Direct 7.0 7402 14788 8531 15.3%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.99 6.99 0.00 0.00 0.00 1.2775 0.0000 59631.19 59631.19 0.00% 6677.62 6677.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.72% 5.92 1 8 7402.32 5920 10146 7396.66 6213 8386 43839 43839 0.00%
crit 15.28% 1.07 0 5 14787.86 11840 19641 10080.60 0 19641 15792 15792 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [M]:5.81
  • if_expr:variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
    cooldowns
    [N]:0.18
  • if_expr:variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
    opener
    [a]:1.00
  • if_expr:debuff.festering_wound.stack>=4
Death Coil 4202 (5446) 9.6% (12.4%) 95.8 3.09sec 17023 14639 Direct 95.7 (227.8) 11388 22769 13141 15.4% (15.4%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.76 95.72 0.00 0.00 0.00 1.1629 0.0000 1257921.69 1257921.69 0.00% 14638.81 14638.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.59% 80.97 53 111 11388.08 7356 18286 11397.62 10707 12218 922147 922147 0.00%
crit 15.41% 14.75 2 30 22769.03 14712 36052 22789.00 18534 28129 335774 335774 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    generic
    [T]:94.22
  • if_expr:!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
    opener
    [Y]:1.55
  • if_expr:pet.gargoyle.active&runic_power.deficit=0
    Coil of Devastation 1244 2.8% 0.0 0.00sec 0 0 Periodic 132.1 2819 0 2819 0.0% 88.1%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 132.10 132.10 81.04 0.0000 2.0000 372329.26 372329.26 0.00% 1409.30 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 132.10 99 166 2818.59 1103 11792 2825.65 2338 3510 372329 372329 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Dragon Games Equipment 1049 2.4% 8.2 29.10sec 38474 0 Direct 8.2 33373 66746 38501 15.4%

Stats Details: Dragon Games Equipment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.20 8.19 0.00 0.00 0.00 0.0000 0.0000 315448.79 450652.62 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.63% 6.93 1 9 33373.08 33373 33373 33373.08 33373 33373 231409 330592 30.00%
crit 15.37% 1.26 0 6 66746.15 66746 66746 49167.32 0 66746 84040 120060 22.10%

Action Details: Dragon Games Equipment

  • id:386708
  • school:physical
  • range:50.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42440.30
  • base_dd_max:42440.30
  • base_dd_mult:1.00

Spelldata

  • id:386708
  • name:Dragon Games Equipment
  • school:physical
  • tooltip:
  • description:
Festering Strike 1176 2.7% 26.5 11.40sec 13339 10865 Direct 26.5 11577 23101 13339 15.3%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.47 26.47 0.00 0.00 0.00 1.2277 0.0000 353071.81 504401.15 30.00% 10865.42 10865.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.71% 22.42 11 33 11576.96 8646 18322 11564.15 10520 12480 259557 370806 30.00%
crit 15.29% 4.05 0 13 23100.60 17293 36643 22728.10 0 32347 93514 133595 29.57%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    generic
    [V]:24.23
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
    opener
    [W]:2.23
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 1854 4.2% 103.4 3.52sec 5377 0 Direct 103.4 4662 9324 5377 15.3%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 103.44 103.44 0.00 0.00 0.00 0.0000 0.0000 556170.37 556170.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.68% 87.59 57 119 4662.45 3287 7872 4663.13 4395 4940 408375 408375 0.00%
crit 15.32% 15.85 3 33 9323.97 6575 15743 9326.22 8036 11272 147796 147796 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Outbreak 84 0.2% 11.9 26.31sec 2117 1762 Direct 11.9 1839 3680 2117 15.1%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.87 11.87 0.00 0.00 0.00 1.2019 0.0000 25121.89 25121.89 0.00% 1761.58 1761.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.87% 10.07 4 14 1838.61 1259 3052 1838.55 1560 2108 18516 18516 0.00%
crit 15.13% 1.79 0 8 3680.32 2517 6105 3146.74 0 6072 6606 6606 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    default
    [E]:11.87
  • target_if_expr:(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
Scourge Strike 966 (2236) 2.2% (5.1%) 76.8 3.76sec 8738 7596 Direct 76.8 (153.5) 3274 6557 3778 15.4% (15.4%)

Stats Details: Scourge Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 76.77 76.77 0.00 0.00 0.00 1.1504 0.0000 290010.42 414311.17 30.00% 7596.05 7596.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.65% 64.98 39 91 3273.98 2446 4940 3273.37 3084 3457 212746 303931 30.00%
crit 15.35% 11.78 1 27 6556.64 4892 9733 6556.46 5622 8025 77264 110380 30.00%

Action Details: Scourge Strike

  • id:55090
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:
  • description:An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.

Action Priority List

    generic
    [U]:76.77
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    Scourge Strike (_shadow) 1269 2.9% 0.0 0.00sec 0 0 Direct 76.8 4300 8592 4960 15.4%

Stats Details: Scourge Strike Shadow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 76.77 0.00 0.00 0.00 0.0000 0.0000 380774.32 380774.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.62% 64.96 42 91 4300.15 2777 6804 4302.35 4001 4610 279330 279330 0.00%
crit 15.38% 11.81 0 27 8592.05 5553 13608 8597.05 0 11116 101445 101445 0.00%

Action Details: Scourge Strike Shadow

  • id:70890
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:70890
  • name:Scourge Strike
  • school:shadow
  • tooltip:
  • description:{$@spelldesc55090=An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.}
Soul Reaper 443 (2571) 1.0% (5.9%) 15.7 6.86sec 49195 39692 Direct 15.7 (31.3) 7360 14711 8483 15.3% (15.3%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.68 15.68 0.00 0.00 0.00 1.2394 0.0000 132996.99 132996.99 0.00% 39692.44 39692.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.72% 13.28 5 19 7359.86 4500 11186 7367.86 6644 8321 97756 97756 0.00%
crit 15.28% 2.40 0 10 14711.05 9899 22054 13573.06 0 21100 35241 35241 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [S]:15.68
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
    Soul Reaper (_execute) 2127 4.8% 15.7 6.86sec 40740 0 Direct 15.7 35312 70651 40739 15.4%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.67 15.67 0.00 0.00 0.00 0.0000 0.0000 638266.74 638266.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.64% 13.26 5 19 35311.73 26079 50965 35346.75 31618 39182 468257 468257 0.00%
crit 15.36% 2.41 0 9 70650.93 52158 101931 65199.98 0 100485 170010 170010 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 210 0.5% 3.7 91.03sec 17233 14858 Direct 3.7 14965 29902 17232 15.2%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.66 3.66 0.00 0.00 0.00 1.1601 0.0000 63040.89 63040.89 0.00% 14857.62 14857.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.82% 3.10 0 4 14964.78 12322 17822 14950.53 0 17822 46433 46433 0.00%
crit 15.18% 0.56 0 4 29901.82 24644 35644 13518.68 0 35644 16608 16608 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [R]:3.66
  • if_expr:variable.st_planning
Unholy Pact 1334 3.0% 122.8 2.64sec 3255 0 Direct 122.8 2822 5644 3255 15.3%

Stats Details: Unholy Pact

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.84 122.84 0.00 0.00 0.00 0.0000 0.0000 399843.63 399843.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.66% 104.00 73 135 2822.09 1980 4501 2821.82 2580 3025 293491 293491 0.00%
crit 15.34% 18.84 4 38 5643.68 3960 9002 5643.25 4803 6602 106353 106353 0.00%

Action Details: Unholy Pact

  • id:319236
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:319236
  • name:Unholy Pact
  • school:shadow
  • tooltip:Deals {$s1=0} Shadow damage.
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
Virulent Plague 882 2.0% 11.9 26.31sec 22299 0 Periodic 99.2 2314 4630 2668 15.3% 99.2%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.87 0.00 99.16 99.16 10.87 0.0000 3.0000 264598.79 264598.79 0.00% 889.47 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 84.70% 83.99 57 111 2314.15 1654 4017 2314.51 2186 2459 194361 194361 0.00%
crit 15.30% 15.17 3 32 4629.58 3309 7922 4628.95 3883 5454 70238 70238 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 5980 / 5980
Claw 311 0.7% 37.7 7.90sec 2477 2466 Direct 37.7 2145 4292 2477 15.5%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.72 37.72 0.00 0.00 0.00 1.0045 0.0000 93445.97 133497.65 30.00% 2466.18 2466.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.54% 31.89 18 46 2145.44 1713 6578 2143.76 1927 2309 68417 97741 30.00%
crit 15.46% 5.83 0 16 4291.82 3425 6397 4278.97 0 5379 25029 35757 29.92%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:37.72
  • if_expr:energy>70
Gnaw 1 0.0% 3.7 90.06sec 85 84 Direct 3.7 73 147 85 15.3%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0045 0.0000 314.33 449.06 30.00% 84.16 84.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.67% 3.15 0 4 73.27 63 91 73.17 0 88 231 330 29.98%
crit 15.33% 0.57 0 4 146.75 125 182 67.14 0 182 84 119 13.73%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:3.72
main_hand 4301 9.8% 191.7 1.55sec 6716 4324 Direct 191.7 5822 11642 6716 15.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 191.68 191.68 0.00 0.00 0.00 1.5531 0.0000 1287218.67 1838930.70 30.00% 4324.10 4324.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.64% 162.24 120 208 5821.73 1936 13250 5832.01 5253 6534 944510 1349334 30.00%
crit 15.36% 29.44 11 51 11641.85 3871 26501 11660.60 6169 16312 342709 489597 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Sweeping Claws 1368 3.1% 68.0 4.29sec 6017 5990 Direct 68.0 5218 10438 6017 15.3%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.98 67.98 0.00 0.00 0.00 1.0045 0.0000 409017.49 409017.49 0.00% 5990.12 5990.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.69% 57.57 41 75 5217.54 3859 8518 5219.71 4881 5599 300355 300355 0.00%
crit 15.31% 10.41 1 25 10437.63 7718 17037 10444.19 8483 13926 108663 108663 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:67.98
pet - gargoyle 31036 / 5236
Gargoyle Strike 31036 11.8% 39.5 5.36sec 39265 36072 Direct 39.5 34056 68191 39264 15.3%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.51 39.51 0.00 0.00 0.00 1.0885 0.0000 1551435.45 1551435.45 0.00% 36071.51 36071.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.74% 33.48 18 40 34056.00 6177 74701 34054.79 27738 40692 1140262 1140262 0.00%
crit 15.26% 6.03 0 18 68190.54 13095 145808 67982.14 0 133655 411174 411174 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.

Action Priority List

    default
    [ ]:41.51
pet - risen_skulker 1184 / 1184
Skulker Shot 1184 2.7% 153.9 1.94sec 2306 1187 Direct 153.8 1999 3999 2307 15.4%

Stats Details: Skulker Shot

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.87 153.81 0.00 0.00 0.00 1.9430 0.0000 354796.17 506864.60 30.00% 1186.72 1186.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.63% 130.18 95 169 1999.42 1469 3351 2000.23 1913 2122 260279 371837 30.00%
crit 15.37% 23.63 6 42 3999.24 2937 6703 4000.93 3506 4686 94517 135028 30.00%

Action Details: Skulker Shot

  • id:212423
  • school:physical
  • range:35.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:212423
  • name:Skulker Shot
  • school:physical
  • tooltip:
  • description:A ranged shot that causes Physical damage.

Action Priority List

    default
    [ ]:154.87
pet - magus_of_the_dead 7584 / 3361
Frostbolt 2253 2.3% 34.5 8.52sec 8620 6133 Direct 34.5 7467 14967 8623 15.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.53 34.52 0.00 0.00 0.00 1.4056 0.0000 297649.35 297649.35 0.00% 6133.05 6133.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.59% 29.20 20 38 7467.12 3824 11817 7467.68 6505 8274 218038 218038 0.00%
crit 15.41% 5.32 0 14 14966.98 7648 23633 14934.73 0 22641 79612 79612 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:19.28
    default
    [ ]:18.97
Shadow Bolt 5331 5.3% 82.2 3.51sec 8559 6645 Direct 82.2 7422 14826 8561 15.4%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.18 82.16 0.00 0.00 0.00 1.2882 0.0000 703422.74 703422.74 0.00% 6644.59 6644.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.62% 69.52 48 85 7422.27 3658 11269 7422.60 6511 8113 516014 516014 0.00%
crit 15.38% 12.64 3 27 14825.94 7316 22537 14823.66 10877 19080 187409 187409 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:44.02
    default
    [ ]:43.41
pet - army_ghoul 24504 / 5539
Claw 4006 2.0% 212.4 1.02sec 1263 1263 Direct 212.4 1094 2189 1263 15.4%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 212.39 212.39 0.00 0.00 0.00 1.0000 0.0000 268181.28 383125.88 30.00% 1262.67 1262.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.63% 179.75 145 201 1094.37 525 1564 1093.92 925 1183 196709 281020 30.00%
crit 15.37% 32.65 15 56 2189.26 1050 3129 2188.31 1731 2472 71472 102105 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:26.47
    default
    [ ]:26.53
    default
    [ ]:26.51
    default
    [ ]:26.58
    default
    [ ]:26.59
    default
    [ ]:26.56
    default
    [ ]:26.61
    default
    [ ]:26.55
main_hand 20497 10.4% 348.1 0.62sec 3942 3487 Direct 348.1 3417 6834 3942 15.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 348.12 348.12 0.00 0.00 0.00 1.1302 0.0000 1372172.29 1960296.11 30.00% 3487.48 3487.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.65% 294.68 235 320 3417.12 1571 4682 3415.44 2881 3672 1006970 1438565 30.00%
crit 15.35% 53.44 30 79 6834.45 3142 9364 6830.88 5562 7590 365202 521731 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - apoc_ghoul 7814 / 2665
Claw 1673 1.3% 152.3 1.83sec 1122 1122 Direct 152.3 973 1945 1122 15.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 152.31 152.31 0.00 0.00 0.00 1.0000 0.0000 170891.21 244136.53 30.00% 1121.99 1121.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.66% 128.95 78 169 972.83 542 1500 972.92 811 1080 125449 179217 30.00%
crit 15.34% 23.36 7 44 1945.42 1139 2999 1945.19 1574 2318 45443 64920 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:37.80
    default
    [ ]:38.32
    default
    [ ]:38.35
    default
    [ ]:37.85
main_hand 6142 4.8% 181.1 1.53sec 3465 2511 Direct 181.1 3002 6004 3465 15.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 181.14 181.14 0.00 0.00 0.00 1.3796 0.0000 627564.74 896543.91 30.00% 2511.24 2511.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.59% 153.23 99 202 3002.06 1623 4488 3002.98 2413 3355 460008 657170 30.00%
crit 15.41% 27.91 8 52 6004.16 3350 9105 6006.72 4946 7012 167557 239374 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Death_Knight_Unholy
Army of the Dead 2.0 0.00sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 16.00 0.00 0.00 1.1682 0.5000 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    default
    [D]:2.00
  • if_expr:talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 183.66sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [b]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 166.88sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.41 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [P]:2.41
  • if_expr:variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.4 305.39sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.43 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [L]:1.43
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Algeth'ar Puzzle (solved_the_puzzle) 2.0 183.59sec

Stats Details: Solved The Puzzle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Solved The Puzzle

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
Summon Gargoyle 2.0 186.17sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [Q]:1.00
  • if_expr:buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
    opener
    [X]:1.00
  • if_expr:buff.commander_of_the_dead_window.up
Unholy Strength 21.4 13.65sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.42 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 2.0 183.5sec 61.2sec 20.0sec 13.51% 0.00% 2.0 (2.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3273.11
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3273.11

Trigger Details

  • interval_min/max:181.2s / 232.9s
  • trigger_min/max:0.0s / 232.9s
  • trigger_pct:100.00%
  • duration_min/max:14.0s / 20.0s

Stack Uptimes

  • algethar_puzzle_1:13.51%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 183.6sec 183.6sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 233.0s
  • trigger_min/max:180.0s / 233.0s
  • trigger_pct:100.00%
  • duration_min/max:9.9s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
commander_of_the_dead_window 7.0 0.0 45.7sec 45.7sec 4.0sec 9.28% 41.19% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead_window
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 52.2s
  • trigger_min/max:45.0s / 52.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s

Stack Uptimes

  • commander_of_the_dead_window_1:9.28%
Dark Transformation 7.0 0.0 45.7sec 45.7sec 22.1sec 51.66% 57.95% 0.0 (0.0) 6.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 52.2s
  • trigger_min/max:45.0s / 52.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.0s

Stack Uptimes

  • dark_transformation_1:51.66%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dragon Games Equipment 2.7 0.0 120.5sec 120.5sec 0.9sec 0.79% 0.00% 8.2 (8.2) 2.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_dragon_games_equipment
  • max_stacks:1
  • base duration:0.85
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.25

Trigger Details

  • interval_min/max:120.0s / 124.7s
  • trigger_min/max:120.0s / 124.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.9s

Stack Uptimes

  • dragon_games_equipment_1:0.79%

Spelldata

  • id:386692
  • name:Dragon Games Equipment
  • tooltip:
  • description:Empty out the Dragon Games kickballs onto the field. Running into them kicks them at your enemy target, dealing {$383950s1=20227} Physical damage.
  • max_stacks:0
  • duration:1.00
  • cooldown:120.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 305.4sec 305.4sec 27.3sec 12.82% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 324.0s
  • trigger_min/max:300.0s / 324.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.82%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 166.9sec 166.9sec 19.3sec 15.44% 0.00% 7.0 (7.0) 2.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 232.1s
  • trigger_min/max:120.0s / 232.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.44%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Festermight 13.2 70.5 23.1sec 3.5sec 19.3sec 85.10% 0.00% 0.0 (0.0) 12.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 46.5s
  • trigger_min/max:0.8s / 27.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:8.74%
  • festermight_2:9.54%
  • festermight_3:10.57%
  • festermight_4:15.50%
  • festermight_5:9.84%
  • festermight_6:8.28%
  • festermight_7:6.94%
  • festermight_8:5.60%
  • festermight_9:4.00%
  • festermight_10:2.79%
  • festermight_11:1.72%
  • festermight_12:0.96%
  • festermight_13:0.44%
  • festermight_14:0.16%
  • festermight_15:0.01%
  • festermight_16:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 8.2 87.6 38.5sec 3.1sec 34.1sec 93.11% 75.32% 72.7 (72.7) 7.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 217.5s
  • trigger_min/max:0.8s / 17.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 216.9s

Stack Uptimes

  • icy_talons_1:6.95%
  • icy_talons_2:6.66%
  • icy_talons_3:79.50%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 11.9 8.0 25.1sec 14.6sec 10.7sec 42.15% 0.00% 8.0 (8.0) 11.4

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 178.6s
  • trigger_min/max:0.8s / 176.6s
  • trigger_pct:14.97%
  • duration_min/max:0.0s / 79.0s

Stack Uptimes

  • rune_mastery_1:42.15%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 40.4 5.6 7.3sec 6.4sec 2.6sec 35.12% 0.00% 5.6 (5.6) 40.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 86.3s
  • trigger_min/max:0.8s / 86.3s
  • trigger_pct:47.99%
  • duration_min/max:0.0s / 17.8s

Stack Uptimes

  • runic_corruption_1:35.12%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 20.4 0.2 14.4sec 14.2sec 1.0sec 7.11% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.4s / 60.8s
  • trigger_min/max:1.4s / 60.8s
  • trigger_pct:14.33%
  • duration_min/max:0.0s / 11.5s

Stack Uptimes

  • sudden_doom_1:7.11%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.7 0.0 91.0sec 91.0sec 19.5sec 23.83% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 94.8s
  • trigger_min/max:90.0s / 94.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • unholy_assault_1:23.83%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Pact 7.0 0.0 45.7sec 45.7sec 14.7sec 34.25% 37.54% 95.8 (95.8) 6.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_pact
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:45.0s / 52.2s
  • trigger_min/max:45.0s / 52.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • unholy_pact_1:34.25%

Spelldata

  • id:319233
  • name:Unholy Pact
  • tooltip:
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 13.0 36.2sec 13.7sec 24.5sec 68.76% 0.00% 13.0 (13.0) 7.7

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 201.6s
  • trigger_min/max:0.0s / 59.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 182.0s

Stack Uptimes

  • unholy_strength_1:68.76%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.4 0.0 47.8sec 47.8sec 14.7sec 96.73% 95.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 182.4s
  • trigger_min/max:45.0s / 182.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:96.73%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.5 0.0 47.1sec 47.1sec 14.7sec 96.78% 95.22% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 183.4s
  • trigger_min/max:45.0s / 183.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:96.78%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.5 0.0 47.2sec 47.2sec 14.7sec 96.76% 95.21% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 184.8s
  • trigger_min/max:45.0s / 184.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:96.76%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.4 0.0 47.8sec 47.8sec 14.7sec 96.72% 95.14% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 184.1s
  • trigger_min/max:45.0s / 184.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:96.72%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.4sec 186.4sec 28.4sec 92.32% 97.66% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 232.3s
  • trigger_min/max:180.9s / 232.3s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.32%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 186.5sec 186.5sec 28.4sec 92.77% 98.13% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 232.3s
  • trigger_min/max:180.9s / 232.3s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.77%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 186.4sec 186.4sec 28.4sec 92.86% 98.13% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 232.3s
  • trigger_min/max:180.9s / 232.3s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.86%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.4sec 186.4sec 28.4sec 92.06% 97.42% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 232.3s
  • trigger_min/max:180.9s / 232.3s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.06%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.5sec 186.5sec 28.4sec 92.23% 97.65% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 232.3s
  • trigger_min/max:180.9s / 232.3s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.23%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.5sec 186.5sec 28.4sec 91.46% 97.14% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 232.3s
  • trigger_min/max:180.9s / 232.3s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.46%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.6sec 186.6sec 28.3sec 91.72% 97.47% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 232.3s
  • trigger_min/max:180.9s / 232.3s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.72%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 1.9 0.0 186.7sec 186.7sec 28.3sec 91.53% 97.47% 0.0 (0.0) 0.6

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 232.8s
  • trigger_min/max:180.9s / 232.8s
  • trigger_pct:100.00%
  • duration_min/max:8.3s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:91.53%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Commander of the Dead 2.0 0.0 186.1sec 186.1sec 25.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:182.5s / 235.2s
  • trigger_min/max:182.5s / 235.2s
  • trigger_pct:100.00%
  • duration_min/max:6.4s / 25.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 187.7sec 187.7sec 23.2sec 92.74% 99.94% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.5s / 236.9s
  • trigger_min/max:181.5s / 236.9s
  • trigger_pct:100.00%
  • duration_min/max:5.4s / 25.0s

Stack Uptimes

  • dark_empowerment_1:92.74%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.4 0.0 62.1sec 62.1sec 17.4sec 92.23% 91.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:42.4s / 232.9s
  • trigger_min/max:42.4s / 232.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.23%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 4.3 0.0 62.7sec 62.7sec 17.3sec 92.10% 91.80% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:42.4s / 231.8s
  • trigger_min/max:42.4s / 231.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:92.10%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 24.7 9.0 44.0 11.8s 1.4s 124.5s
delayed_aa_cast 2.0 2.0 2.0 183.2s 181.0s 232.4s
Rune ready 155.5 118.0 198.0 2.0s 0.0s 12.8s
Runic Corruption from Runic Power Spent 46.0 24.0 71.0 6.4s 0.8s 86.3s
Festering Wound from Festering Strike 66.2 42.0 91.0 11.4s 1.0s 77.2s
Festering Wound from Infected Claws 31.7 11.0 54.0 9.3s 1.0s 142.3s
Festering Wound from Unholy Assault 14.6 12.0 16.0 91.0s 90.0s 94.8s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 4.19% 0.30% 16.92% 2.2s 0.0s 25.8s
ghoul - Energy Cap 0.40% 0.16% 1.39% 0.2s 0.0s 1.0s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=297834)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0922.103 / 1.1747.97128.393
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
43.71862.93583.485 / 82.712106.158146.958

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Army of the Dead5.9390.00242.5705.6250.00042.570
Apocalypse0.4950.00110.9402.8930.22812.890
Dark Transformation0.6900.0017.2234.0540.94312.233
Empower Rune Weapon47.4620.002112.14666.13657.809112.146
Summon Gargoyle6.1432.50555.2076.1442.50555.207
Unholy Assault1.0760.0014.8042.7620.0008.215
Soul Reaper0.9260.00111.73712.6365.02924.633

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Death_Knight_Unholy
ApocalypseRune13.9313.908.94%1.000.030.23%
Empower Rune WeaponRunic Power11.5653.972.33%4.673.856.66%
Empower Rune WeaponRune11.5610.977.05%0.950.595.12%
Festering WoundRunic Power103.44299.3512.90%2.8910.973.54%
Rune RegenerationRune130.66130.6684.01%1.000.000.00%
Runic AttenuationRunic Power73.97353.1015.21%4.7716.754.53%
Army of the DeadRunic Power2.0019.720.85%9.860.281.40%
Festering StrikeRunic Power26.47509.1321.94%19.2420.233.82%
OutbreakRunic Power11.87114.524.93%9.654.143.49%
Scourge StrikeRunic Power76.77746.5932.17%9.7321.072.74%
Soul ReaperRunic Power15.68145.626.27%9.2911.167.12%
Summon GargoyleRunic Power2.0078.783.39%39.3921.2221.22%
pet - ghoul
Dark TransformationEnergy6.99357.058.58%51.08341.9848.92%
energy_regenEnergy1325.133805.1991.42%2.8756.841.47%
pet - army_ghoul
energy_regenEnergy894.077012.52100.00%7.841098.8813.55%
pet - apoc_ghoul
energy_regenEnergy463.143768.98100.00%8.141691.1030.97%
Usage Type Count Total Avg RPE APR
PR_Death_Knight_Unholy
Army of the DeadRune 2.002.001.001.000.00
Death CoilRunic Power 95.762264.2123.6423.64720.01
Festering StrikeRune 26.4752.942.002.006669.77
OutbreakRune 11.8711.871.001.002117.18
Scourge StrikeRune 76.7776.771.001.008738.06
Soul ReaperRune 15.6815.681.001.0049194.30
pet - ghoul
ClawEnergy 37.721508.8440.0040.0061.93
Sweeping ClawsEnergy 67.982719.0940.0040.00150.42
pet - army_ghoul
ClawEnergy 212.398495.6140.0040.0031.57
pet - apoc_ghoul
ClawEnergy 152.316092.4440.0040.0028.05
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 7.74 7.55 109.7 56.6 0.0 100.0
Rune 6.0 0.52 0.53 0.0 2.3 0.0 6.0

Statistics & Data Analysis

Fight Length
PR_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 44084.98
Minimum 38885.34
Maximum 50205.96
Spread ( max - min ) 11320.62
Range [ ( max - min ) / 2 * 100% ] 12.84%
Standard Deviation 1926.8731
5th Percentile 41211.20
95th Percentile 47579.09
( 95th Percentile - 5th Percentile ) 6367.89
Mean Distribution
Standard Deviation 22.2511
95.00% Confidence Interval ( 44041.37 - 44128.59 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7339
0.1 Scale Factor Error with Delta=300 31695
0.05 Scale Factor Error with Delta=300 126780
0.01 Scale Factor Error with Delta=300 3169494
Priority Target DPS
PR_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 44084.98
Minimum 38885.34
Maximum 50205.96
Spread ( max - min ) 11320.62
Range [ ( max - min ) / 2 * 100% ] 12.84%
Standard Deviation 1926.8731
5th Percentile 41211.20
95th Percentile 47579.09
( 95th Percentile - 5th Percentile ) 6367.89
Mean Distribution
Standard Deviation 22.2511
95.00% Confidence Interval ( 44041.37 - 44128.59 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7339
0.1 Scale Factor Error with Delta=300 31695
0.05 Scale Factor Error with Delta=300 126780
0.01 Scale Factor Error with Delta=300 3169494
DPS(e)
PR_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 44084.98
Minimum 38885.34
Maximum 50205.96
Spread ( max - min ) 11320.62
Range [ ( max - min ) / 2 * 100% ] 12.84%
Damage
PR_Death_Knight_Unholy Damage
Count 7499
Mean 6032965.83
Minimum 4486251.09
Maximum 7535166.44
Spread ( max - min ) 3048915.35
Range [ ( max - min ) / 2 * 100% ] 25.27%
DTPS
PR_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 fleshcraft
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%45=0)
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%45=0)
8 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
9 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
A 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
B 0.00 variable,name=opener_done,op=setif,value=1,value_else=0,condition=active_enemies>=3
Default action list Executed every time the actor is available.
# count action,conditions
C 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
0.00 variable,name=apoc_timing,op=setif,value=8,value_else=4,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<4
Variables
0.00 variable,name=garg_pooling,op=setif,value=(((cooldown.summon_gargoyle.remains+1)%gcd)%((rune+1)*(runic_power+20)))*100,value_else=gcd,condition=cooldown.summon_gargoyle.remains<gcd*2
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(2-talent.infected_claws),condition=talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
0.00 variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4|fight_remains<debuff.festering_wound.stack*gcd)
0.00 variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=pooling_runes,value=talent.soul_reaper&rune<2&target.time_to_pct_35<5&fight_remains>5
0.00 variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion.
D 2.00 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
Prioritize Army, Outbreak and Maintaining Plaguebringer
E 11.87 outbreak,target_if=(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
0.00 wound_spender,if=cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
F 0.00 call_action_list,name=opener,if=variable.opener_done=0
Call Action Lists
G 0.00 call_action_list,name=cooldowns
H 0.00 call_action_list,name=trinkets
I 0.00 call_action_list,name=racials
J 0.00 run_action_list,name=aoe,if=active_enemies>=4
K 0.00 run_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
L 1.43 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Potion
0.00 vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
M 5.81 dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
N 0.18 dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
O 6.17 apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&cooldown.dark_transformation.remains
P 2.41 empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
Q 1.00 summon_gargoyle,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
0.00 unholy_blight,if=variable.adds_remain|fight_remains<21
0.00 abomination_limb,if=variable.st_planning&rune<3
R 3.66 unholy_assault,if=variable.st_planning
S 15.68 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
0.00 sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd
actions.generic
# count action,conditions
T 94.22 death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
Generic
0.00 any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
U 76.77 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
V 24.23 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.opener
# count action,conditions
W 2.23 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
Opener
X 1.00 summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up
Y 1.55 death_coil,if=pet.gargoyle.active&runic_power.deficit=0
Z 0.80 apocalypse,if=buff.commander_of_the_dead_window.up
a 1.00 dark_transformation,if=debuff.festering_wound.stack>=4
0.00 variable,name=opener_done,op=setif,value=1,value_else=0,condition=cooldown.apocalypse.remains|!talent.apocalypse&(cooldown.dark_transformation.remains|cooldown.summon_gargoyle.remains)
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.blood_fury.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
b 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&15>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.fireblood.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
c 2.00 use_item,slot=trinket1,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets
0.00 use_item,slot=trinket2,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
d 2.74 use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

Sample Sequence

01246789ABCDEWWaXYZLPRcbTTTTUTUUUTUTUVTEUTUUTUTUTUTdVUTUUTVTUTUVTEMOUUTUTTUTVUTUTUVTTETTUUUUTUVTTVTVMORUUETUUUUTTUVTTUTUVTUTUTVTETUTVMOUUTVTUdTTUVETTUUTUVTTUUTUTTUVTUETDMOQPRScbTTTTUSTUTUUTSUTUUTUESTUVTSTUUUSTVTVTMOSETUTSUVTTSTUTUSUTUUTSEUTSTdVTNORSUUTUTSUTETUSVTTTU

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 2 augmentation PR_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 6 trinket_1_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 7 trinket_2_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 8 trinket_priority Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat 9 trinket_1_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat A trinket_2_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
Pre precombat B opener_done Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default C auto_attack Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
static_empowerment
0:00.000 default D army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
bloodlust, static_empowerment
0:01.020 default E outbreak Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune
bloodlust, static_empowerment(2)
0:02.040 opener W festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, static_empowerment(3)
0:03.061 opener W festering_strike Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, static_empowerment(4)
0:04.082 opener a dark_transformation Fluffy_Pillow 65.0/100: 65% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, static_empowerment(5)
0:04.082 opener X summon_gargoyle Fluffy_Pillow 65.0/100: 65% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:05.103 opener Y death_coil Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:06.123 opener Z apocalypse Fluffy_Pillow 70.0/100: 70% runic_power
0.0/6: 0% rune
bloodlust, rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:07.144 cooldowns L potion Fluffy_Pillow 82.0/100: 82% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
0:07.144 cooldowns P empower_rune_weapon Fluffy_Pillow 82.0/100: 82% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.144 cooldowns R unholy_assault Fluffy_Pillow 87.0/100: 87% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.032 trinkets c use_item_algethar_puzzle_box Fluffy_Pillow 92.0/100: 92% runic_power
4.0/6: 67% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.014 racials b berserking Fluffy_Pillow 92.0/100: 92% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.014 generic T death_coil Fluffy_Pillow 92.0/100: 92% runic_power
5.0/6: 83% rune
bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.769 generic T death_coil Fluffy_Pillow 97.0/100: 97% runic_power
5.0/6: 83% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(2), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.523 generic T death_coil Fluffy_Pillow 67.0/100: 67% runic_power
6.0/6: 100% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.277 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
6.0/6: 100% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.031 generic U scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
6.0/6: 100% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.786 generic T death_coil Fluffy_Pillow 30.0/100: 30% runic_power
6.0/6: 100% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.540 generic U scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.296 generic U scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.049 generic U scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.804 generic T death_coil Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.559 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.314 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.068 generic U scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.823 generic V festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.577 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.331 default E outbreak Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune
bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.085 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.838 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.592 generic U scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.347 generic U scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.101 generic T death_coil Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(13), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.855 generic U scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(13), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.609 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(14), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.361 generic U scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
5.0/6: 83% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.115 generic T death_coil Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune
bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.869 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune
bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.887 generic T death_coil Fluffy_Pillow 43.0/100: 43% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.908 trinkets d use_item_dragon_games_equipment Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:29.908 generic V festering_strike Fluffy_Pillow 13.0/100: 13% runic_power
5.0/6: 83% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(2), dragon_games_equipment, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.927 generic U scourge_strike Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:31.946 generic T death_coil Fluffy_Pillow 46.0/100: 46% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:32.966 generic U scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power
3.0/6: 50% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:33.984 generic U scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:35.004 generic T death_coil Fluffy_Pillow 47.0/100: 47% runic_power
1.0/6: 17% rune
bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:36.025 generic V festering_strike Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune
bloodlust, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:37.045 generic T death_coil Fluffy_Pillow 42.0/100: 42% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:38.064 generic U scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune
bloodlust, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
0:39.085 generic T death_coil Fluffy_Pillow 30.0/100: 30% runic_power
0.0/6: 0% rune
bloodlust, unholy_strength, icy_talons(3), festermight(6), static_empowerment(5)
0:40.103 generic U scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(6), static_empowerment(5)
0:41.428 Waiting     1.771 sec 18.0/100: 18% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(7), static_empowerment(5)
0:43.199 generic V festering_strike Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(7), static_empowerment(5)
0:44.524 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), festermight(7), static_empowerment(5)
0:45.849 Waiting     2.217 sec 8.0/100: 8% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), festermight(7), static_empowerment(5)
0:48.066 default E outbreak Fluffy_Pillow 8.0/100: 8% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), static_empowerment(5)
0:49.391 Waiting     0.462 sec 23.0/100: 23% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), static_empowerment(5)
0:49.853 cooldowns M dark_transformation Fluffy_Pillow 23.0/100: 23% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), static_empowerment(5)
0:51.179 cooldowns O apocalypse Fluffy_Pillow 23.0/100: 23% runic_power
0.0/6: 0% rune
rune_mastery, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
0:52.505 generic U scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune
dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
0:53.830 generic U scourge_strike Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune
dark_transformation, unholy_pact, festermight(5), commander_of_the_dead_window, static_empowerment(5)
0:55.156 generic T death_coil Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune
dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
0:56.482 generic U scourge_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
icy_talons, dark_transformation, runic_corruption, unholy_pact, festermight(6), static_empowerment(5)
0:57.808 generic T death_coil Fluffy_Pillow 54.0/100: 54% runic_power
2.0/6: 33% rune
icy_talons, dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
0:59.134 generic T death_coil Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune
icy_talons(2), dark_transformation, sudden_doom, unholy_pact, festermight(7), static_empowerment(5)
1:00.459 generic U scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune
icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), static_empowerment(5)
1:01.784 generic T death_coil Fluffy_Pillow 42.0/100: 42% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(8), static_empowerment(5)
1:03.110 generic V festering_strike Fluffy_Pillow 42.0/100: 42% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), static_empowerment(5)
1:04.437 generic U scourge_strike Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), static_empowerment(5)
1:05.762 generic T death_coil Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
1:07.086 generic U scourge_strike Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(9), static_empowerment(5)
1:08.413 generic T death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, festermight(10), static_empowerment(5)
1:09.739 generic U scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(10), static_empowerment(5)
1:11.063 generic V festering_strike Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(11), static_empowerment(5)
1:12.387 generic T death_coil Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), static_empowerment(5)
1:13.712 generic T death_coil Fluffy_Pillow 46.0/100: 46% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), static_empowerment(5)
1:15.037 default E outbreak Fluffy_Pillow 21.0/100: 21% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), static_empowerment(5)
1:16.360 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), static_empowerment(5)
1:17.685 generic T death_coil Fluffy_Pillow 1.0/100: 1% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, sudden_doom, static_empowerment(5)
1:19.009 generic U scourge_strike Fluffy_Pillow 1.0/100: 1% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
1:20.333 generic U scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
1:21.658 generic U scourge_strike Fluffy_Pillow 27.0/100: 27% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
1:22.982 generic U scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
1:24.306 generic T death_coil Fluffy_Pillow 58.0/100: 58% runic_power
2.0/6: 33% rune
unholy_strength, festermight(4), static_empowerment(5)
1:25.632 generic U scourge_strike Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons, runic_corruption, festermight(4), static_empowerment(5)
1:26.958 generic V festering_strike Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons, festermight(5), static_empowerment(5)
1:28.282 generic T death_coil Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons, festermight(5), static_empowerment(5)
1:29.607 generic T death_coil Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(2), festermight(5), static_empowerment(5)
1:30.934 generic V festering_strike Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(5), static_empowerment(5)
1:32.259 generic T death_coil Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
1:33.584 generic V festering_strike Fluffy_Pillow 1.0/100: 1% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(5), static_empowerment(5)
1:34.911 cooldowns M dark_transformation Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), festermight(5), static_empowerment(5)
1:36.237 cooldowns O apocalypse Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_pact, festermight(5), commander_of_the_dead_window, static_empowerment(5)
1:37.563 cooldowns R unholy_assault Fluffy_Pillow 43.0/100: 43% runic_power
5.0/6: 83% rune
icy_talons(3), dark_transformation, unholy_pact, festermight(9), commander_of_the_dead_window, static_empowerment(5)
1:38.889 generic U scourge_strike Fluffy_Pillow 43.0/100: 43% runic_power
5.0/6: 83% rune
dark_transformation, unholy_assault, unholy_pact, festermight(9), commander_of_the_dead_window, static_empowerment(5)
1:39.996 generic U scourge_strike Fluffy_Pillow 61.0/100: 61% runic_power
5.0/6: 83% rune
rune_mastery, dark_transformation, unholy_assault, unholy_pact, static_empowerment(5)
1:41.099 default E outbreak Fluffy_Pillow 74.0/100: 74% runic_power
4.0/6: 67% rune
rune_mastery, dark_transformation, unholy_assault, unholy_pact, festermight, static_empowerment(5)
1:42.205 generic T death_coil Fluffy_Pillow 89.0/100: 89% runic_power
3.0/6: 50% rune
rune_mastery, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight, static_empowerment(5)
1:43.311 generic U scourge_strike Fluffy_Pillow 89.0/100: 89% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons, dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight, static_empowerment(5)
1:44.416 generic U scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(2), static_empowerment(5)
1:45.521 generic U scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(3), static_empowerment(5)
1:46.627 generic U scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(4), static_empowerment(5)
1:47.732 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(5), static_empowerment(5)
1:48.837 generic T death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(5), static_empowerment(5)
1:49.944 generic U scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(5), static_empowerment(5)
1:51.050 generic V festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(6), static_empowerment(5)
1:52.156 generic T death_coil Fluffy_Pillow 83.0/100: 83% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(6), static_empowerment(5)
1:53.260 generic T death_coil Fluffy_Pillow 53.0/100: 53% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(6), static_empowerment(5)
1:54.367 generic U scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(6), static_empowerment(5)
1:55.471 generic T death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(7), static_empowerment(5)
1:56.576 generic U scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), unholy_assault, festermight(7), static_empowerment(5)
1:57.682 generic V festering_strike Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(8), static_empowerment(5)
1:59.008 generic T death_coil Fluffy_Pillow 49.0/100: 49% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(8), static_empowerment(5)
2:00.333 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), static_empowerment(5)
2:01.658 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, static_empowerment(5)
2:02.983 Waiting     0.400 sec 7.0/100: 7% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
2:03.383 generic U scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
2:04.708 generic T death_coil Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(2), static_empowerment(5)
2:06.032 generic V festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
2:07.358 generic T death_coil Fluffy_Pillow 50.0/100: 50% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
2:08.682 Waiting     0.655 sec 20.0/100: 20% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
2:09.337 default E outbreak Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
2:10.662 generic T death_coil Fluffy_Pillow 35.0/100: 35% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
2:11.987 generic U scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
2:13.313 Waiting     3.672 sec 23.0/100: 23% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
2:16.985 generic T death_coil Fluffy_Pillow 33.0/100: 33% runic_power
1.0/6: 17% rune
unholy_strength, festermight(3), static_empowerment(5)
2:18.311 generic V festering_strike Fluffy_Pillow 3.0/100: 3% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, festermight(3), static_empowerment(5)
2:19.637 Waiting     0.342 sec 23.0/100: 23% runic_power
1.0/6: 17% rune
icy_talons, festermight(3), static_empowerment(5)
2:19.979 cooldowns M dark_transformation Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune
icy_talons, festermight(3), static_empowerment(5)
2:21.304 cooldowns O apocalypse Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune
icy_talons, dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
2:22.631 generic U scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune
icy_talons, dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
2:23.955 generic U scourge_strike Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune
rune_mastery, dark_transformation, unholy_pact, festermight(5), commander_of_the_dead_window, static_empowerment(5)
2:25.283 generic T death_coil Fluffy_Pillow 71.0/100: 71% runic_power
2.0/6: 33% rune
rune_mastery, dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
2:26.609 generic V festering_strike Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons, dark_transformation, runic_corruption, unholy_pact, festermight(6), static_empowerment(5)
2:27.935 generic T death_coil Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons, dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
2:29.261 generic U scourge_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(2), dark_transformation, sudden_doom, unholy_pact, festermight(6), static_empowerment(5)
2:30.585 trinkets d use_item_dragon_games_equipment Fluffy_Pillow 54.0/100: 54% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(2), dark_transformation, sudden_doom, unholy_pact, festermight(7), static_empowerment(5)
2:30.585 generic T death_coil Fluffy_Pillow 54.0/100: 54% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(2), dark_transformation, sudden_doom, unholy_pact, festermight(7), dragon_games_equipment, static_empowerment(5)
2:31.908 generic T death_coil Fluffy_Pillow 59.0/100: 59% runic_power
2.0/6: 33% rune
icy_talons(3), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
2:33.233 generic U scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), static_empowerment(5)
2:34.558 generic V festering_strike Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight(8), static_empowerment(5)
2:35.884 default E outbreak Fluffy_Pillow 62.0/100: 62% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(8), static_empowerment(5)
2:37.207 generic T death_coil Fluffy_Pillow 72.0/100: 72% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), dark_transformation, sudden_doom, festermight(8), static_empowerment(5)
2:38.532 generic T death_coil Fluffy_Pillow 72.0/100: 72% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), dark_transformation, runic_corruption, festermight(8), static_empowerment(5)
2:39.859 generic U scourge_strike Fluffy_Pillow 42.0/100: 42% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), dark_transformation, runic_corruption, festermight(8), static_empowerment(5)
2:41.185 generic U scourge_strike Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(3), runic_corruption, festermight(9), static_empowerment(5)
2:42.509 generic T death_coil Fluffy_Pillow 73.0/100: 73% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), static_empowerment(5)
2:43.833 generic U scourge_strike Fluffy_Pillow 43.0/100: 43% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
2:45.157 generic V festering_strike Fluffy_Pillow 61.0/100: 61% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
2:46.482 generic T death_coil Fluffy_Pillow 81.0/100: 81% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
2:47.808 generic T death_coil Fluffy_Pillow 51.0/100: 51% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
2:49.132 generic U scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
2:50.457 generic U scourge_strike Fluffy_Pillow 34.0/100: 34% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
2:51.782 generic T death_coil Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), sudden_doom, festermight(3), static_empowerment(5)
2:53.108 generic U scourge_strike Fluffy_Pillow 52.0/100: 52% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
2:54.434 generic T death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:55.760 generic T death_coil Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:57.085 generic U scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:58.412 generic V festering_strike Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
2:59.736 generic T death_coil Fluffy_Pillow 48.0/100: 48% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:01.062 generic U scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:02.388 default E outbreak Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(6), static_empowerment(5)
3:03.713 generic T death_coil Fluffy_Pillow 46.0/100: 46% runic_power
0.0/6: 0% rune
rune_mastery, unholy_strength, icy_talons(3), festermight(6), static_empowerment(5)
3:05.038 default D army_of_the_dead Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
3:06.364 cooldowns M dark_transformation Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
rune_mastery, unholy_strength, icy_talons(3), static_empowerment(5)
3:07.689 cooldowns O apocalypse Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:09.016 cooldowns Q summon_gargoyle Fluffy_Pillow 43.0/100: 43% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:09.016 cooldowns P empower_rune_weapon Fluffy_Pillow 93.0/100: 93% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:09.016 cooldowns R unholy_assault Fluffy_Pillow 98.0/100: 98% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:10.170 cooldowns S soul_reaper Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, dark_transformation, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:11.132 trinkets c use_item_algethar_puzzle_box Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune
unholy_strength, empower_rune_weapon, dark_transformation, unholy_assault, unholy_pact, festermight(4), static_empowerment(5)
3:12.409 racials b berserking Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
unholy_strength, empower_rune_weapon, dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:12.409 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:13.282 generic T death_coil Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, runic_corruption, sudden_doom, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:14.158 generic T death_coil Fluffy_Pillow 80.0/100: 80% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(2), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:15.033 generic T death_coil Fluffy_Pillow 50.0/100: 50% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:15.907 generic U scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
6.0/6: 100% rune
berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:16.783 cooldowns S soul_reaper Fluffy_Pillow 33.0/100: 33% runic_power
5.0/6: 83% rune
berserking, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5)
3:17.657 generic T death_coil Fluffy_Pillow 43.0/100: 43% runic_power
4.0/6: 67% rune
berserking, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5)
3:18.531 generic U scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
4.0/6: 67% rune
berserking, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(5), algethar_puzzle, static_empowerment(5)
3:19.405 generic T death_coil Fluffy_Pillow 36.0/100: 36% runic_power
5.0/6: 83% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5)
3:20.278 generic U scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
5.0/6: 83% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), algethar_puzzle, static_empowerment(5)
3:21.154 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
4.0/6: 67% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), algethar_puzzle, static_empowerment(5)
3:22.028 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
3.0/6: 50% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), algethar_puzzle, static_empowerment(5)
3:22.904 cooldowns S soul_reaper Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), algethar_puzzle, static_empowerment(5)
3:23.780 generic U scourge_strike Fluffy_Pillow 17.0/100: 17% runic_power
3.0/6: 50% rune
berserking, rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), algethar_puzzle, static_empowerment(5)
3:24.655 generic T death_coil Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune
rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), algethar_puzzle, static_empowerment(5)
3:25.619 generic U scourge_strike Fluffy_Pillow 5.0/100: 5% runic_power
3.0/6: 50% rune
rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), algethar_puzzle, static_empowerment(5)
3:26.579 generic U scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune
rune_mastery, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), algethar_puzzle, static_empowerment(5)
3:27.541 generic T death_coil Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5)
3:28.504 generic U scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, algethar_puzzle, static_empowerment(5)
3:29.465 default E outbreak Fluffy_Pillow 24.0/100: 24% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, algethar_puzzle, static_empowerment(5)
3:30.790 cooldowns S soul_reaper Fluffy_Pillow 34.0/100: 34% runic_power
3.0/6: 50% rune
rune_mastery, unholy_strength, icy_talons(3), festermight, algethar_puzzle, static_empowerment(5)
3:32.116 generic T death_coil Fluffy_Pillow 49.0/100: 49% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight, algethar_puzzle, static_empowerment(5)
3:33.442 generic U scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
3:34.766 generic V festering_strike Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
3:36.091 generic T death_coil Fluffy_Pillow 52.0/100: 52% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
3:37.417 cooldowns S soul_reaper Fluffy_Pillow 27.0/100: 27% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
3:38.743 generic T death_coil Fluffy_Pillow 37.0/100: 37% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
3:40.068 generic U scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
3:41.394 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
3:42.722 generic U scourge_strike Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
3:44.048 cooldowns S soul_reaper Fluffy_Pillow 56.0/100: 56% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(5), static_empowerment(5)
3:45.373 generic T death_coil Fluffy_Pillow 66.0/100: 66% runic_power
1.0/6: 17% rune
unholy_strength, festermight(5), static_empowerment(5)
3:46.697 generic V festering_strike Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons, runic_corruption, festermight(5), static_empowerment(5)
3:48.023 generic T death_coil Fluffy_Pillow 56.0/100: 56% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, festermight(5), static_empowerment(5)
3:49.348 generic V festering_strike Fluffy_Pillow 26.0/100: 26% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), static_empowerment(5)
3:50.673 generic T death_coil Fluffy_Pillow 46.0/100: 46% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(2), static_empowerment(5)
3:51.998 cooldowns M dark_transformation Fluffy_Pillow 21.0/100: 21% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), static_empowerment(5)
3:53.323 cooldowns O apocalypse Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:54.647 cooldowns S soul_reaper Fluffy_Pillow 33.0/100: 33% runic_power
4.0/6: 67% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:55.973 default E outbreak Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
3:57.298 generic T death_coil Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune
unholy_strength, dark_transformation, sudden_doom, unholy_pact, festermight(4), static_empowerment(5)
3:58.623 generic U scourge_strike Fluffy_Pillow 53.0/100: 53% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(4), static_empowerment(5)
3:59.949 generic T death_coil Fluffy_Pillow 71.0/100: 71% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
4:01.275 cooldowns S soul_reaper Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune
icy_talons(2), dark_transformation, runic_corruption, unholy_pact, festermight(5), static_empowerment(5)
4:02.602 generic U scourge_strike Fluffy_Pillow 56.0/100: 56% runic_power
4.0/6: 67% rune
icy_talons(2), dark_transformation, unholy_pact, festermight(5), static_empowerment(5)
4:03.926 generic V festering_strike Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune
rune_mastery, icy_talons(2), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
4:05.251 generic T death_coil Fluffy_Pillow 89.0/100: 89% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(2), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
4:06.575 generic T death_coil Fluffy_Pillow 59.0/100: 59% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
4:07.901 cooldowns S soul_reaper Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(6), static_empowerment(5)
4:09.225 generic T death_coil Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(6), static_empowerment(5)
4:10.550 generic U scourge_strike Fluffy_Pillow 14.0/100: 14% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(6), static_empowerment(5)
4:11.875 generic T death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune
rune_mastery, icy_talons(3), dark_transformation, festermight(7), static_empowerment(5)
4:13.202 generic U scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(7), static_empowerment(5)
4:14.527 cooldowns S soul_reaper Fluffy_Pillow 15.0/100: 15% runic_power
1.0/6: 17% rune
icy_talons(3), static_empowerment(5)
4:15.853 Waiting     0.192 sec 25.0/100: 25% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), static_empowerment(5)
4:16.045 generic U scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), static_empowerment(5)
4:17.372 generic T death_coil Fluffy_Pillow 38.0/100: 38% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight, static_empowerment(5)
4:18.699 generic U scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
4:20.024 generic U scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
4:21.350 generic T death_coil Fluffy_Pillow 39.0/100: 39% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
4:22.676 cooldowns S soul_reaper Fluffy_Pillow 9.0/100: 9% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), runic_corruption, festermight(3), static_empowerment(5)
4:24.003 default E outbreak Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
4:25.328 generic U scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(3), static_empowerment(5)
4:26.655 generic T death_coil Fluffy_Pillow 42.0/100: 42% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
4:27.982 Waiting     0.511 sec 12.0/100: 12% runic_power
0.0/6: 0% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
4:28.493 cooldowns S soul_reaper Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
4:30.000 generic T death_coil Fluffy_Pillow 27.0/100: 27% runic_power
0.0/6: 0% rune
icy_talons(3), sudden_doom, festermight(4), static_empowerment(5)
4:31.324 trinkets d use_item_dragon_games_equipment Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(4), static_empowerment(5)
4:31.324 Waiting     1.324 sec 27.0/100: 27% runic_power
1.0/6: 17% rune
icy_talons(3), festermight(4), dragon_games_equipment, static_empowerment(5)
4:32.648 generic V festering_strike Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune
icy_talons(3), festermight(4), static_empowerment(5)
4:33.972 generic T death_coil Fluffy_Pillow 47.0/100: 47% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), festermight(4), static_empowerment(5)
4:35.299 Waiting     1.476 sec 22.0/100: 22% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), festermight(4), static_empowerment(5)
4:36.775 cooldowns N dark_transformation Fluffy_Pillow 22.0/100: 22% runic_power
0.0/6: 0% rune
rune_mastery, icy_talons(3), static_empowerment(5)
4:38.325 cooldowns O apocalypse Fluffy_Pillow 27.0/100: 27% runic_power
1.0/6: 17% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
4:39.651 cooldowns R unholy_assault Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune
rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(3), commander_of_the_dead_window, static_empowerment(5)
4:40.976 cooldowns S soul_reaper Fluffy_Pillow 41.0/100: 41% runic_power
4.0/6: 67% rune
unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(3), commander_of_the_dead_window, static_empowerment(5)
4:42.081 generic U scourge_strike Fluffy_Pillow 51.0/100: 51% runic_power
4.0/6: 67% rune
unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(3), static_empowerment(5)
4:43.187 generic U scourge_strike Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune
unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(4), static_empowerment(5)
4:44.293 generic T death_coil Fluffy_Pillow 82.0/100: 82% runic_power
2.0/6: 33% rune
unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(5), static_empowerment(5)
4:45.399 generic U scourge_strike Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(5), static_empowerment(5)
4:46.504 generic T death_coil Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons, dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
4:47.609 cooldowns S soul_reaper Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
4:48.714 generic U scourge_strike Fluffy_Pillow 85.0/100: 85% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
4:49.820 generic T death_coil Fluffy_Pillow 98.0/100: 98% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
4:50.925 default E outbreak Fluffy_Pillow 68.0/100: 68% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(7), static_empowerment(5)
4:52.030 generic T death_coil Fluffy_Pillow 78.0/100: 78% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, festermight(7), static_empowerment(5)
4:53.136 generic U scourge_strike Fluffy_Pillow 83.0/100: 83% runic_power
3.0/6: 50% rune
icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(7), static_empowerment(5)
4:54.242 cooldowns S soul_reaper Fluffy_Pillow 96.0/100: 96% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), static_empowerment(5)
4:55.347 generic V festering_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(8), static_empowerment(5)
4:56.452 generic T death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), unholy_assault, festermight(8), static_empowerment(5)
4:57.557 generic T death_coil Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune
unholy_strength, icy_talons(3), unholy_assault, festermight(8), static_empowerment(5)
4:58.663 generic T death_coil Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune
unholy_strength, icy_talons(3), unholy_assault, static_empowerment(5)
4:59.769 generic U scourge_strike Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune
unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 6227 5922 3440 (2547)
Agility 1734 2 1822 1736 0
Stamina 3463 0 12965 12348 6827
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 259300 246960 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 15.36% 15.36% 1504
Haste 13.49% 13.49% 2293
Versatility 6.99% 3.99% 818
Attack Power 6538 5922 0
Mastery 44.26% 44.26% 2986
Armor 5338 5338 5338
Run Speed 7 0 0
Leech 2.50% 2.50% 275

Gear

Source Slot Average Item Level: 372.00
Local Head Earthshaker's Steel Visor
ilevel: 372, stats: { 697 Armor, +687 Sta, +218 Vers, +369 Mastery, +315 StrInt }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Nokhud Traditionalist's Pauldrons
ilevel: 372, stats: { 639 Armor, +515 Sta, +258 Crit, +183 Vers, +237 StrInt }
Local Chest Breastplate of Soaring Terror
ilevel: 372, stats: { 929 Armor, +687 Sta, +218 Haste, +369 Mastery, +315 StrInt }, enchant: { +127 StrAgiInt }
Local Waist Illusion Breaker's Waistguard
ilevel: 372, stats: { 523 Armor, +515 Sta, +164 Crit, +277 Mastery, +237 StrInt }
Local Legs Drake Hunter's Greaves
ilevel: 372, stats: { 813 Armor, +687 Sta, +382 Haste, +206 Mastery, +315 StrInt }, enchant: { +89 Sta, +151 StrAgi }
Local Feet Scaleguard's Stalwart Greatboots
ilevel: 372, stats: { 581 Armor, +515 Sta, +287 Vers, +154 Mastery, +237 StrInt }
Local Wrists Thrashing Wind Vambraces
ilevel: 372, stats: { 465 Armor, +386 Sta, +130 Vers, +201 Mastery, +177 StrInt }, enchant: { +175 Leech }
Local Hands Keeper's Iron Grips
ilevel: 372, stats: { 523 Armor, +515 Sta, +258 Crit, +183 Mastery, +237 StrInt }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Mastery }
Local Finger2 Platinum Star Band
ilevel: 372, stats: { +386 Sta, +519 Crit, +271 Mastery }, enchant: { +73 Haste }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 372, stats: { +300 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Dragon Games Equipment
ilevel: 372, stats: { +300 Str }
item effects: { equip: Dragon Games Equipment, use: Dragon Games Equipment }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }, enchant: { +100 Leech }
Local Main Hand Ley-Line Tracer
ilevel: 372, weapon: { 598 - 1112, 3.6 }, stats: { +315 Str, +687 Sta, +369 Haste, +218 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Profile

deathknight="PR_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/fleshcraft
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
actions.precombat+=/variable,name=opener_done,op=setif,value=1,value_else=0,condition=active_enemies>=3

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
# Variables
actions+=/variable,name=apoc_timing,op=setif,value=8,value_else=4,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<4
actions+=/variable,name=garg_pooling,op=setif,value=(((cooldown.summon_gargoyle.remains+1)%gcd)%((rune+1)*(runic_power+20)))*100,value_else=gcd,condition=cooldown.summon_gargoyle.remains<gcd*2
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(2-talent.infected_claws),condition=talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
actions+=/variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&!talent.summon_gargoyle&variable.st_planning|debuff.festering_wound.stack>4|fight_remains<debuff.festering_wound.stack*gcd)
actions+=/variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=pooling_runes,value=talent.soul_reaper&rune<2&target.time_to_pct_35<5&fight_remains>5
actions+=/variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
# Prioritize Army, Outbreak and Maintaining Plaguebringer
actions+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
actions+=/outbreak,target_if=(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
actions+=/wound_spender,if=cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
# Call Action Lists
actions+=/call_action_list,name=opener,if=variable.opener_done=0
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/run_action_list,name=aoe,if=active_enemies>=4
actions+=/run_action_list,name=generic,if=active_enemies<=3

# AoE Action List
actions.aoe=any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(talent.festermight&buff.festermight.remains<3|!talent.festermight)&(death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets=8|!talent.bursting_sores&!talent.vile_contagion|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5|(cooldown.vile_contagion.remains|!talent.vile_contagion)&buff.dark_transformation.up&talent.infected_claws&(buff.empower_rune_weapon.up|buff.unholy_assault.up))|fight_remains<10
actions.aoe+=/abomination_limb,if=rune=0&variable.adds_remain
actions.aoe+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!death_and_decay.ticking&debuff.festering_wound.stack<4&(cooldown.vile_contagion.remains<5|cooldown.apocalypse.ready&cooldown.any_dnd.remains)
actions.aoe+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!death_and_decay.ticking&(cooldown.vile_contagion.remains>5|!talent.vile_contagion)
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=death_and_decay.ticking
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe+=/epidemic,if=!variable.pooling_runic_power
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=cooldown.death_and_decay.remains>10

# Potion
actions.cooldowns=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
# Cooldowns
actions.cooldowns+=/vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/dark_transformation,if=variable.st_planning&(talent.commander_of_the_dead&cooldown.apocalypse.remains<gcd|!talent.commander_of_the_dead)
actions.cooldowns+=/dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&cooldown.dark_transformation.remains
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
actions.cooldowns+=/summon_gargoyle,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
actions.cooldowns+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
actions.cooldowns+=/unholy_blight,if=variable.adds_remain|fight_remains<21
actions.cooldowns+=/abomination_limb,if=variable.st_planning&rune<3
actions.cooldowns+=/unholy_assault,if=variable.st_planning
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.cooldowns+=/sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# Generic
actions.generic=death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
actions.generic+=/any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Opener
actions.opener=festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.opener+=/summon_gargoyle,use_off_gcd=1,if=buff.commander_of_the_dead_window.up
actions.opener+=/death_coil,if=pet.gargoyle.active&runic_power.deficit=0
actions.opener+=/apocalypse,if=buff.commander_of_the_dead_window.up
actions.opener+=/dark_transformation,if=debuff.festering_wound.stack>=4
actions.opener+=/variable,name=opener_done,op=setif,value=1,value_else=0,condition=cooldown.apocalypse.remains|!talent.apocalypse&(cooldown.dark_transformation.remains|cooldown.summon_gargoyle.remains)

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.blood_fury.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&15>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.fireblood.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,slot=trinket1,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

head=earthshakers_steel_visor,id=193735,bonus_id=6808/4786/1594
neck=ukhel_ancestry_beads,id=193676,bonus_id=6808/4786/1594
shoulders=nokhud_traditionalists_pauldrons,id=193686,bonus_id=6808/4786/1594
back=fireproof_drape,id=193763,bonus_id=6808/4786/1594,enchant_id=6597
chest=breastplate_of_soaring_terror,id=193753,bonus_id=6808/4786/1594,enchant_id=6624
wrists=thrashing_wind_vambraces,id=193698,bonus_id=6808/4786/1594,enchant_id=6579
hands=keepers_iron_grips,id=193795,bonus_id=6808/4786/1594
waist=illusion_breakers_waistguard,id=193650,bonus_id=6808/4786/1594
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1594,enchant_id=6489
feet=scaleguards_stalwart_greatboots,id=193728,bonus_id=6808/4786/1594
finger1=unstable_arcane_loop,id=193633,bonus_id=6808/4786/1594,enchant_id=6561
finger2=platinum_star_band,id=193708,bonus_id=6808/4786/1594,enchant_id=6555
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1594
trinket2=dragon_games_equipment,id=193719,bonus_id=6808/4786/1594
main_hand=leyline_tracer,id=193638,bonus_id=6808/4786/1594,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=372.00
# gear_strength=3440
# gear_stamina=6827
# gear_crit_rating=1504
# gear_haste_rating=2293
# gear_mastery_rating=2986
# gear_versatility_rating=818
# gear_leech_rating=275
# gear_armor=5338

PR_Priest_Shadow : 42122 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
42122.0 42122.0 32.4 / 0.077% 5621.9 / 13.3% 150.7
APS APS Error APS Range APR
513.0 2.0 / 0.388% 239.7 / 46.7% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
223.1 221.8 Mana 0.00% 45.3 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIk04ABAAAAAAAAAAAAQikkSESRLJRSJhEBpRSSiECSQIFpFSCA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 42122
Devouring Plague 9225 21.9% 50.7 5.89sec 54527 49199 Direct 50.7 19167 41007 23354 19.2%
Periodic 128.6 10366 21165 12299 17.9% 85.3%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.73 50.73 128.59 128.59 29.77 1.1083 1.9908 2766304.58 2766304.58 0.00% 8860.26 49198.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 41.01 24 59 19166.62 15379 30235 19156.75 17716 20948 785947 785947 0.00%
crit 19.17% 9.73 0 23 41007.29 30759 60469 41035.05 0 53329 398877 398877 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.10% 105.57 72 140 10365.91 65 31666 10363.97 8879 12161 1094361 1094361 0.00%
crit 17.90% 23.01 7 44 21165.31 147 65820 21167.66 15141 30225 487119 487119 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.701215
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.75

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.582811
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 70.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [N]:50.73
  • if_expr:(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
Halo 0 (434) 0.0% (1.0%) 4.9 62.99sec 26566 24407

Stats Details: Halo

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.90 0.00 0.00 0.00 0.00 1.0886 0.0000 0.00 0.00 0.00% 24407.19 24407.19

Action Details: Halo

  • id:120644
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Shadow damage to enemies. Healing reduced beyond {$s1=6} targets.

Action Priority List

    main
    [V]:4.91
  • if_expr:raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
    Halo (_damage) 434 1.0% 4.9 62.99sec 26566 0 Direct 4.9 22021 47757 26706 18.2%

Stats Details: Halo Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.90 4.87 0.00 0.00 0.00 0.0000 0.0000 130163.57 130163.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.81% 3.99 0 8 22021.09 16818 35529 22053.39 0 35529 87812 87812 0.00%
crit 18.19% 0.89 0 4 47757.08 33636 71058 29951.78 0 71058 42352 42352 0.00%

Action Details: Halo Damage

  • id:390964
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.442000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390964
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Idol of C'Thun 0 (3216) 0.0% (7.6%) 0.0 0.00sec 0 0

Stats Details: Idol Of Cthun

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Idol Of Cthun

  • id:377349
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377349
  • name:Idol of C'Thun
  • school:physical
  • tooltip:
  • description:Mind Flay and Mind Sear have a chance to spawn a Void Tendril or Void Lasher that channels at your target for {$377355d=15 seconds}, generating {$s1=3} insanity every {$193473t1=1} sec.
    Mind Flay (void_tendril) 7291  / 3216 7.6% 22.0 12.62sec 43844 5854 Periodic 164.9 5011 10160 5854 16.4% 55.0%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.02 0.00 164.91 164.91 0.00 7.4897 1.0000 965348.17 965348.17 0.00% 5853.89 5853.89
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.63% 137.91 42 315 5011.14 4352 6701 5009.31 4709 5549 691106 691106 0.00%
crit 16.37% 26.99 4 65 10159.90 8705 13402 10146.84 9311 11695 274242 274242 0.00%

Action Details: Mind Flay

  • id:193473
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:1667.76
  • base_td_mult:1.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:{$?=}{$=}w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=30}%.

Action Priority List

    default
    [ ]:4.11
Mind Blast 4048 9.6% 62.9 4.76sec 19284 17451 Direct 62.9 15797 34618 19284 18.5%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 62.94 62.94 0.00 0.00 0.00 1.1051 0.0000 1213737.20 1213737.20 0.00% 17450.79 17450.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.47% 51.28 30 73 15797.24 10050 27600 15793.89 14178 17605 810061 810061 0.00%
crit 18.53% 11.66 1 25 34617.72 20100 55200 34654.07 22850 46539 403677 403677 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.{$?s137033=true}[ |cFFFFFFFFGenerates {$/100;s2=0} Insanity|r][]{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [M]:5.07
  • if_expr:(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
    main
    [Q]:56.84
  • if_expr:variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
    main
    [T]:1.22
  • if_expr:raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
Mind Flay 587 1.4% 6.8 39.18sec 25970 7715 Periodic 40.4 3749 7695 4351 15.3% 7.5%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.77 0.00 40.43 40.43 0.00 3.3662 0.5564 175907.98 175907.98 0.00% 7715.26 7715.26
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 84.74% 34.26 3 85 3748.95 3020 5614 3751.77 3242 4682 128430 128430 0.00%
crit 15.26% 6.17 0 23 7694.98 6040 11229 7600.83 0 11229 47478 47478 0.00%

Action Details: Mind Flay

  • id:15407
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:2.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.235400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.50
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=4.500 seconds} and slowing their movement speed by {$s2=50}%. |cFFFFFFFFGenerates {$=}{{$s4=6}*{$s3=200}/100} Insanity over the duration.|r

Action Priority List

    main
    [U]:40.59
  • if_expr:buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
    main
    [X]:6.77
  • interrupt_if_expr:ticks>=2
Mind Flay: Insanity 5541 13.2% 40.6 7.28sec 40944 18660 Periodic 161.7 8695 17764 10280 17.5% 29.7%

Stats Details: Mind Flay Insanity

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.59 0.00 161.68 161.68 0.00 2.1942 0.5509 1662013.11 1662013.11 0.00% 18660.47 18660.47
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.53% 133.43 83 189 8694.97 6644 12351 8692.78 8303 9224 1160200 1160200 0.00%
crit 17.47% 28.25 10 52 17764.45 13288 24703 17763.21 16384 19823 501813 501813 0.00%

Action Details: Mind Flay Insanity

  • id:391403
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.517880
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:391403
  • name:Mind Flay: Insanity
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=70}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r
Mind Spike 849 2.0% 10.1 25.37sec 25204 23089 Direct 10.1 21198 45964 25203 16.2%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.08 10.08 0.00 0.00 0.00 1.0917 0.0000 253999.76 253999.76 0.00% 23088.79 23088.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.83% 8.45 0 22 21198.02 15395 42280 21281.45 0 35350 179078 179078 0.00%
crit 16.17% 1.63 0 7 45963.73 30791 84559 36806.18 0 84559 74922 74922 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.440000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage.{$?s391090=false}[ Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times.][] |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity|r{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [W]:10.08
  • if_expr:buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
Mindgames 1389 3.3% 7.7 40.43sec 53732 48432 Direct 7.7 (7.7) 43568 95300 53731 19.6% (19.6%)

Stats Details: Mindgames

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.75 7.75 0.00 0.00 0.00 1.1095 0.0000 416269.89 416269.89 0.00% 48431.63 48431.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.35% 6.22 2 10 43567.77 32802 69296 43493.35 35248 55044 271206 271206 0.00%
crit 19.65% 1.52 0 6 95300.31 65605 138592 78582.85 0 138592 145064 145064 0.00%

Action Details: Mindgames

  • id:375901
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:375901
  • name:Mindgames
  • school:shadow
  • tooltip:The next {$=}w2 damage and {$=}w5 healing dealt will be reversed.
  • description:Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target.

Action Priority List

    main
    [R]:7.78
  • if_expr:spell_targets.mind_sear<5&variable.all_dots_up
Shadow Crash 0 (1190) 0.0% (2.8%) 8.6 32.89sec 41388 36506

Stats Details: Shadow Crash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.63 0.00 0.00 0.00 0.00 1.1338 0.0000 0.00 0.00 0.00% 36505.79 36505.79

Action Details: Shadow Crash

  • id:205385
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:15.0

Spelldata

  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r

Action Priority List

    main
    [S]:8.63
  • if_expr:raid_event.adds.in>10
    Shadow Crash (_damage) 1190 2.8% 9.6 32.83sec 37264 0 Direct 9.6 30816 65998 37264 18.3%

Stats Details: Shadow Crash Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 9.58 0.00 0.00 0.00 0.0000 0.0000 357063.17 357063.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.67% 7.83 2 12 30815.94 20814 49353 30724.84 24978 37617 241159 241159 0.00%
crit 18.33% 1.76 0 7 65998.39 41627 98706 56573.50 0 98706 115904 115904 0.00%

Action Details: Shadow Crash Damage

  • id:205386
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.103750
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadow Weaving 661 1.6% 131.4 2.22sec 1505 0 Direct 130.4 1517 0 1517 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.36 130.36 0.00 0.00 0.00 0.0000 0.0000 197695.73 197695.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 130.36 91 159 1516.60 353 4883 1517.27 1211 2076 197696 197696 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1308.38
  • base_dd_max:1308.38
  • base_dd_mult:1.00

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}
Shadow Word: Death 1240 2.9% 12.8 24.31sec 29089 25828 Direct 12.8 24230 50544 29089 18.5%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.76 12.76 0.00 0.00 0.00 1.1263 0.0000 371116.48 371116.48 0.00% 25827.58 25827.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.53% 10.40 4 16 24229.57 10905 54837 24189.96 15042 36779 252038 252038 0.00%
crit 18.47% 2.36 0 8 50544.05 21810 109674 46551.01 0 109674 119078 119078 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target. {$?=}A364675[Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]

Action Priority List

    main
    [L]:3.75
  • if_expr:pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
    main
    [O]:9.00
  • target_if_expr:(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
Shadow Word: Pain 2785 6.6% 9.6 32.83sec 87167 0 Periodic 254.1 2774 5677 3287 17.7% 99.3%

Stats Details: Shadow Word Pain

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 0.00 254.09 254.09 210.69 0.0000 1.1721 835244.03 835244.03 0.00% 2804.60 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.31% 209.15 153 266 2773.71 1080 3962 2773.16 2658 2937 580119 580119 0.00%
crit 17.69% 44.94 20 75 5677.06 4262 7924 5677.89 5330 6228 255125 255125 0.00%

Action Details: Shadow Word Pain

  • id:589
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:3.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.095880
  • base_td:0.00
  • base_td_mult:1.73
  • dot_duration:21.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=2} sec.
  • description:A word of darkness that causes {$?a390707=false}[{$=}{{$s1=0}*(1+{$390707s1=15}/100)}][{$s1=0}] Shadow damage instantly, and an additional {$?a390707=false}[{$=}{{$=}o2*(1+{$390707s1=15}/100)}][{$=}o2] Shadow damage over {$d=16 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m3=300}/100} Insanity.|r][]
Shadowy Apparitions 0 (1215) 0.0% (2.9%) 113.7 2.63sec 3207 0

Stats Details: Shadowy Apparitions

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowy Apparitions

  • id:341491
  • school:physical
  • range:0.0
  • travel_speed:6.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:341491
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:Mind Blast, Devouring Plague, and Void Bolt have a {$s4=100}% chance to conjure Shadowy Apparitions and Mind Sear has a {$s3=50}% chance to conjure Shadowy Apparitions. Shadowy Apparitions float towards all targets afflicted by your Vampiric Touch for {$148859s1=0} Shadow damage. Critical strikes with Mind Blast, Devouring Plague, and Void Bolt increase the damage of the Shadowy Apparitions they conjure by {$s2=100}%.
    Shadowy Apparition 1215 2.9% 111.9 2.62sec 3258 0 Direct 110.1 3311 0 3311 0.0%

Stats Details: Shadowy Apparition

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 111.89 110.10 0.00 0.00 0.00 0.0000 0.0000 364583.06 364583.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 110.10 78 149 3311.48 2508 5299 3310.19 3104 3555 364583 364583 0.00%

Action Details: Shadowy Apparition

  • id:148859
  • school:shadow
  • range:100.0
  • travel_speed:6.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Spelldata

  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals $148859sw1 Shadow damage.}
Soulseeker Arrow 1147 2.7% 7.3 36.94sec 47132 0 Periodic 86.9 3959 0 3959 0.0% 39.0%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.30 0.00 86.86 86.86 2.51 0.0000 1.3481 343883.10 343883.10 0.00% 2936.79 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 86.86 14 185 3958.96 28 4452 3956.44 3841 4166 343883 343883 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3665.83
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1747}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 3341 7.9% 9.6 32.83sec 104556 0 Periodic 167.0 5062 10358 5998 17.7% 99.2%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 0.00 167.03 167.03 210.69 0.0000 1.7809 1001862.97 1001862.97 0.00% 3367.96 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.32% 137.50 95 178 5061.75 32 7225 5060.83 4852 5364 695998 695998 0.00%
crit 17.68% 29.53 12 54 10357.84 4062 14450 10359.50 9478 11607 305865 305865 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.201960
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [P]:0.00
  • target_if_expr:(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
pet - mindbender 11333 / 5255
Inescapable Torment 0 (2839) 0.0% (6.7%) 41.9 6.98sec 20265 0

Stats Details: Inescapable Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.91 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Inescapable Torment

  • id:373427
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:373427
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.
    Inescapable Torment (_damage) 6118 6.7% 41.9 6.98sec 20265 0 Direct 41.9 16162 33968 20265 23.0%

Stats Details: Inescapable Torment Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.91 41.91 0.00 0.00 0.00 0.0000 0.0000 849282.68 849282.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.96% 32.25 15 50 16162.29 10882 24138 16156.05 14453 18766 521275 521275 0.00%
crit 23.04% 9.66 1 23 33967.61 21764 48275 33991.75 25181 44020 328007 328007 0.00%

Action Details: Inescapable Torment Damage

  • id:373442
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.923780
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:373442
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:{$@spelldesc373427=Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.}
melee 5216 5.7% 131.4 2.22sec 5505 5320 Direct 131.4 4470 9089 5505 22.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.36 131.36 0.00 0.00 0.00 1.0348 0.0000 723111.90 723111.90 0.00% 5319.82 5319.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.59% 101.92 62 135 4469.59 3944 6103 4468.33 4226 4839 455530 455530 0.00%
crit 22.41% 29.44 10 49 9089.17 7887 12205 9090.85 8346 10216 267582 267582 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
PR_Priest_Shadow 0
Mental Fortitude 513 99.9% 336.0 0.88sec 456 0 Direct 347.8 441 0 441 0.0%

Stats Details: Mental Fortitude

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 335.98 347.77 0.00 0.00 0.00 0.0000 0.0000 153295.99 7078119.51 97.83% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 347.77 255 438 440.81 0 27823 441.85 264 667 153296 7078120 97.83%

Action Details: Mental Fortitude

  • id:377065
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21610.00
  • base_dd_max:21610.00
  • base_dd_mult:1.00

Spelldata

  • id:377065
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
Simple Action Stats Execute Interval
PR_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 2.9 123.47sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    default
    [D]:2.94
  • if_expr:buff.power_infusion.up|fight_remains<=15
Dark Ascension 5.3 61.87sec

Stats Details: Dark Ascension

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.32 0.00 102.74 0.00 0.00 1.1676 1.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Dark Ascension

  • id:391109
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:30.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:391109
  • name:Dark Ascension
  • school:shadow
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r

Action Priority List

    cds
    [G]:5.33
  • if_expr:pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
Desperate Prayer 0.3 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.28 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [J]:0.28
  • if_expr:health.pct<=75
Devouring Plague (_heal) 179.3 1.66sec

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 179.32 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 70.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Halo (_heal) 4.9 62.99sec

Stats Details: Halo Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 4.90 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Halo Heal

  • id:390971
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.610000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390971
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Mindbender 5.4 60.64sec

Stats Details: Mindbender

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.44 0.00 0.00 0.00 0.00 1.1689 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindbender

  • id:200174
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$=}{{$200010s1=300}/100} Insanity each time the Mindbender attacks.|r

Action Priority List

    cds
    [I]:5.45
  • if_expr:(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
Mindgames (_damage_reversal) 7.7 40.43sec

Stats Details: Mindgames Damage Reversal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 7.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindgames Damage Reversal

  • id:323706
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:323706
  • name:Mindgames
  • school:shadow
  • tooltip:
  • description:{$@spelldesc323673=Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. {$?=}c3[For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing generate up to {$=}{{$323706s2=10}*2} Insanity.|r] ][For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing restore up to {$=}{{$323706s3=2}*2}% mana.|r]}
Elemental Potion of Ultimate Power 1.4 309.40sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.40 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.40
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
Power Infusion 2.9 123.67sec

Stats Details: Power Infusion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Power Infusion

  • id:10060
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.

Action Priority List

    cds
    [F]:2.92
  • if_expr:(buff.voidform.up|buff.dark_ascension.up)
Shadow Crash (_dots) 8.6 32.89sec

Stats Details: Shadow Crash Dots

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.63 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadow Crash Dots

  • id:391286
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:391286
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Spoils of Neltharus 2.9 123.67sec

Stats Details: Spoils Of Neltharus

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Spoils Of Neltharus

  • id:381768
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:381768
  • name:Spoils of Neltharus
  • school:physical
  • tooltip:
  • description:Open the spoils and loot the first item you find to gain its fleeting power, increasing a secondary stat by {$381766s1=1144} for {$s2=20} sec.
Vampiric Touch (_heal) 167.0 1.78sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 167.03 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:PR_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2572.12
  • base_dd_max:2572.12
  • base_dd_mult:1.00

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ancient Madness 5.3 0.0 61.9sec 61.9sec 19.4sec 34.29% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_ancient_madness
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.2s / 70.5s
  • trigger_min/max:61.2s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • ancient_madness_1:1.66%
  • ancient_madness_2:1.67%
  • ancient_madness_3:1.67%
  • ancient_madness_4:1.68%
  • ancient_madness_5:1.68%
  • ancient_madness_6:1.69%
  • ancient_madness_7:1.69%
  • ancient_madness_8:1.70%
  • ancient_madness_9:1.71%
  • ancient_madness_10:1.71%
  • ancient_madness_11:1.72%
  • ancient_madness_12:1.72%
  • ancient_madness_13:1.73%
  • ancient_madness_14:1.73%
  • ancient_madness_15:1.74%
  • ancient_madness_16:1.75%
  • ancient_madness_17:1.75%
  • ancient_madness_18:1.76%
  • ancient_madness_19:1.76%
  • ancient_madness_20:1.77%

Spelldata

  • id:341240
  • name:Ancient Madness
  • tooltip:
  • description:Voidform and Dark Ascension increase your critical strike chance by {$s1=10}% for {$194249d=20 seconds}, reducing by {$=}{{$s3=5}/10}.1% every sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.9 0.0 123.5sec 123.5sec 14.7sec 14.46% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:120.0s / 132.9s
  • trigger_min/max:120.0s / 132.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • blood_fury_1:14.46%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Coalescing Shadows 56.4 149.6 5.3sec 1.4sec 3.4sec 64.23% 76.54% 72.8 (72.8) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 39.6s
  • trigger_min/max:0.0s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.7s

Stack Uptimes

  • coalescing_shadows_1:22.23%
  • coalescing_shadows_2:14.51%
  • coalescing_shadows_3:27.48%

Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Coalescing Shadows (_dot) 2.0 53.7 127.8sec 5.4sec 144.3sec 98.14% 98.84% 53.7 (53.7) 1.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_coalescing_shadows_dot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.1s / 354.2s
  • trigger_min/max:0.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.1s

Stack Uptimes

  • coalescing_shadows_dot_1:98.14%

Spelldata

  • id:391244
  • name:Coalescing Shadows
  • tooltip:Your periodic damage is increased by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Ascension 5.3 0.0 61.9sec 61.9sec 19.4sec 34.29% 42.12% 97.8 (97.8) 5.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_ascension
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.2s / 70.5s
  • trigger_min/max:61.2s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • dark_ascension_1:34.29%

Spelldata

  • id:391109
  • name:Dark Ascension
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Dark Evangelism 1.0 201.1 196.8sec 1.4sec 292.9sec 97.69% 98.23% 197.1 (197.1) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_dark_evangelism
  • max_stacks:5
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:74.5s / 310.1s
  • trigger_min/max:0.3s / 29.9s
  • trigger_pct:100.00%
  • duration_min/max:26.8s / 353.8s

Stack Uptimes

  • dark_evangelism_1:0.12%
  • dark_evangelism_2:0.12%
  • dark_evangelism_3:0.12%
  • dark_evangelism_4:0.80%
  • dark_evangelism_5:96.52%

Spelldata

  • id:391099
  • name:Dark Evangelism
  • tooltip:Periodic Shadow damage increased by {$=}w1%.
  • description:{$@spelldesc391095=Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391095
  • name:Dark Evangelism
  • tooltip:
  • description:Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Death and Madness (_insanity_gain) 0.4 0.0 0.0sec 0.0sec 0.0sec 0.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_insanity_gain
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s

Stack Uptimes

Spelldata

  • id:321973
  • name:Death and Madness
  • tooltip:{$=}{{$m1=750}/100} Insanity generated every {$t1=1} sec.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_reset) 2.8 0.0 22.4sec 22.4sec 16.9sec 15.50% 0.00% 0.0 (0.0) 1.9

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_reset
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.9s / 38.2s
  • trigger_min/max:20.9s / 38.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • death_and_madness_reset_1:15.50%

Spelldata

  • id:390628
  • name:Death and Madness
  • tooltip:
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:321291
  • name:Death and Madness
  • tooltip:
  • description:If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Desperate Prayer 0.3 0.0 0.0sec 0.0sec 9.2sec 0.84% 0.00% 2.3 (2.3) 0.2

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • desperate_prayer_1:0.84%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Devoured Pride 1.5 0.0 61.0sec 0.0sec 22.8sec 10.89% 12.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 63.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.0s / 33.0s

Stack Uptimes

  • devoured_pride_1:10.89%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=15}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=15}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 309.4sec 309.4sec 27.3sec 12.53% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:306.1s / 319.2s
  • trigger_min/max:306.1s / 319.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.53%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mental Fortitude 4.5 331.5 82.6sec 0.9sec 64.1sec 95.18% 100.00% 331.5 (331.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.1s / 330.1s
  • trigger_min/max:0.0s / 31.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 324.0s

Stack Uptimes

  • mental_fortitude_1:95.18%

Spelldata

  • id:377065
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Mind Devourer 6.2 0.2 42.0sec 40.8sec 2.1sec 4.22% 11.93% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_devourer
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 326.2s
  • trigger_min/max:0.8s / 326.2s
  • trigger_pct:10.02%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • mind_devourer_1:4.22%

Spelldata

  • id:373204
  • name:Mind Devourer
  • tooltip:Your next Devouring Plague or Mind Sear costs 0 insanity.
  • description:{$@spelldesc373202=Mind Blast has a {$s1=15}% chance to make your next Devouring Plague or Mind Sear cost no insanity.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373202
  • name:Mind Devourer
  • tooltip:
  • description:Mind Blast has a {$s1=15}% chance to make your next Devouring Plague or Mind Sear cost no insanity.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Mind Flay: Insanity 41.1 9.6 7.3sec 5.9sec 3.2sec 44.16% 0.00% 9.6 (9.6) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_mind_flay_insanity
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 31.7s
  • trigger_min/max:0.8s / 24.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.3s

Stack Uptimes

  • mind_flay_insanity_1:44.16%

Spelldata

  • id:391401
  • name:Mind Flay: Insanity
  • tooltip:Mind Flay is temporarily empowered.
  • description:{$@spelldesc391399=Devouring Plague transforms your next Mind Flay into Mind Flay: Insanity. Lasts {$391401d=10 seconds}. {$@=}spellicon391403 {$@=}spellname391403 {$@spelldesc391403=Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Infusion 2.9 0.0 123.7sec 123.7sec 19.4sec 18.93% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:122.4s / 132.9s
  • trigger_min/max:122.4s / 132.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • power_infusion_1:18.93%

Spelldata

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 17.3 0.7 16.8sec 16.1sec 1.4sec 7.81% 27.22% 0.7 (0.7) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:2.40
  • modifier:1.00

Trigger Details

  • interval_min/max:0.5s / 70.8s
  • trigger_min/max:0.5s / 70.8s
  • trigger_pct:7.12%
  • duration_min/max:0.0s / 8.7s

Stack Uptimes

  • shadowy_insight_1:7.81%

Spelldata

  • id:375981
  • name:Shadowy Insight
  • tooltip:Your next Mind Blast is instant cast.
  • description:{$@spelldesc375888=Mind Blast gains an additional charge. Shadow Word: Pain periodic damage has a chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.9sec 45.6sec 16.5sec 23.67% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 209.8s
  • trigger_min/max:0.0s / 209.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.7s

Stack Uptimes

  • sophic_devotion_1:23.67%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Crit) 0.7 0.0 159.4sec 159.4sec 19.4sec 4.71% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 254.3s
  • trigger_min/max:122.4s / 254.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_crit_1:4.71%

Spelldata

  • id:381954
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Critical Strike increased by {$=}w1.][Through a crack in the chest you glimpse a ruby sphere, which would increase your Critical Strike when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Haste) 0.7 0.0 155.0sec 155.0sec 19.5sec 4.73% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 253.9s
  • trigger_min/max:122.4s / 253.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_haste_1:4.73%

Spelldata

  • id:381955
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Haste increased by {$=}w1.][Through a crack in the chest you glimpse a bronze hourglass, which would increase your Haste when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Mastery) 0.7 0.0 156.4sec 156.4sec 19.4sec 4.77% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 252.8s
  • trigger_min/max:122.4s / 252.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_mastery_1:4.77%

Spelldata

  • id:381956
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Mastery increased by {$=}w1.][Through a crack in the chest you glimpse an emerald bell, which would increase your Mastery when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Spoils of Neltharus (Vers) 0.7 0.0 156.1sec 156.1sec 19.4sec 4.72% 0.00% 0.0 (0.0) 0.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_spoils_of_neltharus_stat_vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2116.65

Trigger Details

  • interval_min/max:122.4s / 254.3s
  • trigger_min/max:122.4s / 254.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • spoils_of_neltharus_stat_vers_1:4.72%

Spelldata

  • id:381957
  • name:Spoils of Neltharus
  • tooltip:{$?=}e0[Versatility increased by {$=}w1.][Through a crack in the chest you glimpse an azure rod, which would increase your Versatility when looted.]
  • description:{$@spelldesc381766=Your spells have a chance to jostle the spoils, reordering the treasure within.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Surge of Darkness 12.9 14.8 23.0sec 10.5sec 12.4sec 53.34% 100.00% 3.6 (3.6) 7.6

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_surge_of_darkness
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 132.6s
  • trigger_min/max:0.0s / 132.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 100.0s

Stack Uptimes

  • surge_of_darkness_1:25.79%
  • surge_of_darkness_2:14.44%
  • surge_of_darkness_3:13.11%

Spelldata

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike is instant cast, and deals {$s2=200}% additional damage.
  • description:{$@spelldesc162448=Your Vampiric Touch and Devouring Plague damage has a chance to cause your next Mind Spike to be instant cast and deal {$87160s2=200}% additional damage. Stacks up to {$87160u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Twist of Fate 1.0 205.1 0.0sec 0.5sec 104.4sec 34.79% 32.71% 205.1 (205.1) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 4.9s
  • trigger_pct:100.00%
  • duration_min/max:81.8s / 125.9s

Stack Uptimes

  • twist_of_fate_1:34.79%

Spelldata

  • id:390978
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$=}w1%.
  • description:{$@spelldesc390972=After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390972
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Shadowy Apparition from Devouring Plague 50.7 35.0 68.0 5.9s 0.8s 24.4s
Shadowy Apparition from Mind Blast 62.9 45.0 85.0 4.8s 0.0s 15.9s
Mind Devourer free Devouring Plague proc 6.3 0.0 19.0 40.8s 0.8s 326.2s
Void Tendril proc from Idol of C'Thun 11.3 4.0 25.0 25.1s 0.3s 110.1s
Shadowy Insight procs 17.3 7.0 33.0 16.8s 0.5s 70.8s
Shadowy Insight procs lost to overflow 0.7 0.0 6.0 90.3s 0.6s 319.1s
Coalescing Shadows from Mind Fay 50.6 25.0 79.0 5.7s 0.3s 69.9s
Coalescing Shadows from Shadow Word: Pain 15.2 2.0 35.0 18.5s 0.5s 207.7s
Coalescing Shadows from Shadowy Apparition 8.8 0.0 23.0 29.5s 0.0s 271.4s
Surge of Darkness from Vampiric Touch 13.3 1.0 30.0 21.0s 0.8s 222.4s
Surge of Darkness from Devouring Plague 14.3 2.0 31.0 19.6s 0.0s 221.5s
Mind Flay: Insanity casts that did not channel for full ticks 0.3 0.0 1.0 0.0s 0.0s 0.0s
Idol of Y'Shaarj Devoured Violence procs 4.0 3.0 5.0 60.7s 60.0s 63.4s
Mindgames casts without full Mastery value 0.5 0.0 4.0 102.5s 32.9s 296.7s
Inescapable Torment expired when Mind Blast was ready 3.2 0.0 8.0 94.2s 0.0s 335.9s
Inescapable Torment expired when Shadow Word: Death was ready 0.7 0.0 5.0 161.2s 0.1s 335.9s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 81.10% 74.43% 85.90% 10.4s 0.0s 45.5s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Priest_Shadow
Auspicious SpiritsInsanity110.10109.814.82%1.000.280.26%
Insanity Gained from Idol of C'thun Mind Flay'sInsanity164.91327.8914.40%1.991.930.59%
MindbenderInsanity131.36392.1117.22%2.991.960.50%
Throes of PainInsanity1.004.940.22%4.940.061.14%
Dark AscensionInsanity5.32154.396.78%29.045.093.19%
mana_regenMana834.4866537.12100.00%79.73412795.6686.12%
Mind BlastInsanity62.94376.1216.52%5.981.520.40%
Mind FlayInsanity40.4280.553.54%1.990.300.37%
Mind Flay: InsanityInsanity161.68646.0528.38%4.000.690.11%
Mind SpikeInsanity10.0840.311.77%4.000.000.00%
Shadow CrashInsanity9.63144.416.34%15.000.000.00%
Vampiric TouchInsanity0.000.000.00%4.000.000.00%
Usage Type Count Total Avg RPE APR
PR_Priest_Shadow
Devouring PlagueInsanity 50.732230.8243.9743.971240.04
HaloMana 4.9012249.032500.002499.9510.63
MindgamesMana 7.7538736.175000.005000.0410.75
Shadow Word: DeathMana 12.7615947.711250.001250.0123.27
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 216100.0 305.07 297.13 2159552.4 212787.2 69120.9 216100.0
Mana 49999.0 221.79 223.11 412796.0 49603.1 43753.8 49999.0
Insanity 15.0 7.59 7.44 11.8 45.8 5.0 100.0

Statistics & Data Analysis

Fight Length
PR_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Priest_Shadow Damage Per Second
Count 7499
Mean 42121.95
Minimum 36421.39
Maximum 47706.52
Spread ( max - min ) 11285.13
Range [ ( max - min ) / 2 * 100% ] 13.40%
Standard Deviation 1430.4333
5th Percentile 39854.30
95th Percentile 44562.06
( 95th Percentile - 5th Percentile ) 4707.76
Mean Distribution
Standard Deviation 16.5183
95.00% Confidence Interval ( 42089.58 - 42154.33 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4431
0.1 Scale Factor Error with Delta=300 17468
0.05 Scale Factor Error with Delta=300 69869
0.01 Scale Factor Error with Delta=300 1746703
Priority Target DPS
PR_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 42121.95
Minimum 36421.39
Maximum 47706.52
Spread ( max - min ) 11285.13
Range [ ( max - min ) / 2 * 100% ] 13.40%
Standard Deviation 1430.4333
5th Percentile 39854.30
95th Percentile 44562.06
( 95th Percentile - 5th Percentile ) 4707.76
Mean Distribution
Standard Deviation 16.5183
95.00% Confidence Interval ( 42089.58 - 42154.33 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4431
0.1 Scale Factor Error with Delta=300 17468
0.05 Scale Factor Error with Delta=300 69869
0.01 Scale Factor Error with Delta=300 1746703
DPS(e)
PR_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 42121.95
Minimum 36421.39
Maximum 47706.52
Spread ( max - min ) 11285.13
Range [ ( max - min ) / 2 * 100% ] 13.40%
Damage
PR_Priest_Shadow Damage
Count 7499
Mean 10089844.62
Minimum 7524699.33
Maximum 12568212.49
Spread ( max - min ) 5043513.16
Range [ ( max - min ) / 2 * 100% ] 24.99%
DTPS
PR_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 297.21
Minimum 0.00
Maximum 1104.75
Spread ( max - min ) 1104.75
Range [ ( max - min ) / 2 * 100% ] 185.85%
HPS
PR_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 304.62
Minimum 0.00
Maximum 997.79
Spread ( max - min ) 997.79
Range [ ( max - min ) / 2 * 100% ] 163.78%
TMI
PR_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 arcane_torrent
7 0.00 use_item,name=shadowed_orb_of_torment
8 0.00 variable,name=mind_sear_cutoff,op=set,value=2
9 0.00 shadow_crash,if=talent.shadow_crash.enabled
A 0.00 mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
B 0.00 vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled
Default action list Executed every time the actor is available.
# count action,conditions
C 1.40 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
0.00 variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
0.00 variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
0.00 variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
0.00 variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
0.00 variable,name=is_vt_possible,op=set,value=0,default=1
0.00 variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
0.00 variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
0.00 variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
D 2.94 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 variable,name=pool_amount,op=set,value=60
E 0.00 run_action_list,name=main
actions.cds
# count action,conditions
F 2.92 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
G 5.33 dark_ascension,if=pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
H 0.00 call_action_list,name=trinkets
I 5.45 mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
J 0.28 desperate_prayer,if=health.pct<=75
actions.main
# count action,conditions
K 0.00 call_action_list,name=cds
0.00 mind_blast,if=cooldown.mind_blast.charges>=2&talent.mind_devourer&spell_targets.mind_sear>=3&spell_targets.mind_sear<=7&!buff.mind_devourer.up
Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
L 3.75 shadow_word_death,if=pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
M 5.07 mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
0.00 damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
0.00 void_bolt,if=variable.dots_up&insanity<=85
0.00 mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
0.00 mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
N 50.73 devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
O 9.00 shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
P 0.00 vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
0.00 shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
Q 56.84 mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
R 7.78 mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
S 8.63 shadow_crash,if=raid_event.adds.in>10
0.00 dark_void,if=raid_event.adds.in>20
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
0.00 void_torrent,if=insanity<=35,target_if=variable.dots_up
T 1.22 mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
0.00 vampiric_touch,if=buff.unfurling_darkness.up
U 40.59 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
V 4.91 halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
0.00 divine_star,if=spell_targets.divine_star>1
Use when it will hit at least 2 targets.
0.00 lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75
W 10.08 mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
X 6.77 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>30
Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain
Use Shadow Word: Pain while moving as a low-priority action
actions.trinkets
# count action,conditions
0.00 use_item,name=scars_of_fraternal_strife,if=(!buff.scars_of_fraternal_strife_4.up&time>1)|(buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10)
0.00 use_item,name=macabre_sheet_music,if=cooldown.void_eruption.remains>10|cooldown.dark_ascension.remains>10
0.00 use_item,name=soulletting_ruby,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10,target_if=min:target.health.pct
0.00 use_item,name=architects_ingenuity_core
Use this on CD for max CDR
Y 2.92 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10
Default fallback for usable items: Use on cooldown in order by trinket slot.

Sample Sequence

012589IMGCFDYNOQRUQVNUQWXNQUXMNUWWQNQUXNQSUQNURQWWWXNQUVQXIGNOQQNSQUNUQNNQRULNQNUQQVNUQNQSUNNQUQNUWIOGFDYNQQRQUNUQWSNUQNUOVQNUWNQUWNNQUQRNNQSUNQUNUQIOXGNQUNQQUNSQONRUQXNUQVWNUQWNUQSNUXILLMMNGFDYQRUNQQUNQQULLNQSNNMQUNQUNNQQOOQNRUQWNS

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 2 augmentation PR_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 5 shadowform Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 8 mind_sear_cutoff Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
Pre precombat 9 shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
static_empowerment
0:00.000 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
bloodlust, static_empowerment
0:00.938 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
bloodlust, coalescing_shadows, static_empowerment
0:01.877 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
bloodlust, coalescing_shadows_dot, static_empowerment(2)
0:02.816 default C potion Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3)
0:02.816 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.816 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.816 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.816 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(3), elemental_potion_of_ultimate_power
0:03.570 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(20), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(4), elemental_potion_of_ultimate_power
0:04.325 main Q mind_blast Fluffy_Pillow 49957.0/49999: 100% mana
13.0/100: 13% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(19), mental_fortitude, coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.080 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
22.0/100: 22% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(18), mental_fortitude, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.835 main U mind_flay Fluffy_Pillow 45010.2/49999: 90% mana
25.0/100: 25% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(17), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.336 main Q mind_blast Fluffy_Pillow 47411.8/49999: 95% mana
47.0/100: 47% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(16), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.092 main V halo Fluffy_Pillow 48621.4/49999: 97% mana
56.0/100: 56% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(15), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.846 main N devouring_plague Fluffy_Pillow 47327.8/49999: 95% mana
59.0/100: 59% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.602 main U mind_flay Fluffy_Pillow 48537.4/49999: 97% mana
12.0/100: 12% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.102 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(12), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.857 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(11), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.612 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.862 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.618 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.373 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
bloodlust, blood_fury, power_infusion, ancient_madness(7), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.874 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
bloodlust, power_infusion, ancient_madness(5), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.122 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
bloodlust, power_infusion, ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.878 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
bloodlust, power_infusion, ancient_madness(2), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.632 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
bloodlust, power_infusion, ancient_madness(2), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_mastery, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.131 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.072 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.012 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity
bloodlust, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.951 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.891 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.830 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.702 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.509 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
65.0/100: 65% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.448 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity
bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:34.388 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
21.0/100: 21% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:35.326 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:37.199 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
0:38.138 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
bloodlust, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:39.079 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
11.0/100: 11% insanity
bloodlust, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:40.951 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:42.172 main Q mind_blast Fluffy_Pillow 45007.0/49999: 90% mana
27.0/100: 27% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
0:43.526 main W mind_spike Fluffy_Pillow 47173.4/49999: 94% mana
34.0/100: 34% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:44.748 main W mind_spike Fluffy_Pillow 49128.6/49999: 98% mana
39.0/100: 39% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:45.970 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:47.190 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
0:50.841 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
0:52.061 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
11.0/100: 11% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:53.281 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
0:55.719 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
0:56.939 main Q mind_blast Fluffy_Pillow 47505.4/49999: 95% mana
40.0/100: 40% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
0:58.158 main X mind_flay Fluffy_Pillow 49455.8/49999: 99% mana
48.0/100: 48% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:01.810 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:03.030 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:04.250 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
ancient_madness(20), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
1:05.471 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
ancient_madness(19), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:06.692 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
ancient_madness(18), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:07.912 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
ancient_madness(17), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:09.130 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
85.0/100: 85% insanity
ancient_madness(16), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:10.350 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
ancient_madness(14), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:11.570 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
ancient_madness(13), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:12.791 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
65.0/100: 65% insanity
ancient_madness(12), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:15.228 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
88.0/100: 88% insanity
ancient_madness(10), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
1:16.449 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
ancient_madness(8), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:18.886 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
ancient_madness(6), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:20.106 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity
ancient_madness(5), surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
1:21.325 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
ancient_madness(3), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
1:22.547 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
ancient_madness(2), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:23.769 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
ancient_madness, surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
1:24.990 main U mind_flay Fluffy_Pillow 45007.0/49999: 90% mana
44.0/100: 44% insanity
surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:27.425 main L shadow_word_death Fluffy_Pillow 48903.0/49999: 98% mana
67.0/100: 67% insanity
surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:28.645 main N devouring_plague Fluffy_Pillow 49605.0/49999: 99% mana
70.0/100: 70% insanity
surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:29.864 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:31.084 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:32.305 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:34.741 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:35.962 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:37.181 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:38.402 main N devouring_plague Fluffy_Pillow 47507.0/49999: 95% mana
76.0/100: 76% insanity
surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:39.623 main U mind_flay Fluffy_Pillow 49460.6/49999: 99% mana
33.0/100: 33% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:42.059 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:43.278 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:44.498 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
25.0/100: 25% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:45.719 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:46.940 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity
mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:49.376 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity
mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
1:50.595 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:51.816 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:53.036 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
1:55.472 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:56.692 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
1:57.912 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:00.350 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), static_empowerment(5)
2:01.571 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:03.032 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
40.0/100: 40% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
2:04.251 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:05.472 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
2:05.472 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
power_infusion, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
2:05.472 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
blood_fury, power_infusion, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
2:05.472 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity
blood_fury, power_infusion, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:06.364 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity
blood_fury, power_infusion, ancient_madness(20), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:07.254 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
blood_fury, power_infusion, ancient_madness(19), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:08.145 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
blood_fury, power_infusion, ancient_madness(18), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:09.036 main Q mind_blast Fluffy_Pillow 45005.4/49999: 90% mana
49.0/100: 49% insanity
blood_fury, power_infusion, ancient_madness(17), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:09.927 main U mind_flay Fluffy_Pillow 46431.0/49999: 93% mana
58.0/100: 58% insanity
blood_fury, power_infusion, ancient_madness(16), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:11.704 main N devouring_plague Fluffy_Pillow 49274.2/49999: 99% mana
80.0/100: 80% insanity
blood_fury, power_infusion, ancient_madness(14), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:12.595 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
blood_fury, power_infusion, ancient_madness(13), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:14.372 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity
blood_fury, power_infusion, ancient_madness(12), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:15.264 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
blood_fury, power_infusion, ancient_madness(11), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:16.154 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity
blood_fury, power_infusion, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:17.046 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
91.0/100: 91% insanity
blood_fury, power_infusion, ancient_madness(9), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:17.939 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
blood_fury, power_infusion, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:19.715 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
blood_fury, power_infusion, ancient_madness(6), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:20.607 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
power_infusion, ancient_madness(5), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:21.497 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity
power_infusion, ancient_madness(4), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:23.273 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
61.0/100: 61% insanity
power_infusion, ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:24.163 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity
power_infusion, ancient_madness(2), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, sophic_devotion, static_empowerment(5)
2:25.056 main Q mind_blast Fluffy_Pillow 47508.6/49999: 95% mana
71.0/100: 71% insanity
power_infusion, ancient_madness, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_haste, static_empowerment(5)
2:25.949 main N devouring_plague Fluffy_Pillow 48937.4/49999: 98% mana
83.0/100: 83% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:27.170 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:29.607 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity
surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:30.828 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:32.049 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:33.270 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:35.706 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
surge_of_darkness(2), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
2:36.927 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
77.0/100: 77% insanity
surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:38.150 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
79.0/100: 79% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:39.372 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:40.593 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:43.032 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:44.252 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity
mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:45.473 main N devouring_plague Fluffy_Pillow 45007.0/49999: 90% mana
77.0/100: 77% insanity
mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
2:46.692 main N devouring_plague Fluffy_Pillow 46957.4/49999: 94% mana
79.0/100: 79% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:47.913 main Q mind_blast Fluffy_Pillow 48911.0/49999: 98% mana
32.0/100: 32% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:49.132 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:50.351 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:52.787 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
2:54.008 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:55.229 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
2:57.666 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
2:58.888 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
14.0/100: 14% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:01.325 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
3:02.545 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:03.767 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:04.987 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity
mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:08.640 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity
surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
3:09.860 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
3:11.082 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
ancient_madness(19), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:12.303 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
ancient_madness(18), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:14.739 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
85.0/100: 85% insanity
ancient_madness(16), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, sophic_devotion, static_empowerment(5)
3:15.960 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity
twist_of_fate, ancient_madness(14), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:17.182 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity
twist_of_fate, ancient_madness(13), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, sophic_devotion, static_empowerment(5)
3:18.404 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
twist_of_fate, ancient_madness(12), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:20.841 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
79.0/100: 79% insanity
twist_of_fate, ancient_madness(10), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, static_empowerment(5)
3:22.058 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity
twist_of_fate, ancient_madness(8), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:23.280 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
twist_of_fate, ancient_madness(7), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:24.499 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
twist_of_fate, ancient_madness(6), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:25.721 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
twist_of_fate, ancient_madness(5), dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:26.941 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity
twist_of_fate, ancient_madness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:28.162 main U mind_flay Fluffy_Pillow 45007.0/49999: 90% mana
21.0/100: 21% insanity
twist_of_fate, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
3:30.597 main Q mind_blast Fluffy_Pillow 48903.0/49999: 98% mana
38.0/100: 38% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:31.819 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:35.471 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
3:36.692 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:39.129 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
3:40.350 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:41.571 main W mind_spike Fluffy_Pillow 47507.0/49999: 95% mana
49.0/100: 49% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:42.791 main N devouring_plague Fluffy_Pillow 49459.0/49999: 99% mana
56.0/100: 56% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:44.012 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:46.449 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, static_empowerment(5)
3:47.670 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:48.890 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:50.111 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
3.0/100: 3% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:52.548 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:53.767 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:54.987 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
3:56.209 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
3:58.645 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity
twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:02.299 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:03.766 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), static_empowerment(5)
4:04.987 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, shadowy_insight, dark_evangelism(5), coalescing_shadows(3), static_empowerment(5)
4:06.208 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, shadowy_insight, dark_evangelism(5), coalescing_shadows(3), static_empowerment(5)
4:07.429 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:08.651 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, static_empowerment(5)
4:09.873 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity
twist_of_fate, death_and_madness_reset, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:11.091 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
twist_of_fate, death_and_madness_reset, ancient_madness(20), dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
4:11.091 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
4:11.091 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, static_empowerment(5)
4:11.091 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:12.071 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:13.046 main U mind_flay Fluffy_Pillow 45002.2/49999: 90% mana
66.0/100: 66% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(19), dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:14.993 main N devouring_plague Fluffy_Pillow 48117.4/49999: 96% mana
88.0/100: 88% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(17), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:15.972 main Q mind_blast Fluffy_Pillow 49683.8/49999: 99% mana
41.0/100: 41% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(16), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:16.949 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(15), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:17.926 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(14), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:19.875 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
86.0/100: 86% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(12), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:20.853 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(11), surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:21.831 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(10), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:22.810 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(9), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:24.759 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
90.0/100: 90% insanity
blood_fury, power_infusion, twist_of_fate, ancient_madness(7), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:25.966 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
99.0/100: 99% insanity
blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(6), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:26.942 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(5), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:27.918 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(4), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:28.895 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(3), surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:29.875 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(2), surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:30.851 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
94.0/100: 94% insanity
power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, spoils_of_neltharus_stat_crit, static_empowerment(5)
4:31.830 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:33.052 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:34.271 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:36.706 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
94.0/100: 94% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, static_empowerment(5)
4:37.927 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:39.148 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)
4:41.585 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, mind_devourer, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, static_empowerment(5)
4:42.805 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
82.0/100: 82% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:44.024 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:45.245 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:46.465 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity
twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:47.687 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:48.907 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:50.127 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:51.346 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:52.567 main U mind_flay Fluffy_Pillow 45007.0/49999: 90% mana
21.0/100: 21% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, sophic_devotion, static_empowerment(5)
4:55.004 main Q mind_blast Fluffy_Pillow 48906.2/49999: 98% mana
39.0/100: 39% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:56.224 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:57.444 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, sophic_devotion, static_empowerment(5)
4:58.666 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity
twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3463 1 10805 10291 6827
Intellect 2089 -1 7607 6945 4527 (177)
Spirit 0 0 0 0 0
Health 216100 205820 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 7607 6945 0
Crit 13.12% 13.12% 1461
Haste 23.32% 23.32% 3965
Versatility 5.33% 2.33% 478
Mana Regen 1600 1600 0
Mastery 8.76% 8.76% 1715
Armor 1524 1524 1524
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Organized Pontificator's Mask
ilevel: 372, stats: { 183 Armor, +315 Int, +687 Sta, +382 Crit, +206 Haste }
Local Neck Ukhel Ancestry Beads
ilevel: 372, stats: { +386 Sta, +248 Haste, +542 Mastery }
Local Shoulders Molten Magma Mantle
ilevel: 372, stats: { 168 Armor, +237 Int, +515 Sta, +173 Crit, +268 Haste }
Local Chest Bronze Challenger's Robe
ilevel: 372, stats: { 244 Armor, +315 Int, +687 Sta, +243 Crit, +344 Mastery }, enchant: { +127 StrAgiInt }
Local Waist Sky Saddle Cord
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +277 Haste, +164 Mastery }
Local Legs Crazed Traveler's Legwraps
ilevel: 372, stats: { 213 Armor, +315 Int, +687 Sta, +369 Haste, +218 Vers }, enchant: { +151 Int, +89 Sta }
Local Feet Ancient Crosswrapped Sandals
ilevel: 372, stats: { 152 Armor, +237 Int, +515 Sta, +164 Crit, +277 Haste }
Local Wrists Animated Shackles
ilevel: 372, stats: { 122 Armor, +177 Int, +386 Sta, +194 Crit, +137 Haste }
Local Hands Azureblade's Work Gloves
ilevel: 372, stats: { 137 Armor, +237 Int, +515 Sta, +268 Haste, +173 Mastery }
Local Finger1 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +82 Haste }
Local Finger2 Circle of Ascended Frost
ilevel: 372, stats: { +386 Sta, +530 Haste, +260 Vers }, enchant: { +82 Haste }
Local Trinket1 Spoils of Neltharus
ilevel: 372, stats: { +300 Int }
item effects: { use: Spoils of Neltharus, equip: Spoils of Neltharus }
Local Trinket2 Furious Ragefeather
ilevel: 372, stats: { +300 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 372, stats: { 168 Armor, +386 Sta, +208 Haste, +123 Mastery, +177 StrAgiInt }
Local Main Hand Final Grade
ilevel: 372, weapon: { 363 - 493, 3.6 }, stats: { +315 Int, +1087 Int, +687 Sta, +218 Haste, +369 Mastery }, enchant: sophic_devotion_2, temporary_enchant: Howling Rune

Profile

priest="PR_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIk04ABAAAAAAAAAAAAQikkSESRLJRSJhEBpRSSiECSQIFpFSCA
class_talents=dispel_magic:1/improved_flash_heal:1/protective_light:1/angelic_feather:1/phantasm:1/death_and_madness:1/leap_of_faith:1/dominate_mind:1/mass_dispel:1/power_infusion:1/vampiric_embrace:1/tithe_evasion:1/improved_mass_dispel:1/body_and_soul:1/twins_of_the_sun_priestess:1/sanlayn:1/twist_of_fate:2/throes_of_pain:2/halo:1/translucent_image:1/mindgames:1/lights_inspiration:2/improved_fade:2/manipulation:2/angelic_bulwark:1/shattered_perceptions:1
spec_talents=devouring_plague:1/dispersion:1/shadowy_apparitions:1/silence:1/mental_fortitude:1/misery:1/coalescing_shadows:1/mind_spike:1/puppet_master:1/mental_decay:1/dark_ascension:1/surge_of_darkness:1/harnessed_shadows:1/shadowy_insight:1/ancient_madness:2/shadow_crash:1/dark_evangelism:2/auspicious_spirits:1/mindbender:1/mind_flay_insanity:1/encroaching_shadows:1/inescapable_torment:2/screams_of_the_void:2/mind_devourer:1/idol_of_yshaarj:1/idol_of_cthun:1

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/use_item,name=shadowed_orb_of_torment
actions.precombat+=/variable,name=mind_sear_cutoff,op=set,value=2
actions.precombat+=/shadow_crash,if=talent.shadow_crash.enabled
actions.precombat+=/mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
actions.precombat+=/vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled

# Executed every time the actor is available.
actions=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
actions+=/variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions+=/variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
actions+=/variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
actions+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
actions+=/variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
actions+=/variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
actions+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
actions+=/variable,name=pool_amount,op=set,value=60
actions+=/run_action_list,name=main

actions.cds=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
actions.cds+=/call_action_list,name=trinkets
actions.cds+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.main=call_action_list,name=cds
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
actions.main+=/mind_blast,if=cooldown.mind_blast.charges>=2&talent.mind_devourer&spell_targets.mind_sear>=3&spell_targets.mind_sear<=7&!buff.mind_devourer.up
actions.main+=/shadow_word_death,if=pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
actions.main+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
actions.main+=/damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
actions.main+=/void_bolt,if=variable.dots_up&insanity<=85
# Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
actions.main+=/mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
# Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
actions.main+=/mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.main+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
actions.main+=/shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
actions.main+=/vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
actions.main+=/shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
actions.main+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
actions.main+=/mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
actions.main+=/shadow_crash,if=raid_event.adds.in>10
actions.main+=/dark_void,if=raid_event.adds.in>20
actions.main+=/devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
actions.main+=/void_torrent,if=insanity<=35,target_if=variable.dots_up
actions.main+=/mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
actions.main+=/vampiric_touch,if=buff.unfurling_darkness.up
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
# Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
actions.main+=/halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
# Use when it will hit at least 2 targets.
actions.main+=/divine_star,if=spell_targets.divine_star>1
actions.main+=/lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75
actions.main+=/mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
actions.main+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
actions.main+=/shadow_crash,if=raid_event.adds.in>30
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.main+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.main+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.main+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.main+=/shadow_word_pain

actions.trinkets=use_item,name=scars_of_fraternal_strife,if=(!buff.scars_of_fraternal_strife_4.up&time>1)|(buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10)
actions.trinkets+=/use_item,name=macabre_sheet_music,if=cooldown.void_eruption.remains>10|cooldown.dark_ascension.remains>10
actions.trinkets+=/use_item,name=soulletting_ruby,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10,target_if=min:target.health.pct
# Use this on CD for max CDR
actions.trinkets+=/use_item,name=architects_ingenuity_core
# Default fallback for usable items: Use on cooldown in order by trinket slot.
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10

head=organized_pontificators_mask,id=193703,ilevel=372
neck=ukhel_ancestry_beads,id=193676,ilevel=372
shoulders=molten_magma_mantle,id=193788,ilevel=372
back=fireproof_drape,id=193763,ilevel=372
chest=bronze_challengers_robe,id=193720,ilevel=372,enchant=waking_stats_2
wrists=animated_shackles,id=193792,ilevel=372
hands=azureblades_work_gloves,id=193648,ilevel=372
waist=sky_saddle_cord,id=193691,ilevel=372
legs=crazed_travelers_legwraps,id=193799,ilevel=372,enchant=frozen_spellthread_2
feet=ancient_crosswrapped_sandals,id=193806,ilevel=372
finger1=unstable_arcane_loop,id=193633,ilevel=372,enchant_id=6556
finger2=circle_of_ascended_frost,id=193731,ilevel=372,enchant_id=6556
trinket1=spoils_of_neltharus,id=193773,ilevel=372
trinket2=furious_ragefeather,id=193677,ilevel=372
main_hand=final_grade,id=193707,ilevel=372,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_stamina=6827
# gear_intellect=4527
# gear_crit_rating=1461
# gear_haste_rating=3965
# gear_mastery_rating=1715
# gear_versatility_rating=478
# gear_armor=1524

PR_Shaman_Enhancement : 47164 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
47163.8 47163.8 42.7 / 0.091% 7340.4 / 15.6% 61.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
733.1 731.1 Mana 0.64% 52.5 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement 47164
Elemental Blast 8119 17.2% 22.1 13.50sec 110114 95167 Direct 22.1 90894 182455 110154 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.10 22.09 0.00 0.00 0.00 1.1571 0.0000 2433227.85 2433227.85 0.00% 95166.92 95166.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.96% 17.44 7 27 90894.26 46980 200949 90932.59 76209 109422 1585407 1585407 0.00%
crit 21.04% 4.65 0 13 182454.75 93961 433554 181224.79 0 286710 847821 847821 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [N]:22.10
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 4864 10.3% 82.4 3.64sec 17706 137859 Direct 82.4 6338 12737 7450 17.4% 0.0%
Periodic 192.2 3736 7513 4394 17.4% 0.0% 99.4%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 82.35 82.35 192.21 192.21 81.35 0.1284 1.5508 1458134.26 1458134.26 0.00% 4724.14 137858.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 68.04 39 104 6338.09 3614 14502 6337.60 5452 7582 431258 431258 0.00%
crit 17.38% 14.31 2 30 12737.19 7228 28529 12737.41 10163 16517 182304 182304 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.59% 158.75 114 201 3736.47 1784 8470 3736.23 3317 4244 593159 593159 0.00%
crit 17.41% 33.46 10 58 7512.82 3640 16718 7513.17 6500 8832 251413 251413 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [V]:8.80
Flametongue Weapon 0 (947) 0.0% (2.0%) 1.0 0.00sec 284041 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 947 2.0% 661.3 0.73sec 430 0 Direct 661.3 365 734 430 17.4% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 661.31 661.31 0.00 0.00 0.00 0.0000 0.0000 284041.14 284041.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 546.32 386 714 365.41 303 639 365.42 338 402 199632 199632 0.00%
crit 17.39% 114.99 62 176 734.05 605 1262 734.19 674 811 84410 84410 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1087 2.3% 28.3 7.68sec 11542 0 Direct 28.3 9807 19715 11542 17.5% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.27 28.27 0.00 0.00 0.00 0.0000 0.0000 326349.00 326349.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.49% 23.32 3 68 9806.64 9732 10030 9806.10 9732 10030 228720 228720 0.00%
crit 17.51% 4.95 0 19 19715.04 19463 20059 19294.28 0 20059 97629 97629 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 5548 11.8% 43.2 6.92sec 38532 33243 Direct 43.2 32795 65590 38532 17.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.15 43.15 0.00 0.00 0.00 1.1591 0.0000 1662676.16 1662676.16 0.00% 33242.89 33242.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 35.60 19 52 32795.40 7897 115152 32858.89 25714 42489 1167635 1167635 0.00%
crit 17.49% 7.55 0 18 65590.12 15795 218507 65703.95 0 158572 495041 495041 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [M]:38.70
  • if_expr:buff.hailstorm.up
    single
    [T]:4.45
Ice Strike 1993 4.2% 24.7 12.26sec 24195 20811 Direct 24.7 20562 41353 24195 17.5% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.68 24.68 0.00 0.00 0.00 1.1626 0.0000 597240.39 597240.39 0.00% 20811.22 20811.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.52% 20.37 8 29 20561.55 15697 47297 20566.21 17867 24832 418846 418846 0.00%
crit 17.48% 4.31 0 14 41352.79 31393 89787 40965.57 0 71759 178395 178395 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:24.68
  • if_expr:talent.hailstorm.enabled
Lava Lash 9559 20.3% 66.6 4.43sec 43003 36925 Direct 66.6 (66.6) 36554 73466 43002 17.5% (17.5%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.63 66.63 0.00 0.00 0.00 1.1646 0.0000 2865076.73 2865076.73 0.00% 36925.37 36925.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.53% 54.99 28 89 36553.83 18515 124963 36574.37 31541 43164 2010011 2010011 0.00%
crit 17.47% 11.64 1 26 73466.44 37029 222807 73536.20 54485 103622 855066 855066 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [I]:51.14
  • if_expr:buff.hot_hand.up|buff.ashen_catalyst.stack=8
    single
    [Q]:15.48
Lightning Bolt 3924 8.3% 18.5 16.36sec 63407 53243 Direct 18.5 52189 104907 63405 21.3% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.54 18.54 0.00 0.00 0.00 1.1909 0.0000 1175765.90 1175765.90 0.00% 53243.03 53243.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.72% 14.60 5 25 52188.60 29713 135368 52304.86 40257 66709 761827 761827 0.00%
crit 21.28% 3.95 0 13 104906.96 59426 256673 103586.26 0 230318 413939 413939 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [K]:7.00
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [O]:1.64
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [R]:9.90
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1703 3.6% 193.1 1.81sec 2644 1483 Direct 193.1 2612 5250 2644 17.4% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.12 193.12 0.00 0.00 0.00 1.7821 0.0000 510568.27 729401.83 30.00% 1483.48 1483.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.25% 127.94 84 180 2611.61 2204 4389 2611.76 2402 2849 334128 477338 30.00%
crit 17.40% 33.61 14 60 5250.26 4408 8778 5250.02 4630 6228 176440 252064 30.00%
miss 16.35% 31.58 11 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 853 1.8% 193.2 1.80sec 1323 743 Direct 193.2 1308 2629 1323 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 193.20 193.20 0.00 0.00 0.00 1.7818 0.0000 255602.62 365155.91 30.00% 742.51 742.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.29% 128.07 81 180 1307.75 1102 2195 1307.80 1202 1449 167481 239264 30.00%
crit 17.35% 33.52 14 60 2628.67 2204 4389 2628.48 2357 3056 88122 125891 30.00%
miss 16.36% 31.60 11 56 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 164 (2986) 0.3% (6.3%) 7.0 45.72sec 127207 106789 Direct 7.0 (14.0) 5984 11989 7004 17.0% (19.1%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 0.00 1.1913 0.0000 49212.29 49212.29 0.00% 106789.04 106789.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.02% 5.83 2 8 5983.94 4707 9434 5988.21 4707 8070 34911 34911 0.00%
crit 16.98% 1.19 0 6 11989.28 9413 18674 8722.21 0 18674 14301 14301 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:7.03
  • if_expr:buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
    Lightning Bolt (_pw) 2821 6.0% 7.0 45.90sec 120778 0 Direct 7.0 99551 199772 120777 21.2% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 0.00 0.0000 0.0000 844932.34 844932.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.82% 5.51 0 8 99550.72 69330 203052 99667.59 0 141553 548923 548923 0.00%
crit 21.18% 1.48 0 7 199771.70 138661 395522 161119.84 0 371132 296009 296009 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (1838) 0.0% (3.9%) 46.4 6.37sec 11887 10152

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.36 0.00 0.00 0.00 0.00 1.1709 0.0000 0.00 0.00 0.00% 10152.42 10152.42

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [P]:46.37
    Stormstrike (_mh) 1226 2.6% 46.4 6.37sec 7925 0 Direct 46.4 6740 13554 7925 17.4% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.36 46.36 0.00 0.00 0.00 0.0000 0.0000 367458.28 524953.79 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.61% 38.30 18 60 6740.42 5715 11523 6739.72 6119 7849 258175 368831 30.00%
crit 17.39% 8.06 0 21 13554.30 11430 22755 13542.49 0 17904 109283 156122 29.99%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 613 1.3% 46.4 6.37sec 3962 0 Direct 46.4 3370 6778 3962 17.4% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.36 46.36 0.00 0.00 0.00 0.0000 0.0000 183696.22 262429.87 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 38.31 19 63 3370.17 2858 5762 3369.68 3068 3766 129123 184467 30.00%
crit 17.37% 8.05 0 18 6777.87 5715 11523 6775.06 0 9034 54573 77963 29.99%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 807 1.7% 5.7 54.09sec 42569 36541 Direct 5.7 36064 72803 42569 17.7% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.68 0.00 0.00 0.00 1.1650 0.0000 241898.55 241898.55 0.00% 36540.57 36540.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.30% 4.68 1 8 36064.48 27905 75235 36064.53 27905 55501 168657 168657 0.00%
crit 17.70% 1.01 0 5 72802.93 55810 163175 48040.82 0 148796 73242 73242 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [S]:5.68
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (732) 0.0% (1.6%) 1.0 0.00sec 219602 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 732 1.6% 148.4 4.16sec 1479 0 Direct 148.4 1259 2531 1479 17.3% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.45 148.45 0.00 0.00 0.00 0.0000 0.0000 219601.68 313724.68 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 122.71 67 196 1258.76 1063 2143 1258.80 1143 1398 154469 220676 30.00%
crit 17.34% 25.74 7 51 2530.88 2125 4285 2530.98 2185 2928 65133 93049 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
pet - greater_earth_elemental 427 / 89
melee 427 0.2% 39.9 2.24sec 662 434 Direct 39.9 564 1128 662 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.87 39.87 0.00 0.00 0.00 1.5253 0.0000 26383.30 37691.38 30.00% 433.82 433.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 32.96 9 65 563.92 490 982 562.89 490 733 18586 26553 30.00%
crit 17.33% 6.91 0 21 1128.12 980 1801 1125.20 0 1488 7797 11139 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 2416 / 706
melee 2416 1.5% 89.3 3.41sec 2366 2104 Direct 89.3 2014 4022 2366 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.33 89.33 0.00 0.00 0.00 1.1248 0.0000 211375.78 301973.11 30.00% 2103.60 2103.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.46% 73.67 8 193 2013.81 1660 3306 2011.68 1679 2559 148348 211931 30.00%
crit 17.54% 15.67 0 43 4022.47 3321 6526 4015.41 0 5352 63028 90042 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 2401 / 703
melee 2401 1.5% 89.4 3.41sec 2353 2091 Direct 89.4 2003 4001 2353 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.40 89.40 0.00 0.00 0.00 1.1255 0.0000 210389.73 300564.43 30.00% 2090.91 2090.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.46% 73.73 8 174 2002.82 1660 3306 2001.05 1660 2571 147658 210945 30.00%
crit 17.54% 15.68 0 44 4001.09 3321 6526 3995.85 0 5317 62732 89620 29.98%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 2418 / 707
melee 2418 1.5% 89.6 3.42sec 2362 2100 Direct 89.6 2011 4017 2362 17.5% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.63 89.63 0.00 0.00 0.00 1.1249 0.0000 211702.02 302439.17 30.00% 2099.59 2099.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.52% 73.96 7 180 2011.12 1660 3306 2008.54 1660 2704 148748 212503 30.00%
crit 17.48% 15.67 1 47 4016.90 3321 6611 4012.20 3321 5369 62954 89937 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 310.83sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.12 0.00 0.00 0.00 0.00 1.0254 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [U]:1.12
Feral Spirit 10.7 30.04sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.74 0.00 0.00 0.00 0.00 1.1814 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:10.74
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 302.66sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.47
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 66.2 126.0 4.5sec 1.6sec 3.7sec 81.79% 98.16% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 15.3s
  • trigger_min/max:1.0s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.4s

Stack Uptimes

  • ashen_catalyst_1:30.87%
  • ashen_catalyst_2:16.21%
  • ashen_catalyst_3:11.74%
  • ashen_catalyst_4:9.73%
  • ashen_catalyst_5:6.55%
  • ashen_catalyst_6:3.80%
  • ashen_catalyst_7:2.23%
  • ashen_catalyst_8:0.66%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.0 0.0 48.3sec 48.3sec 14.7sec 29.26% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 276.2s
  • trigger_min/max:14.0s / 276.2s
  • trigger_pct:85.10%
  • duration_min/max:0.0s / 29.3s

Stack Uptimes

  • crackling_surge_1:23.45%
  • crackling_surge_2:5.81%
  • crackling_surge_3:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.5sec 12.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.3s
  • trigger_min/max:0.0s / 164.9s
  • trigger_pct:100.00%
  • duration_min/max:16.1s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.33%
  • crumbling_power_2:0.35%
  • crumbling_power_3:0.58%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.67%
  • crumbling_power_7:0.66%
  • crumbling_power_8:0.66%
  • crumbling_power_9:0.65%
  • crumbling_power_10:0.63%
  • crumbling_power_11:0.63%
  • crumbling_power_12:0.63%
  • crumbling_power_13:0.63%
  • crumbling_power_14:0.64%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.73%
  • crumbling_power_17:0.79%
  • crumbling_power_18:0.82%
  • crumbling_power_19:1.00%
  • crumbling_power_20:0.01%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 6.3 1.0 43.9sec 37.0sec 10.8sec 22.85% 0.00% 1.0 (1.0) 6.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 268.6s
  • trigger_min/max:1.6s / 268.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.1s

Stack Uptimes

  • elemental_blast_critical_strike_1:22.85%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 6.2 1.1 44.7sec 37.2sec 10.9sec 22.63% 0.00% 1.1 (1.1) 6.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 272.0s
  • trigger_min/max:1.6s / 272.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.9s

Stack Uptimes

  • elemental_blast_haste_1:22.63%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 6.4 1.1 44.2sec 37.1sec 10.8sec 22.89% 0.00% 1.1 (1.1) 6.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 273.7s
  • trigger_min/max:1.6s / 273.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.2s

Stack Uptimes

  • elemental_blast_mastery_1:22.89%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 123.4sec 99.1sec 57.8sec 24.80% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:24.80%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 121.4sec 98.3sec 58.2sec 25.23% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 337.7s

Stack Uptimes

  • elemental_chaos_earth_1:25.23%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 125.3sec 99.9sec 58.2sec 24.84% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.9s

Stack Uptimes

  • elemental_chaos_fire_1:24.84%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 126.0sec 99.4sec 58.3sec 25.13% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.13%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.8sec 302.8sec 27.5sec 13.19% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.0s
  • trigger_min/max:300.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.19%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 0.0 29.2sec 30.0sec 14.7sec 52.56% 0.00% 42.0 (42.0) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 48.1s
  • trigger_min/max:16.2s / 46.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.9s

Stack Uptimes

  • feral_spirit_1:52.56%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 50.0 226.3 6.0sec 1.1sec 4.7sec 78.54% 87.72% 226.3 (487.7) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 61.9s
  • trigger_min/max:0.0s / 17.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 61.2s

Stack Uptimes

  • flurry_1:22.00%
  • flurry_2:33.61%
  • flurry_3:22.93%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.4sec 46.3sec 13.0sec 19.41% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 218.6s
  • trigger_min/max:0.2s / 207.2s
  • trigger_pct:98.89%
  • duration_min/max:0.0s / 48.0s

Stack Uptimes

  • forgestorm_ignited_1:19.41%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 39.0 1.6 7.7sec 7.4sec 2.4sec 30.88% 89.79% 1.6 (10.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 30.9s
  • trigger_min/max:1.1s / 30.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.8s

Stack Uptimes

  • hailstorm_5:9.78%
  • hailstorm_6:6.06%
  • hailstorm_7:3.68%
  • hailstorm_8:2.24%
  • hailstorm_9:1.39%
  • hailstorm_10:7.72%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 10.6 5.6 27.6sec 17.6sec 9.9sec 35.14% 89.16% 5.6 (5.6) 10.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 244.2s
  • trigger_min/max:0.0s / 242.2s
  • trigger_pct:5.02%
  • duration_min/max:0.0s / 49.7s

Stack Uptimes

  • hot_hand_1:35.14%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 24.7 0.0 12.3sec 12.3sec 3.6sec 29.81% 56.16% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.7s / 25.4s
  • trigger_min/max:7.7s / 24.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.2s

Stack Uptimes

  • ice_strike_1:29.81%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 6.0 0.0 48.3sec 48.3sec 14.7sec 29.19% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.4s / 301.3s
  • trigger_min/max:12.4s / 301.3s
  • trigger_pct:85.14%
  • duration_min/max:0.0s / 29.9s

Stack Uptimes

  • icy_edge_1:23.40%
  • icy_edge_2:5.79%
  • icy_edge_3:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 41.5 224.2 7.3sec 2.3sec 6.2sec 85.89% 100.00% 17.2 (35.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 30.7s
  • trigger_min/max:0.0s / 15.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.6s

Stack Uptimes

  • maelstrom_weapon_1:12.21%
  • maelstrom_weapon_2:13.63%
  • maelstrom_weapon_3:14.09%
  • maelstrom_weapon_4:14.27%
  • maelstrom_weapon_5:9.89%
  • maelstrom_weapon_6:6.63%
  • maelstrom_weapon_7:4.37%
  • maelstrom_weapon_8:2.78%
  • maelstrom_weapon_9:1.76%
  • maelstrom_weapon_10:6.27%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 6.0 0.0 48.4sec 48.4sec 14.7sec 29.21% 100.00% 0.0 (0.0) 5.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 298.1s
  • trigger_min/max:14.0s / 298.1s
  • trigger_pct:84.90%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • molten_weapon_1:23.34%
  • molten_weapon_2:5.87%
  • molten_weapon_3:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Primordial Wave 7.0 0.0 45.7sec 45.7sec 2.0sec 4.61% 38.12% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 51.5s
  • trigger_min/max:45.0s / 51.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.7s

Stack Uptimes

  • primordial_wave_1:4.61%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.2 61.0sec 45.4sec 16.5sec 23.58% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 260.9s
  • trigger_min/max:0.0s / 219.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 99.9s

Stack Uptimes

  • sophic_devotion_1:23.58%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.2 61.5sec 45.7sec 16.6sec 23.60% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 208.5s
  • trigger_min/max:0.0s / 208.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.1s

Stack Uptimes

  • sophic_devotion_oh_1:23.60%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.9sec 45.5sec 32.1sec 38.27% 0.00% 25.7 (25.7) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 282.1s
  • trigger_min/max:0.0s / 218.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 201.0s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.25%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.77%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Splintered Elements 7.0 0.0 45.9sec 45.9sec 11.8sec 27.58% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:38.7s / 52.6s
  • trigger_min/max:38.7s / 52.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • splintered_elements_1:27.58%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 28.4 9.5 10.4sec 7.7sec 3.5sec 33.02% 59.39% 9.5 (9.5) 0.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 99.2s
  • trigger_min/max:0.0s / 99.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.1s

Stack Uptimes

  • stormbringer_1:33.02%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 26.7 11.0 51.0 11.0s 1.1s 117.5s
windfury_totem_extra_attack_oh 26.7 10.0 50.0 10.9s 1.1s 132.7s
Maelstrom Weapon: Feral Spirit 63.0 47.0 79.0 4.8s 0.0s 31.8s
Maelstrom Weapon: Swirling Maelstrom 63.4 46.0 83.0 4.7s 0.8s 22.9s
Maelstrom Weapon: Primordial Wave 70.3 60.0 80.0 45.7s 45.0s 51.5s
Flametongue: Windfury Attack 148.4 84.0 232.0 4.2s 0.0s 58.5s
Stormbringer: Windfury Attack 16.6 3.0 40.0 18.3s 0.0s 212.9s
Maelstrom Weapon: Windfury Attack 29.7 7.0 55.0 11.1s 0.0s 142.8s
Flametongue: main_hand 161.5 113.0 214.0 2.2s 1.1s 16.9s
Hot Hand: main_hand 8.1 0.0 20.0 33.0s 1.1s 305.4s
Maelstrom Weapon: main_hand 32.4 12.0 66.0 9.4s 1.1s 117.7s
Windfury: main_hand 50.3 20.0 82.0 6.2s 1.1s 87.7s
Flametongue: offhand 161.6 110.0 220.0 2.2s 1.1s 17.5s
Hot Hand: offhand 8.1 0.0 21.0 33.0s 1.1s 285.0s
Maelstrom Weapon: offhand 32.2 12.0 59.0 9.4s 1.1s 109.1s
Flametongue: Sundering 5.7 2.0 8.0 54.1s 40.0s 176.6s
Stormbringer: Sundering 0.6 0.0 4.0 113.2s 40.0s 342.3s
Maelstrom Weapon: Sundering 1.2 0.0 5.0 105.1s 40.0s 328.2s
Windfury: Sundering 1.8 0.0 6.0 97.6s 40.0s 340.9s
Flametongue: Lava Lash 66.6 36.0 104.0 4.4s 0.8s 15.5s
Stormbringer: Lava Lash 7.4 0.0 22.0 34.8s 0.8s 308.7s
Maelstrom Weapon: Lava Lash 13.3 2.0 31.0 20.9s 0.8s 283.6s
Flametongue: Ice Strike 24.7 19.0 30.0 12.3s 7.7s 24.3s
Stormbringer: Ice Strike 2.8 0.0 11.0 69.8s 7.7s 325.4s
Maelstrom Weapon: Ice Strike 5.0 0.0 13.0 50.1s 7.7s 337.1s
Windfury: Ice Strike 7.7 1.0 17.0 35.9s 7.7s 270.1s
Flametongue: Stormstrike 46.4 26.0 69.0 6.4s 0.8s 43.2s
Stormbringer: Stormstrike 5.2 0.0 15.0 44.8s 0.8s 309.1s
Maelstrom Weapon: Stormstrike 9.3 0.0 21.0 29.2s 0.8s 246.6s
Windfury: Stormstrike 14.4 3.0 30.0 19.6s 0.8s 216.0s
Flametongue: Stormstrike Off-Hand 46.4 26.0 69.0 6.4s 0.8s 43.2s
Stormbringer: Stormstrike Off-Hand 5.2 0.0 17.0 44.6s 0.8s 323.3s
Maelstrom Weapon: Stormstrike Off-Hand 9.3 1.0 21.0 29.2s 0.8s 297.7s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 23.13% 13.26% 30.56% 0.5s 0.0s 3.8s
Hot Hand 35.14% 7.36% 64.01% 9.9s 0.0s 49.7s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.8560.0011.4897.6331.80313.505
Sundering14.6070.001136.57065.9114.739190.969
Primordial Wave0.8930.0016.5194.3360.00013.670
Lava Lash0.9830.00111.86163.49728.517105.207
Flame Shock23.3690.001224.261179.6510.000309.270
Ice Strike0.6990.00111.61314.3761.40543.792
Frost Shock2.4240.00124.02195.80552.025145.126
Elemental Blast4.3470.00136.97836.4104.89989.132
Stormstrike2.4140.00132.867104.50649.858176.232
Earth Elemental11.2610.01545.1271.2730.00045.127

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement
mana_regenMana623.67219322.87100.00%351.67260055.9254.25%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 731.08 733.06 260056.5 49405.2 47000.0 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 22.1030383.451375.001374.9880.08
Flame ShockMana 8.806601.22750.0080.16220.89
Frost ShockMana 43.1521575.46500.00500.0077.06
Ice StrikeMana 24.6840729.111650.001650.0114.66
Lava LashMana 66.6326650.31400.00400.00107.51
Lightning BoltMana 18.549271.56500.00500.00126.81
Primordial WaveMana 7.0310543.591500.001500.0084.80
StormstrikeMana 46.3646364.751000.001000.0011.89
SunderingMana 5.6817048.133000.003000.1214.19

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement Damage Per Second
Count 7499
Mean 47163.78
Minimum 40906.38
Maximum 55595.26
Spread ( max - min ) 14688.88
Range [ ( max - min ) / 2 * 100% ] 15.57%
Standard Deviation 1886.2022
5th Percentile 44218.75
95th Percentile 50396.52
( 95th Percentile - 5th Percentile ) 6177.77
Mean Distribution
Standard Deviation 21.7814
95.00% Confidence Interval ( 47121.09 - 47206.47 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6145
0.1 Scale Factor Error with Delta=300 30372
0.05 Scale Factor Error with Delta=300 121485
0.01 Scale Factor Error with Delta=300 3037108
Priority Target DPS
PR_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 47163.78
Minimum 40906.38
Maximum 55595.26
Spread ( max - min ) 14688.88
Range [ ( max - min ) / 2 * 100% ] 15.57%
Standard Deviation 1886.2022
5th Percentile 44218.75
95th Percentile 50396.52
( 95th Percentile - 5th Percentile ) 6177.77
Mean Distribution
Standard Deviation 21.7814
95.00% Confidence Interval ( 47121.09 - 47206.47 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6145
0.1 Scale Factor Error with Delta=300 30372
0.05 Scale Factor Error with Delta=300 121485
0.01 Scale Factor Error with Delta=300 3037108
DPS(e)
PR_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 47163.78
Minimum 40906.38
Maximum 55595.26
Spread ( max - min ) 14688.88
Range [ ( max - min ) / 2 * 100% ] 15.57%
Damage
PR_Shaman_Enhancement Damage
Count 7499
Mean 13475481.67
Minimum 9779835.19
Maximum 17611067.67
Spread ( max - min ) 7831232.48
Range [ ( max - min ) / 2 * 100% ] 29.06%
DTPS
PR_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.47 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 10.74 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
G 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
H 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 windstrike
I 51.14 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
0.00 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
0.00 ice_strike,if=buff.doom_winds_talent.up
0.00 sundering,if=buff.doom_winds_talent.up
J 7.03 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking
K 7.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
L 24.68 ice_strike,if=talent.hailstorm.enabled
M 38.70 frost_shock,if=buff.hailstorm.up
0.00 lava_lash,if=dot.flame_shock.refreshable
0.00 stormstrike,if=talent.stormflurry.enabled&buff.stormbringer.up
N 22.10 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
O 1.64 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
P 46.37 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
Q 15.48 lava_lash
0.00 bag_of_tricks
R 9.90 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
S 5.68 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
T 4.45 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
U 1.12 earth_elemental
V 8.80 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ACDEFBJKLMPNPMQNPMLRQMPSRMFPLQNMPUVQRMLPVNMQPRMVLPQPTVIJFIKILMNPQMNIPILIMIPIOIMILFINIMINIMLPJKMQPSTVLPQFNMPVQTLNPMVQPTRLVMPQINIMIJFKLMNPPMINPILIMIPRMQSPLPPNMQVFPTLDENQMJKIMIPILIPRMPQNMFLINIMIPIINILIMPPQRMSPLJFKMPIVINILIMINPMPQRLMPVQTPPTLFNIMINIJIKLMPRQMSPVTLQFNMPN

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 2 augmentation PR_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_air
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), elemental_chaos_air
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), crumbling_power(20), elemental_chaos_air
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry(2), crumbling_power(20), elemental_chaos_air
0:00.867 default B potion Fluffy_Pillow 40637.2/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, molten_weapon(2), maelstrom_weapon(2), crumbling_power(19), elemental_chaos_air
0:00.867 single J primordial_wave Fluffy_Pillow 40637.2/50000: 81% mana bloodlust, berserking, flurry(2), feral_spirit, molten_weapon(2), maelstrom_weapon(2), crumbling_power(19), elemental_chaos_air, elemental_potion_of_ultimate_power
0:01.734 single K lightning_bolt Fluffy_Pillow 40524.4/50000: 81% mana bloodlust, berserking, flurry(2), primordial_wave, feral_spirit, molten_weapon(2), maelstrom_weapon(10), crumbling_power(19), elemental_chaos_air, elemental_potion_of_ultimate_power
0:02.600 single L ice_strike Fluffy_Pillow 41410.0/50000: 83% mana bloodlust, berserking, flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, hailstorm(10), crumbling_power(18), elemental_chaos_air, elemental_potion_of_ultimate_power
0:03.389 single M frost_shock Fluffy_Pillow 41022.4/50000: 82% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(2), hailstorm(10), ice_strike, crumbling_power(17), elemental_chaos_air, elemental_potion_of_ultimate_power
0:04.177 single P stormstrike Fluffy_Pillow 41783.2/50000: 84% mana bloodlust, berserking, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(4), crumbling_power(16), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:04.966 single N elemental_blast Fluffy_Pillow 42045.6/50000: 84% mana bloodlust, berserking, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(6), crumbling_power(15), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:05.755 single P stormstrike Fluffy_Pillow 41933.0/50000: 84% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), stormbringer, maelstrom_weapon, hailstorm(6), crumbling_power(14), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:06.520 single M frost_shock Fluffy_Pillow 42157.0/50000: 84% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(2), hailstorm(6), crumbling_power(13), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:07.285 single Q lava_lash Fluffy_Pillow 42881.0/50000: 86% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon(4), crumbling_power(12), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:08.050 single N elemental_blast Fluffy_Pillow 43705.0/50000: 87% mana bloodlust, berserking, flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(6), crumbling_power(11), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:08.816 single P stormstrike Fluffy_Pillow 43555.6/50000: 87% mana bloodlust, berserking, flurry(3), elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(2), hailstorm(6), crumbling_power(10), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:09.583 single M frost_shock Fluffy_Pillow 43782.8/50000: 88% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(4), hailstorm(6), crumbling_power(9), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:10.347 single L ice_strike Fluffy_Pillow 44505.2/50000: 89% mana bloodlust, berserking, elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(5), crumbling_power(8), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:11.113 single R lightning_bolt Fluffy_Pillow 44080.8/50000: 88% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(4), maelstrom_weapon(6), ice_strike, crumbling_power(7), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:11.880 single Q lava_lash Fluffy_Pillow 44808.0/50000: 90% mana bloodlust, berserking, elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(5), maelstrom_weapon, hailstorm(6), ice_strike, crumbling_power(6), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:12.646 single M frost_shock Fluffy_Pillow 45633.6/50000: 91% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(3), hailstorm(6), ice_strike, crumbling_power(5), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:13.531 single P stormstrike Fluffy_Pillow 46549.6/50000: 93% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(4), crumbling_power(4), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:14.372 single S sundering Fluffy_Pillow 46895.2/50000: 94% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(4), crumbling_power(3), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:15.300 single R lightning_bolt Fluffy_Pillow 45380.0/50000: 91% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(5), crumbling_power(2), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:16.251 single M frost_shock Fluffy_Pillow 46401.6/50000: 93% mana bloodlust, flurry, elemental_blast_critical_strike, ashen_catalyst(4), hailstorm(5), crumbling_power, sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:17.258 default F feral_spirit Fluffy_Pillow 47512.8/50000: 95% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(5), maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:18.210 single P stormstrike Fluffy_Pillow 49036.0/50000: 98% mana bloodlust, flurry, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_air, elemental_potion_of_ultimate_power
0:19.163 single L ice_strike Fluffy_Pillow 49560.8/50000: 99% mana bloodlust, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), maelstrom_weapon(3), elemental_chaos_air, elemental_potion_of_ultimate_power
0:20.115 single Q lava_lash Fluffy_Pillow 49434.0/50000: 99% mana bloodlust, flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(7), maelstrom_weapon(4), ice_strike, elemental_chaos_air, elemental_potion_of_ultimate_power
0:21.067 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(7), ice_strike, elemental_chaos_air, elemental_potion_of_ultimate_power
0:22.019 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hailstorm(7), ice_strike, elemental_chaos_air, elemental_potion_of_ultimate_power
0:22.970 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), maelstrom_weapon, elemental_chaos_air, elemental_potion_of_ultimate_power
0:23.924 single U earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), elemental_chaos_air, elemental_potion_of_ultimate_power
0:24.877 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(3), elemental_chaos_air, elemental_potion_of_ultimate_power
0:25.830 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), elemental_chaos_air, elemental_potion_of_ultimate_power
0:26.784 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, maelstrom_weapon(5), elemental_chaos_air, elemental_potion_of_ultimate_power
0:27.736 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hailstorm(5), elemental_chaos_air, elemental_potion_of_ultimate_power
0:28.690 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon, elemental_chaos_air, elemental_potion_of_ultimate_power
0:29.642 single P stormstrike Fluffy_Pillow 49873.2/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(3), maelstrom_weapon(3), ice_strike, elemental_chaos_air, elemental_potion_of_ultimate_power
0:30.596 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(4), maelstrom_weapon(4), ice_strike, elemental_chaos_air, elemental_potion_of_ultimate_power
0:31.548 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(5), maelstrom_weapon(5), ice_strike, elemental_chaos_air
0:32.501 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(6), maelstrom_weapon, hailstorm(5), ice_strike, elemental_chaos_air
0:33.427 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, ashen_catalyst(6), maelstrom_weapon(3), elemental_chaos_air
0:34.354 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon(5), elemental_chaos_air
0:35.280 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(5), elemental_chaos_air
0:36.205 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, ashen_catalyst(3), hailstorm(5), elemental_chaos_air
0:37.129 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_air
0:38.055 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, ashen_catalyst(4), maelstrom_weapon(2), elemental_chaos_air
0:38.980 single P stormstrike Fluffy_Pillow 49830.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, ashen_catalyst(5), stormbringer, maelstrom_weapon(3), ice_strike, elemental_chaos_air
0:39.906 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, ashen_catalyst(6), maelstrom_weapon(3), ice_strike, elemental_chaos_air
0:40.832 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, stormbringer, maelstrom_weapon(3), ice_strike, elemental_chaos_air
0:42.034 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(3), ice_strike, elemental_chaos_air
0:43.270 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(3), elemental_chaos_air
0:44.508 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), hot_hand, maelstrom_weapon(3), elemental_chaos_air
0:45.745 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), hot_hand, maelstrom_weapon(3), elemental_chaos_air
0:47.105 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(10), elemental_chaos_air
0:48.341 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), sophic_devotion, elemental_chaos_air
0:49.579 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), primordial_wave, feral_spirit, molten_weapon(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), sophic_devotion, elemental_chaos_air
0:50.815 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), sophic_devotion, elemental_chaos_air
0:51.941 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), stormbringer, maelstrom_weapon, hailstorm(10), sophic_devotion, elemental_chaos_air
0:53.067 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, forgestorm_ignited, sophic_devotion, elemental_chaos_air
0:54.192 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(6), forgestorm_ignited, sophic_devotion, elemental_chaos_air
0:55.318 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(2), hailstorm(6), forgestorm_ignited, sophic_devotion, elemental_chaos_air
0:56.443 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), maelstrom_weapon(4), hailstorm(6), forgestorm_ignited, sophic_devotion, elemental_chaos_air
0:57.568 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst, maelstrom_weapon(4), hailstorm(6), forgestorm_ignited, sophic_devotion, elemental_chaos_air
0:58.693 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(2), maelstrom_weapon(5), forgestorm_ignited, sophic_devotion, elemental_chaos_air
0:59.819 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(3), hailstorm(5), forgestorm_ignited, sophic_devotion, elemental_chaos_air
1:00.945 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon(2), hot_hand, maelstrom_weapon(3), hailstorm(5), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:02.114 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, molten_weapon(2), ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(5), forgestorm_ignited, sophic_devotion, elemental_chaos_fire
1:03.393 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(5), hailstorm(5), forgestorm_ignited, elemental_chaos_fire
1:04.699 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), hailstorm(5), ice_strike, elemental_chaos_fire
1:05.977 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, hot_hand, maelstrom_weapon(6), hailstorm(5), ice_strike, elemental_chaos_fire
1:07.255 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(7), elemental_chaos_fire
1:08.533 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(7), elemental_chaos_fire
1:09.810 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(9), elemental_chaos_fire
1:11.087 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana hot_hand, stormbringer, maelstrom_weapon(10), elemental_chaos_fire
1:12.365 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, stormbringer, hailstorm(10), elemental_chaos_fire
1:13.645 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), elemental_chaos_fire
1:14.921 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3), elemental_chaos_fire
1:16.197 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), hot_hand, stormbringer, maelstrom_weapon(4), elemental_chaos_fire
1:17.474 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_fire
1:18.752 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_fire
1:20.030 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_fire
1:21.309 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), ice_strike, elemental_chaos_fire
1:22.550 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(8), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:23.792 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:25.034 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(7), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:26.273 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, hailstorm(7), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:27.514 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(7), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:28.756 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), maelstrom_weapon(3), sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:29.996 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_weapon(5), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:31.236 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), maelstrom_weapon(6), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:32.514 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, primordial_wave, ashen_catalyst(4), maelstrom_weapon(10), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:33.791 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, ashen_catalyst(5), hailstorm(10), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:34.953 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, splintered_elements, ashen_catalyst(6), maelstrom_weapon, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:36.114 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, maelstrom_weapon, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:37.275 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_fire
1:38.436 single T frost_shock Fluffy_Pillow 48857.6/50000: 98% mana flurry(3), splintered_elements, ashen_catalyst(2), maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_fire
1:39.597 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(3), maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_fire
1:40.758 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst(4), stormbringer, maelstrom_weapon(5), sophic_devotion_oh, elemental_chaos_fire
1:41.920 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst(4), stormbringer, maelstrom_weapon(6), ice_strike, sophic_devotion_oh, elemental_chaos_fire
1:43.081 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(5), maelstrom_weapon(6), ice_strike, sophic_devotion_oh, elemental_chaos_fire
1:44.243 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, maelstrom_weapon(8), ice_strike, sophic_devotion_oh, elemental_chaos_fire
1:45.403 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(9), ice_strike, sophic_devotion_oh, elemental_chaos_fire
1:46.681 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hailstorm(9), ice_strike, sophic_devotion_oh, elemental_chaos_fire
1:47.920 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_fire
1:49.191 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(2), sophic_devotion_oh, elemental_chaos_fire
1:50.433 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(3), spiraling_winds, forgestorm_ignited, elemental_chaos_fire
1:51.672 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(3), spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
1:52.912 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(3), spiraling_winds(2), forgestorm_ignited, elemental_chaos_fire
1:54.154 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), maelstrom_weapon(5), ice_strike, spiraling_winds(3), forgestorm_ignited, elemental_chaos_fire
1:55.393 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hailstorm(5), ice_strike, spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
1:56.634 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), maelstrom_weapon, hailstorm(5), ice_strike, spiraling_winds(4), forgestorm_ignited, elemental_chaos_fire
1:57.930 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_weapon(2), spiraling_winds(5), forgestorm_ignited, elemental_chaos_fire
1:59.207 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(3), spiraling_winds(6), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_fire
2:00.482 Waiting     1.081 sec 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(6), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:01.563 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(4), spiraling_winds(7), sophic_devotion_oh, elemental_chaos_earth
2:03.037 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(4), spiraling_winds(7), sophic_devotion_oh, elemental_chaos_earth
2:04.314 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), maelstrom_weapon(5), spiraling_winds(8), sophic_devotion_oh, elemental_chaos_earth
2:05.593 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(4), maelstrom_weapon, hailstorm(5), spiraling_winds(9), sophic_devotion_oh, elemental_chaos_earth
2:06.871 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(4), maelstrom_weapon(2), hailstorm(5), ice_strike, spiraling_winds(9), sophic_devotion_oh, elemental_chaos_earth
2:08.149 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(5), maelstrom_weapon(3), hailstorm(5), ice_strike, spiraling_winds(10), sophic_devotion_oh, elemental_chaos_earth
2:09.426 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(6), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_earth
2:10.704 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(7), maelstrom_weapon(4), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_earth
2:11.980 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), hot_hand, stormbringer, maelstrom_weapon(5), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_earth
2:13.258 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), spiraling_winds(10), sophic_devotion_oh, elemental_chaos_earth
2:14.536 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, stormbringer, hailstorm(6), elemental_chaos_earth
2:15.814 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(6), forgestorm_ignited, elemental_chaos_earth
2:17.091 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:18.369 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:19.648 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, ashen_catalyst(2), stormbringer, maelstrom_weapon(10), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:20.927 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(10), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:22.205 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, hailstorm(10), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:23.368 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(4), stormbringer, maelstrom_weapon(4), hailstorm(10), ice_strike, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:24.529 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(5), stormbringer, maelstrom_weapon(5), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:25.692 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(6), stormbringer, maelstrom_weapon, hailstorm(5), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:26.854 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(6), stormbringer, maelstrom_weapon(2), hailstorm(5), sophic_devotion_oh, elemental_chaos_earth
2:28.015 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(7), maelstrom_weapon(3), hailstorm(5), sophic_devotion_oh, elemental_chaos_earth
2:29.177 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(8), maelstrom_weapon(8), sophic_devotion_oh, elemental_chaos_earth
2:30.337 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(8), sophic_devotion_oh, elemental_chaos_earth
2:31.499 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, hailstorm(8), elemental_chaos_earth
2:32.660 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(8), elemental_chaos_earth
2:33.822 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(8), elemental_chaos_earth
2:35.145 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(4), hailstorm(8), ice_strike, elemental_chaos_earth
2:36.422 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, hot_hand, maelstrom_weapon(4), hailstorm(8), ice_strike, elemental_chaos_earth
2:37.700 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(5), elemental_chaos_earth
2:38.976 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst, hot_hand, maelstrom_weapon(5), elemental_chaos_earth
2:40.254 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), maelstrom_weapon(5), elemental_chaos_earth
2:41.533 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), hailstorm(5), elemental_chaos_earth
2:42.810 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(3), maelstrom_weapon, elemental_chaos_earth
2:44.088 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(2), elemental_chaos_earth
2:45.366 single P stormstrike Fluffy_Pillow 49044.8/50000: 98% mana flurry, ashen_catalyst(2), maelstrom_weapon(3), elemental_chaos_earth
2:46.643 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), stormbringer, maelstrom_weapon(4), elemental_chaos_earth
2:47.919 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(3), stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_earth
2:49.197 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(4), stormbringer, maelstrom_weapon(6), ice_strike, elemental_chaos_earth
2:50.474 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(5), maelstrom_weapon(6), ice_strike, elemental_chaos_earth
2:51.751 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(5), hailstorm(6), ice_strike, spiraling_winds, elemental_chaos_earth
2:52.991 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(6), maelstrom_weapon, spiraling_winds(2), elemental_chaos_earth
2:54.231 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst, maelstrom_weapon, spiraling_winds(2), elemental_chaos_earth
2:55.471 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst(2), maelstrom_weapon(2), spiraling_winds(3), sophic_devotion, elemental_chaos_earth
2:56.713 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(3), spiraling_winds(4), sophic_devotion, elemental_chaos_earth
2:57.954 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(4), spiraling_winds(4), sophic_devotion, elemental_chaos_earth
2:59.195 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_weapon(6), spiraling_winds(5), sophic_devotion, elemental_chaos_earth
3:00.435 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(7), ice_strike, spiraling_winds(5), sophic_devotion, elemental_chaos_air
3:00.435 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(7), ice_strike, crumbling_power(20), spiraling_winds(5), sophic_devotion, elemental_chaos_air
3:00.435 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon(7), ice_strike, crumbling_power(20), spiraling_winds(5), sophic_devotion, elemental_chaos_air
3:01.528 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(5), maelstrom_weapon, hailstorm(7), ice_strike, crumbling_power(19), spiraling_winds(6), sophic_devotion, elemental_chaos_air
3:02.654 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_weapon, hailstorm(7), ice_strike, crumbling_power(18), spiraling_winds(7), sophic_devotion, elemental_chaos_air
3:03.781 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), maelstrom_weapon(2), crumbling_power(17), spiraling_winds(7), sophic_devotion, elemental_chaos_air
3:04.907 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_critical_strike, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(10), crumbling_power(17), spiraling_winds(8), sophic_devotion, elemental_chaos_air
3:06.033 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), hot_hand, hailstorm(10), crumbling_power(16), spiraling_winds(8), sophic_devotion, elemental_chaos_air
3:07.056 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, hailstorm(10), crumbling_power(15), spiraling_winds(9), sophic_devotion, elemental_chaos_air
3:08.080 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(2), crumbling_power(14), spiraling_winds(9), sophic_devotion, elemental_chaos_air
3:09.104 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), crumbling_power(13), spiraling_winds(10), sophic_devotion, elemental_chaos_air
3:10.128 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), elemental_blast_critical_strike, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), crumbling_power(12), spiraling_winds(10), elemental_chaos_air
3:11.152 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(3), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), crumbling_power(11), spiraling_winds(10), elemental_chaos_air
3:12.175 single I lava_lash Fluffy_Pillow 49986.8/50000: 100% mana berserking, flurry(3), splintered_elements, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, crumbling_power(10), spiraling_winds(10), elemental_chaos_air
3:13.198 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, crumbling_power(9), spiraling_winds(10), elemental_chaos_air
3:14.325 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, maelstrom_weapon(8), ice_strike, crumbling_power(8), spiraling_winds(10), elemental_chaos_air
3:15.450 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(2), hailstorm(8), ice_strike, crumbling_power(7), spiraling_winds(10), elemental_chaos_air
3:16.575 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, ashen_catalyst(3), stormbringer, maelstrom_weapon(2), crumbling_power(6), elemental_chaos_air
3:17.701 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(4), crumbling_power(5), elemental_chaos_air
3:18.938 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon(5), crumbling_power(4), elemental_chaos_air
3:20.173 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, ashen_catalyst, stormbringer, maelstrom_weapon, hailstorm(5), crumbling_power(3), elemental_chaos_air
3:21.399 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), elemental_chaos_air
3:22.601 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(3), elemental_chaos_air
3:23.854 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(4), hot_hand, stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_air
3:25.057 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge(2), hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, forgestorm_ignited, elemental_chaos_air
3:26.257 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(6), ice_strike, forgestorm_ignited, elemental_chaos_air
3:27.460 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(6), ice_strike, forgestorm_ignited, elemental_chaos_air
3:28.663 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_air
3:29.865 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge(2), hot_hand, stormbringer, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_air
3:31.102 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_air
3:32.340 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_air
3:33.577 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), forgestorm_ignited, elemental_chaos_air
3:34.816 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), forgestorm_ignited, elemental_chaos_air
3:36.053 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, hailstorm(8), forgestorm_ignited, elemental_chaos_air
3:37.291 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(8), ice_strike, elemental_chaos_air
3:38.527 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(8), ice_strike, elemental_chaos_air
3:39.764 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst, stormbringer, maelstrom_weapon(5), elemental_chaos_air
3:41.002 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), elemental_chaos_air
3:42.239 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(3), maelstrom_weapon(5), elemental_chaos_air
3:43.477 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(6), elemental_chaos_air
3:44.715 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hailstorm(6), elemental_chaos_air
3:45.950 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), maelstrom_weapon(2), elemental_chaos_air
3:47.190 single P stormstrike Fluffy_Pillow 48984.0/50000: 98% mana flurry(3), ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_air
3:48.428 single L ice_strike Fluffy_Pillow 49964.8/50000: 100% mana flurry, ashen_catalyst(4), maelstrom_weapon(2), elemental_chaos_air
3:49.666 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_weapon(6), ice_strike, elemental_chaos_air
3:50.903 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, ashen_catalyst(5), maelstrom_weapon(10), ice_strike, elemental_chaos_air
3:52.141 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst(6), maelstrom_weapon(10), ice_strike, elemental_chaos_air
3:53.377 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(7), hailstorm(10), ice_strike, elemental_chaos_air
3:54.501 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(7), maelstrom_weapon(3), elemental_chaos_air
3:55.628 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(8), maelstrom_weapon(3), elemental_chaos_air
3:56.755 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(4), elemental_chaos_air
3:57.880 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(5), elemental_chaos_air
3:59.005 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, crackling_surge(2), hot_hand, maelstrom_weapon(5), elemental_chaos_air
4:00.130 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, maelstrom_weapon(3), hailstorm(5), elemental_chaos_fire
4:01.259 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(5), elemental_chaos_fire
4:02.386 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(4), hailstorm(5), ice_strike, elemental_chaos_fire
4:03.513 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, crackling_surge(2), hot_hand, stormbringer, maelstrom_weapon(6), hailstorm(5), ice_strike, elemental_chaos_fire
4:04.640 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), elemental_chaos_fire
4:05.880 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst, stormbringer, maelstrom_weapon(8), elemental_chaos_fire
4:07.121 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(2), stormbringer, maelstrom_weapon, hailstorm(8), elemental_chaos_fire
4:08.362 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, ashen_catalyst(2), stormbringer, maelstrom_weapon(2), hailstorm(8), elemental_chaos_fire
4:09.635 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(3), stormbringer, maelstrom_weapon(4), elemental_chaos_fire
4:10.912 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), maelstrom_weapon(5), elemental_chaos_fire
4:12.190 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(6), elemental_chaos_fire
4:13.469 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, ashen_catalyst(2), hailstorm(6), elemental_chaos_fire
4:14.745 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), maelstrom_weapon, hailstorm(6), ice_strike, elemental_chaos_fire
4:16.022 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_fire
4:17.299 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(4), maelstrom_weapon(3), elemental_chaos_fire
4:18.575 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
4:19.877 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
4:21.152 Waiting     1.026 sec 50000.0/50000: 100% mana flurry, ashen_catalyst, maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
4:22.178 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_fire
4:23.666 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(3), stormbringer, maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_fire
4:24.943 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_fire
4:26.249 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), maelstrom_weapon(4), forgestorm_ignited, elemental_chaos_fire
4:27.526 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(5), maelstrom_weapon(5), ice_strike, forgestorm_ignited, elemental_chaos_fire
4:28.802 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), maelstrom_weapon(6), ice_strike, forgestorm_ignited, elemental_chaos_fire
4:30.082 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(6), hot_hand, hailstorm(6), ice_strike, forgestorm_ignited, elemental_chaos_fire
4:31.359 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(6), ice_strike, elemental_chaos_fire
4:32.637 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(5), elemental_chaos_fire
4:33.915 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(6), elemental_chaos_fire
4:35.191 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, hailstorm(6), elemental_chaos_fire
4:36.469 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon, hailstorm(6), elemental_chaos_fire
4:37.746 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), hailstorm(6), elemental_chaos_fire
4:39.024 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, primordial_wave, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon(10), hailstorm(6), elemental_chaos_fire
4:40.301 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst, stormbringer, maelstrom_weapon, hailstorm(10), elemental_chaos_fire
4:41.461 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, feral_spirit, molten_weapon, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, elemental_chaos_fire
4:42.624 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, splintered_elements, ashen_catalyst(3), stormbringer, maelstrom_weapon(5), elemental_chaos_fire
4:43.784 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, ashen_catalyst(4), maelstrom_weapon(6), elemental_chaos_fire
4:44.946 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(4), hailstorm(6), elemental_chaos_fire
4:46.107 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, hailstorm(6), elemental_chaos_fire
4:47.269 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(2), maelstrom_weapon(2), elemental_chaos_fire
4:48.430 single P stormstrike Fluffy_Pillow 48857.6/50000: 98% mana flurry(3), splintered_elements, ashen_catalyst(3), maelstrom_weapon(2), elemental_chaos_fire
4:49.590 single V flame_shock Fluffy_Pillow 49713.6/50000: 99% mana flurry, splintered_elements, ashen_catalyst(3), maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_fire
4:50.751 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst(4), maelstrom_weapon(3), spiraling_winds, sophic_devotion_oh, elemental_chaos_fire
4:51.911 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), maelstrom_weapon(3), spiraling_winds(2), sophic_devotion_oh, elemental_chaos_fire
4:53.238 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(6), maelstrom_weapon(4), ice_strike, spiraling_winds(2), sophic_devotion_oh, elemental_chaos_fire
4:54.515 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), maelstrom_weapon(6), ice_strike, spiraling_winds(3), sophic_devotion_oh, elemental_chaos_fire
4:55.793 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, maelstrom_weapon(7), ice_strike, spiraling_winds(4), sophic_devotion_oh, elemental_chaos_fire
4:57.070 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, hailstorm(7), ice_strike, spiraling_winds(4), sophic_devotion_oh, elemental_chaos_fire
4:58.348 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(3), spiraling_winds(5), sophic_devotion_oh, elemental_chaos_fire
4:59.626 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), stormbringer, maelstrom_weapon(5), spiraling_winds(6), sophic_devotion_oh, elemental_chaos_fire

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.82% 15.82% 1047
Haste 21.63% 17.79% 3025
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 58.70% 58.70% 3843
Armor 3603 3603 3603
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Mastery }
item effects: { equip: Signet of Melandrus }
Local Finger2 Woe-Bearer's Band
ilevel: 372, stats: { +386 Sta, +339 Crit, +451 Mastery }, enchant: { +73 Mastery }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/stormstrike,if=talent.stormflurry.enabled&buff.stormbringer.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant_id=6495
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant_id=6561
finger2=woebearers_band,id=133638,bonus_id=1795/3251/657/7977,enchant_id=6561
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1047
# gear_haste_rating=3025
# gear_mastery_rating=3843
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Gamba : 47995 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
47995.2 47995.2 84.5 / 0.176% 14691.0 / 30.6% 53.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
841.6 839.0 Mana 1.51% 52.2 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Gamba 47995
Ascendance (_dre) 0 (1053) 0.0% (2.2%) 8.3 30.97sec 38211 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.26 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1053 2.2% 8.3 30.97sec 38211 0 Direct 8.3 32021 64343 38211 19.2% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.00 0.0000 0.0000 315668.04 315668.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 6.68 0 23 32020.90 26454 54220 31976.76 0 43691 213873 213873 0.00%
crit 19.15% 1.58 0 8 64342.92 52908 107069 50672.18 0 104244 101795 101795 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 83 0.2% 3.7 90.41sec 6670 6097 Direct 3.7 6670 0 6670 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.73 3.73 0.00 0.00 0.00 1.0941 0.0000 24892.98 35562.31 30.00% 6096.74 6096.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.73 3 4 6670.35 3838 13180 6685.56 5174 8866 24893 35562 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.73
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 7048 14.7% 25.2 11.74sec 84005 71541 Direct 25.2 69366 139256 84036 21.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.16 25.15 0.00 0.00 0.00 1.1742 0.0000 2113534.25 2113534.25 0.00% 71540.95 71540.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.01% 19.87 10 30 69365.79 45017 138741 69380.32 55265 84530 1378396 1378396 0.00%
crit 20.99% 5.28 0 13 139255.53 90033 274247 138883.79 0 217894 735138 735138 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [Q]:25.16
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 1554 3.2% 30.4 9.71sec 15326 34325 Direct 30.4 2805 5627 3293 17.3% 0.0%
Periodic 186.9 1666 3347 1957 17.3% 0.0% 96.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.40 30.40 186.92 186.92 29.12 0.4465 1.5556 465922.84 465922.84 0.00% 1530.93 34324.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 25.14 11 42 2804.79 2342 5016 2805.99 2549 3138 70510 70510 0.00%
crit 17.31% 5.26 0 14 5627.22 4685 9886 5604.54 0 8695 29608 29608 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.71% 154.60 109 203 1666.47 1 2984 1667.10 1550 1853 257639 257639 0.00%
crit 17.29% 32.31 9 59 3347.30 10 5815 3348.67 2981 3765 108165 108165 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [N]:1.28
  • if_expr:!ticking
    single
    [Z]:10.44
Flametongue Weapon 0 (1552) 0.0% (3.2%) 1.0 0.00sec 464885 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1552 3.2% 1122.9 0.67sec 414 0 Direct 1122.9 353 708 414 17.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1122.90 1122.90 0.00 0.00 0.00 0.0000 0.0000 464884.90 464884.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 929.16 605 1286 352.74 290 614 352.94 329 391 327747 327747 0.00%
crit 17.25% 193.75 117 303 707.82 580 1213 708.30 659 779 137138 137138 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1108 2.3% 28.8 7.60sec 11538 0 Direct 28.8 9806 19715 11538 17.5% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.81 28.81 0.00 0.00 0.00 0.0000 0.0000 332366.79 332366.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.51% 23.77 2 69 9805.81 9732 10030 9806.22 9732 10030 233068 233068 0.00%
crit 17.49% 5.04 0 18 19714.56 19463 20059 19310.79 0 20059 99299 99299 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1075 2.2% 17.1 16.46sec 18864 16099 Direct 17.1 16041 32295 18863 17.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.07 17.07 0.00 0.00 0.00 1.1717 0.0000 322067.31 322067.31 0.00% 16099.34 16099.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 14.11 2 29 16041.17 7567 31940 16112.01 12660 20699 226325 226325 0.00%
crit 17.36% 2.96 0 10 32295.36 15135 62417 30770.87 0 56805 95742 95742 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [X]:17.07
Ice Strike 1459 3.0% 20.5 14.76sec 21366 18440 Direct 20.5 18188 36474 21366 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.46 20.46 0.00 0.00 0.00 1.1587 0.0000 437222.20 437222.20 0.00% 18440.41 18440.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.62% 16.91 7 26 18188.36 15041 31584 18196.89 16106 21027 307523 307523 0.00%
crit 17.38% 3.56 0 12 36473.68 30081 63977 35669.18 0 56901 129699 129699 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:2.56
  • if_expr:buff.doom_winds_talent.up
    single
    [T]:17.91
Lava Lash 1386 2.9% 18.7 15.66sec 22246 18966 Direct 18.7 18909 37998 22246 17.5% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.67 18.67 0.00 0.00 0.00 1.1729 0.0000 415421.57 415421.57 0.00% 18966.42 18966.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.52% 15.41 6 24 18909.02 15840 33198 18913.97 16954 21925 291387 291387 0.00%
crit 17.48% 3.26 0 10 37997.65 31680 64343 36719.80 0 58336 124035 124035 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [O]:4.03
  • if_expr:dot.flame_shock.refreshable
    single
    [U]:14.64
Lightning Bolt 2936 6.1% 17.1 16.45sec 51473 43806 Direct 17.1 42389 84871 51474 21.4% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.10 17.10 0.00 0.00 0.00 1.1751 0.0000 880152.71 880152.71 0.00% 43806.13 43806.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.62% 13.44 3 27 42389.05 28471 93465 42432.10 31730 55556 569821 569821 0.00%
crit 21.38% 3.66 0 11 84871.21 56942 175841 82951.48 0 158850 310332 310332 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [R]:4.36
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [V]:12.74
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1429 3.0% 163.3 2.14sec 2623 1543 Direct 163.3 2592 5209 2623 17.4% 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 163.31 163.31 0.00 0.00 0.00 1.6999 0.0000 428367.17 611968.71 30.00% 1543.08 1543.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.31% 108.28 56 160 2591.56 2204 4389 2592.71 2382 2881 280624 400901 30.00%
crit 17.37% 28.36 6 53 5208.94 4408 8778 5211.00 4636 6007 147743 211067 30.00%
miss 16.32% 26.66 9 51 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 731 1.5% 166.9 2.09sec 1313 772 Direct 166.9 1298 2608 1313 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 166.86 166.86 0.00 0.00 0.00 1.7003 0.0000 219094.43 313000.02 30.00% 772.21 772.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.25% 110.55 61 161 1297.64 1102 2223 1298.25 1198 1456 143460 204948 30.00%
crit 17.38% 29.00 10 57 2608.46 2204 4389 2609.23 2341 3092 75634 108052 30.00%
miss 16.37% 27.31 11 51 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7737) 0.0% (16.1%) 90.5 3.30sec 25607 22043

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.53 0.00 0.00 0.00 0.00 1.1617 0.0000 0.00 0.00 0.00% 22043.47 22043.47

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:12.90
  • if_expr:buff.doom_winds_talent.up
    single
    [P]:40.13
  • if_expr:talent.stormflurry.enabled&buff.stormbringer.up
    single
    [S]:37.50
    Stormstrike (_mh) 4160 (5157) 8.7% (10.7%) 120.7 3.30sec 12804 0 Direct 120.7 (181.3) 8796 17666 10330 17.3% (11.5%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.68 120.68 0.00 0.00 0.00 0.0000 0.0000 1246668.97 1781001.08 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.70% 99.81 50 152 8796.16 2743 23553 8816.59 7453 10321 877942 1254234 30.00%
crit 17.30% 20.87 6 43 17665.90 5486 42791 17706.11 11095 23865 368727 526767 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 997 2.1% 60.6 5.53sec 4925 0 Direct 60.6 4926 0 4926 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.61 60.61 0.00 0.00 0.00 0.0000 0.0000 298556.50 298556.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 60.61 22 105 4925.60 1205 19505 4940.62 3568 6689 298557 298557 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 2081 (2580) 4.3% (5.4%) 120.7 3.30sec 6405 0 Direct 120.7 (181.3) 4398 8838 5167 17.3% (11.5%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.68 120.68 0.00 0.00 0.00 0.0000 0.0000 623580.49 890851.99 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 99.77 50 158 4397.60 1372 11777 4408.07 3802 5176 438730 626773 30.00%
crit 17.33% 20.92 6 43 8837.75 2743 21716 8859.39 5792 12206 184851 264079 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 499 1.0% 60.6 5.53sec 2465 0 Direct 60.6 2465 0 2465 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.61 60.61 0.00 0.00 0.00 0.0000 0.0000 149395.96 149395.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 60.61 22 105 2464.73 602 9715 2472.39 1899 3358 149396 149396 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1057 2.2% 6.4 48.81sec 49108 42341 Direct 6.4 41903 84221 49108 17.0% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.44 6.44 0.00 0.00 0.00 1.1600 0.0000 316500.73 316500.73 0.00% 42341.23 42341.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.97% 5.35 1 9 41903.15 26739 84221 41956.46 28630 54113 224079 224079 0.00%
crit 17.03% 1.10 0 6 84221.15 53478 176889 58798.59 0 176889 92422 92422 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [M]:1.64
  • if_expr:buff.doom_winds_talent.up
    single
    [W]:4.81
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7096) 0.0% (14.8%) 1.0 0.00sec 2123166 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7096 14.8% 415.2 2.41sec 5113 0 Direct 415.2 4360 8740 5113 17.2% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 415.24 415.24 0.00 0.00 0.00 0.0000 0.0000 2123165.62 3033171.07 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.80% 343.84 197 496 4359.86 1488 11800 4358.64 3760 5174 1499095 2141619 30.00%
crit 17.20% 71.40 32 121 8739.94 2976 23745 8735.83 6937 10865 624070 891552 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 500 1.0% 33.3 8.51sec 4495 3199 Direct 33.3 3705 7445 4495 21.1% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.34 33.34 0.00 0.00 0.00 1.4053 0.0000 149858.44 149858.44 0.00% 3198.62 3198.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.87% 26.29 0 78 3704.71 3148 6270 3706.25 0 4956 97411 97411 0.00%
crit 21.13% 7.04 0 24 7445.09 6297 12540 7363.04 0 11135 52448 52448 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 289 0.6% 38.5 7.38sec 2246 1547 Direct 38.5 1853 3721 2246 21.0% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.53 38.53 0.00 0.00 0.00 1.4517 0.0000 86543.74 86543.74 0.00% 1547.19 1547.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.97% 30.43 0 91 1853.10 1574 3135 1853.64 0 2320 56387 56387 0.00%
crit 21.03% 8.10 0 26 3720.99 3148 6212 3695.61 0 5219 30156 30156 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (7017) 0.0% (14.6%) 27.3 8.66sec 77046 67001

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.27 0.00 0.00 0.00 0.00 1.1500 0.0000 0.00 0.00 0.00% 67001.08 67001.08

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:27.27
    Windstrike (_mh) 1905 (2252) 4.0% (4.7%) 36.3 8.66sec 18550 0 Direct 36.3 (48.8) 13389 26875 15704 17.2% (12.8%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.34 36.32 0.00 0.00 0.00 0.0000 0.0000 570402.17 570402.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.83% 30.08 0 97 13388.51 3919 34756 13388.41 0 21947 402800 402800 0.00%
crit 17.17% 6.24 0 24 26874.73 7838 67252 26342.10 0 50347 167602 167602 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 347 0.7% 12.4 18.32sec 8340 0 Direct 12.4 8340 0 8340 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.44 12.44 0.00 0.00 0.00 0.0000 0.0000 103729.56 103729.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.44 0 40 8340.21 3237 29530 8250.71 0 17722 103730 103730 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 952 (1126) 2.0% (2.3%) 36.3 8.66sec 9272 0 Direct 36.3 (48.8) 6694 13440 7850 17.1% (12.8%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.34 36.32 0.00 0.00 0.00 0.0000 0.0000 285127.42 285127.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.86% 30.10 0 106 6693.98 1959 17378 6692.65 0 10891 201474 201474 0.00%
crit 17.14% 6.22 0 29 13440.12 3919 32552 13212.52 0 23935 83654 83654 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 173 0.4% 12.4 18.32sec 4169 0 Direct 12.4 4169 0 4169 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.44 12.44 0.00 0.00 0.00 0.0000 0.0000 51851.65 51851.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 12.44 0 40 4169.08 1618 14141 4125.52 0 7788 51852 51852 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3639 7.6% 27.2 8.68sec 40065 0 Direct 27.2 33054 66195 40065 21.2% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.20 27.20 0.00 0.00 0.00 0.0000 0.0000 1089775.20 1089775.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.84% 21.45 0 70 33053.66 15817 60196 33076.36 0 47628 708840 708840 0.00%
crit 21.16% 5.75 0 21 66194.70 31634 117519 65116.53 0 94608 380935 380935 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 424 / 89
melee 424 0.2% 41.0 2.40sec 647 432 Direct 41.0 552 1103 647 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.95 40.95 0.00 0.00 0.00 1.4999 0.0000 26509.37 37871.49 30.00% 431.54 431.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 33.87 18 61 551.84 490 960 551.30 490 674 18688 26698 30.00%
crit 17.31% 7.09 0 20 1103.23 980 1910 1101.89 0 1481 7821 11174 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4030 / 2796
melee 4030 5.8% 363.7 1.64sec 2301 2015 Direct 363.7 1963 3921 2301 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 363.74 363.74 0.00 0.00 0.00 1.1419 0.0000 837115.74 1195910.13 30.00% 2015.48 2015.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 300.95 178 435 1963.46 1660 3306 1964.58 1831 2208 590897 844160 30.00%
crit 17.26% 62.79 26 107 3921.46 3321 6611 3924.24 3581 4377 246219 351750 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Gamba
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.2 308.91sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.16 0.00 0.00 0.00 0.00 1.0032 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Y]:1.16
Feral Spirit 14.6 21.57sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.62 0.00 0.00 0.00 0.00 1.1536 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:14.62
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Gamba
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.00
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 6.3 0.0 42.0sec 42.0sec 7.7sec 16.33% 91.33% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 281.6s
  • trigger_min/max:6.0s / 281.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.0s

Stack Uptimes

  • ascendance_1:16.33%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.4sec 0.0sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.4sec 5.5sec 18.8sec 12.72% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:0.0s / 164.1s
  • trigger_pct:100.00%
  • duration_min/max:16.9s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.70%
  • crumbling_power_5:0.73%
  • crumbling_power_6:0.73%
  • crumbling_power_7:0.71%
  • crumbling_power_8:0.71%
  • crumbling_power_9:0.70%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.67%
  • crumbling_power_18:0.74%
  • crumbling_power_19:1.21%
  • crumbling_power_20:0.06%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds (_talent) 3.7 0.0 90.4sec 90.4sec 7.9sec 9.88% 11.44% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_doom_winds_talent
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.4s
  • trigger_min/max:90.0s / 92.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_talent_1:9.88%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 14.6 0.0 24.1sec 21.1sec 17.4sec 69.35% 100.00% 0.0 (0.0) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.9s / 116.3s
  • trigger_min/max:6.9s / 47.7s
  • trigger_pct:49.99%
  • duration_min/max:0.0s / 106.5s

Stack Uptimes

  • earthen_weapon_2:67.25%
  • earthen_weapon_4:2.10%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.4 1.0 37.5sec 32.7sec 10.7sec 26.54% 0.00% 1.0 (1.0) 7.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 283.1s
  • trigger_min/max:1.2s / 283.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.0s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.54%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.5 0.9 37.3sec 32.6sec 10.7sec 26.62% 0.00% 0.9 (0.9) 7.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 239.8s
  • trigger_min/max:1.2s / 239.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.4s

Stack Uptimes

  • elemental_blast_haste_1:26.62%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.4 0.9 37.4sec 32.7sec 10.7sec 26.55% 0.00% 0.9 (0.9) 7.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 237.9s
  • trigger_min/max:1.2s / 237.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.2s

Stack Uptimes

  • elemental_blast_mastery_1:26.55%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 121.4sec 98.5sec 57.8sec 25.22% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:25.22%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 125.6sec 99.0sec 58.4sec 24.93% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 314.4s

Stack Uptimes

  • elemental_chaos_earth_1:24.93%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 123.6sec 98.9sec 58.1sec 24.84% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.1s

Stack Uptimes

  • elemental_chaos_fire_1:24.84%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.2sec 98.8sec 58.1sec 25.01% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 314.2s

Stack Uptimes

  • elemental_chaos_frost_1:25.01%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0sec 0.0sec 29.4sec 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.93%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 11.9 2.7 26.1sec 21.6sec 17.4sec 69.36% 0.00% 59.0 (59.0) 11.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 116.3s
  • trigger_min/max:6.9s / 47.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 106.5s

Stack Uptimes

  • feral_spirit_1:69.36%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.6 385.3 6.9sec 0.7sec 5.8sec 85.00% 90.80% 385.3 (914.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 63.6s
  • trigger_min/max:0.0s / 17.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 63.3s

Stack Uptimes

  • flurry_1:19.85%
  • flurry_2:34.82%
  • flurry_3:30.33%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.4 121.0 17.7sec 2.2sec 14.6sec 84.81% 100.00% 57.9 (57.9) 16.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 44.8s
  • trigger_min/max:0.0s / 38.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.60%
  • forceful_winds_2:13.82%
  • forceful_winds_3:12.42%
  • forceful_winds_4:10.60%
  • forceful_winds_5:33.37%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.3sec 46.3sec 12.9sec 19.50% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 209.4s
  • trigger_min/max:0.2s / 209.4s
  • trigger_pct:98.77%
  • duration_min/max:0.0s / 49.8s

Stack Uptimes

  • forgestorm_ignited_1:19.50%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 19.3 1.1 15.7sec 14.8sec 7.6sec 49.17% 79.11% 1.1 (1.1) 5.5

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.3s / 82.1s
  • trigger_min/max:8.3s / 80.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.4s

Stack Uptimes

  • ice_strike_1:49.17%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 23.2 20.4 12.8sec 6.7sec 7.9sec 61.47% 0.00% 20.4 (20.4) 22.6

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 73.7s
  • trigger_min/max:0.8s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.1s

Stack Uptimes

  • legacy_of_the_frost_witch_1:61.47%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 50.7 415.8 6.0sec 1.2sec 5.1sec 86.62% 100.00% 61.3 (65.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 49.5s
  • trigger_min/max:0.0s / 9.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.5s

Stack Uptimes

  • maelstrom_weapon_1:9.05%
  • maelstrom_weapon_2:10.63%
  • maelstrom_weapon_3:12.37%
  • maelstrom_weapon_4:12.94%
  • maelstrom_weapon_5:8.63%
  • maelstrom_weapon_6:7.21%
  • maelstrom_weapon_7:5.55%
  • maelstrom_weapon_8:4.68%
  • maelstrom_weapon_9:3.75%
  • maelstrom_weapon_10:11.82%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.1sec 45.4sec 16.6sec 23.69% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 220.7s
  • trigger_min/max:0.0s / 204.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.0s

Stack Uptimes

  • sophic_devotion_1:23.69%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.2 60.9sec 45.3sec 16.6sec 23.67% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 212.5s
  • trigger_min/max:0.1s / 201.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 84.4s

Stack Uptimes

  • sophic_devotion_oh_1:23.67%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.8sec 45.2sec 32.3sec 38.40% 0.00% 25.9 (25.9) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 246.2s
  • trigger_min/max:0.1s / 208.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 195.8s

Stack Uptimes

  • spiraling_winds_1:2.35%
  • spiraling_winds_2:2.32%
  • spiraling_winds_3:2.31%
  • spiraling_winds_4:2.29%
  • spiraling_winds_5:2.27%
  • spiraling_winds_6:2.26%
  • spiraling_winds_7:2.24%
  • spiraling_winds_8:2.23%
  • spiraling_winds_9:2.21%
  • spiraling_winds_10:17.94%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 6.5 1.8 41.1sec 31.0sec 7.1sec 15.37% 100.00% 41.0 (41.0) 6.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 281.6s
  • trigger_min/max:0.8s / 281.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.3s

Stack Uptimes

  • static_accumulation_1:15.37%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 62.6 19.3 4.7sec 3.6sec 1.1sec 23.53% 52.85% 19.3 (19.3) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 66.6s
  • trigger_min/max:0.0s / 66.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • stormbringer_1:23.53%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Gamba
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.7 33.0 66.0 17.8s 15.0s 62.6s
Windfury-ForcefulWinds: 2 51.3 33.0 75.0 18.0s 0.2s 65.7s
Windfury-ForcefulWinds: 3 49.8 30.0 69.0 18.6s 0.2s 80.5s
Windfury-ForcefulWinds: 4 46.6 24.0 72.0 19.8s 1.1s 90.7s
Windfury-ForcefulWinds: 5 215.8 99.0 363.0 4.6s 0.0s 86.7s
windfury_totem_extra_attack_mh 28.1 9.0 51.0 10.4s 1.2s 120.2s
windfury_totem_extra_attack_oh 29.4 11.0 54.0 10.0s 0.1s 110.3s
Windfury: Unruly Winds 138.4 79.0 198.0 2.4s 0.0s 38.0s
Maelstrom Weapon: Feral Spirit 79.6 52.0 111.0 3.8s 0.0s 32.7s
Maelstrom Weapon: Elemental Assault 117.8 74.0 180.0 2.5s 0.8s 10.0s
Maelstrom Weapon: Static Accumulation 88.4 0.0 248.0 5.3s 1.0s 276.6s
Stormflurry 39.2 11.0 80.0 9.9s 0.8s 134.9s
Flametongue: Windfury Attack 415.2 237.0 594.0 2.4s 0.0s 38.0s
Stormbringer: Windfury Attack 43.9 16.0 76.0 7.8s 0.0s 120.7s
Maelstrom Weapon: Windfury Attack 83.1 36.0 134.0 4.7s 0.0s 70.5s
Flametongue: main_hand 136.6 74.0 195.0 2.6s 1.2s 75.0s
Maelstrom Weapon: main_hand 27.5 10.0 52.0 11.0s 1.2s 131.0s
Windfury: main_hand 52.0 18.0 84.0 6.2s 1.2s 95.7s
Flametongue: Windlash 33.3 0.0 97.0 8.5s 1.2s 277.3s
Maelstrom Weapon: Windlash 6.7 0.0 24.0 32.8s 1.2s 329.7s
Windfury: Windlash 12.5 0.0 43.0 19.9s 1.2s 312.7s
Flametongue: offhand 139.6 81.0 196.0 2.6s 1.2s 74.5s
Maelstrom Weapon: offhand 27.9 9.0 57.0 10.8s 1.2s 143.9s
Flametongue: Windlash Off-Hand 38.5 0.0 110.0 7.4s 0.1s 276.0s
Maelstrom Weapon: Windlash Off-Hand 7.7 0.0 25.0 29.2s 0.2s 330.6s
Flametongue: Sundering 6.4 3.0 9.0 48.9s 40.0s 160.8s
Stormbringer: Sundering 0.7 0.0 5.0 113.3s 40.0s 345.1s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 105.1s 40.0s 344.1s
Windfury: Sundering 3.1 0.0 8.0 87.9s 40.0s 350.1s
Flametongue: Windstrike 36.3 0.0 118.0 8.7s 0.8s 277.9s
Stormbringer: Windstrike 3.8 0.0 19.0 45.3s 0.8s 330.6s
Maelstrom Weapon: Windstrike 7.3 0.0 32.0 30.9s 0.8s 329.0s
Windfury: Windstrike 13.9 0.0 50.0 18.8s 0.8s 326.4s
Flametongue: Windstrike Off-Hand 36.3 0.0 118.0 8.7s 0.8s 277.9s
Stormbringer: Windstrike Off-Hand 3.8 0.0 18.0 45.6s 0.8s 336.3s
Maelstrom Weapon: Windstrike Off-Hand 7.2 0.0 30.0 30.9s 0.8s 315.5s
Flametongue: Lava Lash 18.7 11.0 27.0 15.7s 8.4s 69.6s
Stormbringer: Lava Lash 2.0 0.0 8.0 77.7s 8.8s 325.1s
Maelstrom Weapon: Lava Lash 3.7 0.0 12.0 58.8s 8.4s 307.9s
Flametongue: Ice Strike 20.5 12.0 28.0 14.8s 8.3s 80.1s
Stormbringer: Ice Strike 2.1 0.0 9.0 77.7s 8.3s 350.7s
Maelstrom Weapon: Ice Strike 4.1 0.0 12.0 56.9s 8.3s 317.1s
Windfury: Ice Strike 8.0 1.0 17.0 37.0s 8.3s 297.6s
Flametongue: Stormstrike 120.7 66.0 185.0 3.3s 0.8s 74.3s
Stormbringer: Stormstrike 12.8 1.0 31.0 22.3s 0.8s 245.9s
Maelstrom Weapon: Stormstrike 24.2 7.0 45.0 12.8s 0.8s 138.2s
Windfury: Stormstrike 48.8 22.0 81.0 7.1s 0.8s 94.3s
Flametongue: Stormstrike Off-Hand 120.7 66.0 185.0 3.3s 0.8s 74.3s
Stormbringer: Stormstrike Off-Hand 12.7 2.0 32.0 22.4s 0.8s 237.3s
Maelstrom Weapon: Stormstrike Off-Hand 24.2 6.0 47.0 12.8s 0.8s 140.9s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 26.39% 14.11% 42.95% 0.8s 0.0s 32.7s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7910.0011.47410.1701.89418.402
Doom Winds0.5310.0012.4161.1300.0004.586
Sundering9.3110.001120.84948.2950.845168.305
Windstrike1.0470.0013.94428.2960.00089.901
Lava Lash4.0370.00157.50769.40919.536144.510
Flame Shock20.6100.001216.350218.94371.533316.526
Ice Strike3.2930.00168.34761.62612.720153.335
Frost Shock12.1560.001195.598189.40667.051299.152
Elemental Blast3.8970.00339.9922.8190.00043.482
Stormstrike1.0540.0015.04590.91744.884142.009
Earth Elemental9.6810.00540.8341.4190.00040.834

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Gamba
mana_regenMana670.16251686.59100.00%375.56227710.8647.50%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 838.96 841.60 227711.1 49207.7 41865.6 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Gamba
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 25.1634594.421375.001375.0061.09
Flame ShockMana 11.738795.53750.00289.3252.97
Frost ShockMana 17.078537.13500.00500.0337.73
Ice StrikeMana 20.4633766.161650.001650.0412.95
Lava LashMana 18.677469.78400.00400.0055.61
Lightning BoltMana 17.108549.33500.00499.98102.95
StormstrikeMana 120.68120681.641000.001333.0619.21
SunderingMana 6.4519335.023000.003000.0116.37

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Gamba Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Gamba Damage Per Second
Count 7499
Mean 47995.17
Minimum 37804.17
Maximum 63442.90
Spread ( max - min ) 25638.74
Range [ ( max - min ) / 2 * 100% ] 26.71%
Standard Deviation 3734.6756
5th Percentile 42233.27
95th Percentile 54584.54
( 95th Percentile - 5th Percentile ) 12351.26
Mean Distribution
Standard Deviation 43.1272
95.00% Confidence Interval ( 47910.64 - 48079.70 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 233
0.1% Error 23260
0.1 Scale Factor Error with Delta=300 119067
0.05 Scale Factor Error with Delta=300 476266
0.01 Scale Factor Error with Delta=300 11906646
Priority Target DPS
PR_Shaman_Enhancement_Gamba Priority Target Damage Per Second
Count 7499
Mean 47995.17
Minimum 37804.17
Maximum 63442.90
Spread ( max - min ) 25638.74
Range [ ( max - min ) / 2 * 100% ] 26.71%
Standard Deviation 3734.6756
5th Percentile 42233.27
95th Percentile 54584.54
( 95th Percentile - 5th Percentile ) 12351.26
Mean Distribution
Standard Deviation 43.1272
95.00% Confidence Interval ( 47910.64 - 48079.70 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 233
0.1% Error 23260
0.1 Scale Factor Error with Delta=300 119067
0.05 Scale Factor Error with Delta=300 476266
0.01 Scale Factor Error with Delta=300 11906646
DPS(e)
PR_Shaman_Enhancement_Gamba Damage Per Second (Effective)
Count 7499
Mean 47995.17
Minimum 37804.17
Maximum 63442.90
Spread ( max - min ) 25638.74
Range [ ( max - min ) / 2 * 100% ] 26.71%
Damage
PR_Shaman_Enhancement_Gamba Damage
Count 7499
Mean 13514751.63
Minimum 8679446.09
Maximum 20478001.22
Spread ( max - min ) 11798555.13
Range [ ( max - min ) / 2 * 100% ] 43.65%
DTPS
PR_Shaman_Enhancement_Gamba Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Gamba Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Gamba Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Gamba Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Gamba Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Gamba Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_GambaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Gamba Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.00 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 14.62 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
G 3.73 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 27.27 windstrike
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
K 12.90 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
L 2.56 ice_strike,if=buff.doom_winds_talent.up
M 1.64 sundering,if=buff.doom_winds_talent.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
N 1.28 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 frost_shock,if=buff.hailstorm.up
O 4.03 lava_lash,if=dot.flame_shock.refreshable
P 40.13 stormstrike,if=talent.stormflurry.enabled&buff.stormbringer.up
Q 25.16 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
R 4.36 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
S 37.50 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
T 17.91 ice_strike
U 14.64 lava_lash
0.00 bag_of_tricks
V 12.74 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
W 4.81 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
X 17.07 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Y 1.16 earth_elemental
Z 10.44 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGKKLKKKJJJFJJNQSTUWXSQSPVXTUSQSXYZFSTPRSUXZSPQSTXUZSQXZSTWUXSFZXQSPPJQJJTUVSXFQZSXTGKUKKJJJJFQSTUVSWQPXZPTURSXZSQSPFTQUSXZVSPPQSTUVWPJJJFQSTUVPJJJQSVFTUSDEJGJJJJJFJJQSPQOSPTVWXSZUXSPQSFQSPPPRSPOPQSTXZSVUXZFSJJJJQSTUQWSXVSFJJJJJBJGJFKJJJJNQSFJJQSPTROPJJF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 2 augmentation PR_Shaman_Enhancement_Gamba 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_air
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), maelstrom_weapon, elemental_chaos_air
0:00.000 default E berserking Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry, maelstrom_weapon(2), crumbling_power(20), elemental_chaos_air
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, berserking, flurry, maelstrom_weapon(2), crumbling_power(20), elemental_chaos_air
0:00.840 default G doom_winds Fluffy_Pillow 40594.0/50000: 81% mana bloodlust, berserking, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), crumbling_power(19), elemental_chaos_air
0:01.682 single K stormstrike Fluffy_Pillow 41941.2/50000: 84% mana bloodlust, berserking, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds_talent, crumbling_power(19), elemental_chaos_air
0:02.521 single K stormstrike Fluffy_Pillow 41283.6/50000: 83% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(8), doom_winds_talent, crumbling_power(18), elemental_chaos_air
0:03.363 single L ice_strike Fluffy_Pillow 41630.8/50000: 83% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, crumbling_power(17), elemental_chaos_air
0:04.203 single K stormstrike Fluffy_Pillow 41324.8/50000: 83% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(16), elemental_chaos_air
0:05.045 single K stormstrike Fluffy_Pillow 38672.0/50000: 77% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(15), forgestorm_ignited, elemental_chaos_air
0:05.884 single K stormstrike Fluffy_Pillow 39014.4/50000: 78% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, ice_strike, crumbling_power(14), forgestorm_ignited, elemental_chaos_air
0:06.724 single J windstrike Fluffy_Pillow 38358.4/50000: 77% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, crumbling_power(13), forgestorm_ignited, elemental_chaos_air
0:07.564 single J windstrike Fluffy_Pillow 39702.4/50000: 79% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, crumbling_power(12), forgestorm_ignited, elemental_chaos_air
0:08.406 single J windstrike Fluffy_Pillow 41049.6/50000: 82% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), forgestorm_ignited, elemental_chaos_air
0:09.246 default F feral_spirit Fluffy_Pillow 42393.6/50000: 85% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), forgestorm_ignited, elemental_chaos_air
0:10.085 single J windstrike Fluffy_Pillow 43736.0/50000: 87% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), forgestorm_ignited, elemental_chaos_air
0:10.925 single J windstrike Fluffy_Pillow 45080.0/50000: 90% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), forgestorm_ignited, elemental_chaos_air
0:11.766 single N flame_shock Fluffy_Pillow 46425.6/50000: 93% mana bloodlust, berserking, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), forgestorm_ignited, elemental_chaos_air
0:12.608 single Q elemental_blast Fluffy_Pillow 47022.8/50000: 94% mana bloodlust, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), forgestorm_ignited, elemental_chaos_air
0:13.531 single S stormstrike Fluffy_Pillow 47124.6/50000: 94% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(5), forgestorm_ignited, elemental_chaos_air
0:14.455 single T ice_strike Fluffy_Pillow 47603.0/50000: 95% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, crumbling_power(4), forgestorm_ignited, elemental_chaos_air
0:15.379 single U lava_lash Fluffy_Pillow 47431.4/50000: 95% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, crumbling_power(3), forgestorm_ignited, elemental_chaos_air
0:16.303 single W sundering Fluffy_Pillow 48509.8/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power(2), forgestorm_ignited, elemental_chaos_air
0:17.228 single X frost_shock Fluffy_Pillow 46989.8/50000: 94% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, crumbling_power, elemental_chaos_air
0:18.154 single S stormstrike Fluffy_Pillow 47971.4/50000: 96% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_air
0:19.077 single Q elemental_blast Fluffy_Pillow 48448.2/50000: 97% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(8), elemental_chaos_air
0:20.002 single S stormstrike Fluffy_Pillow 48553.2/50000: 97% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_air
0:20.927 single P stormstrike Fluffy_Pillow 49033.2/50000: 98% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_air
0:21.853 single V lightning_bolt Fluffy_Pillow 49514.8/50000: 99% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_air
0:22.778 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
0:23.701 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
0:24.624 single U lava_lash Fluffy_Pillow 49826.8/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon, ice_strike, elemental_chaos_air
0:25.549 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon, ice_strike, elemental_chaos_air
0:26.474 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(7), ice_strike, elemental_chaos_air
0:27.399 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
0:28.298 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
0:29.197 single Y earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
0:30.095 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
0:30.994 Waiting     0.109 sec 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
0:31.103 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
0:32.143 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_air
0:33.042 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_air
0:33.939 single P stormstrike Fluffy_Pillow 49785.2/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), ice_strike, elemental_chaos_air
0:34.836 single R lightning_bolt Fluffy_Pillow 47220.4/50000: 94% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), ice_strike, elemental_chaos_air
0:35.733 single S stormstrike Fluffy_Pillow 48155.6/50000: 96% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
0:36.630 single U lava_lash Fluffy_Pillow 44590.8/50000: 89% mana bloodlust, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
0:37.556 single X frost_shock Fluffy_Pillow 45672.4/50000: 91% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
0:38.481 single Z flame_shock Fluffy_Pillow 46652.4/50000: 93% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
0:39.405 Waiting     0.762 sec 47380.8/50000: 95% mana bloodlust, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
0:40.167 single S stormstrike Fluffy_Pillow 48600.0/50000: 97% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_air
0:41.605 single P stormstrike Fluffy_Pillow 49900.8/50000: 100% mana flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(8), elemental_chaos_air
0:42.806 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), elemental_chaos_air
0:44.006 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_air
0:45.206 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_air
0:46.406 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:47.607 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_air
0:48.804 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(4), sophic_devotion, elemental_chaos_air
0:50.004 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(4), sophic_devotion, elemental_chaos_air
0:51.204 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(5), sophic_devotion, elemental_chaos_air
0:52.404 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, forceful_winds, sophic_devotion, elemental_chaos_air
0:53.603 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, sophic_devotion, elemental_chaos_air
0:54.804 Waiting     0.946 sec 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds, sophic_devotion, elemental_chaos_air
0:55.750 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds, sophic_devotion, elemental_chaos_air
0:57.188 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon, sophic_devotion, elemental_chaos_air
0:58.389 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon, ice_strike, sophic_devotion, elemental_chaos_air
0:59.589 single U lava_lash Fluffy_Pillow 48920.0/50000: 98% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(2), ice_strike, sophic_devotion, elemental_chaos_air
1:00.790 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, maelstrom_weapon(2), ice_strike, elemental_chaos_earth
1:02.030 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, maelstrom_weapon(2), elemental_chaos_earth
1:03.270 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(3), elemental_chaos_earth
1:04.509 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_earth
1:05.748 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_earth
1:06.986 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_earth
1:08.224 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth
1:09.462 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_earth
1:10.699 single P stormstrike Fluffy_Pillow 49979.2/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, elemental_chaos_earth
1:11.940 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_earth
1:13.176 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, elemental_chaos_earth
1:14.414 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_earth
1:15.652 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_earth
1:16.890 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_chaos_earth
1:18.130 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:19.368 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:20.606 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:21.844 single X frost_shock Fluffy_Pillow 49980.8/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:23.084 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
1:24.508 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_earth
1:25.849 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), elemental_chaos_earth
1:27.087 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, elemental_chaos_earth
1:28.325 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), elemental_chaos_earth
1:29.564 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_earth
1:30.802 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, elemental_chaos_earth
1:32.079 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), doom_winds_talent, ice_strike, elemental_chaos_earth
1:33.319 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), doom_winds_talent, ice_strike, elemental_chaos_earth
1:34.557 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), doom_winds_talent, ice_strike, elemental_chaos_earth
1:35.798 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds_talent, ice_strike, elemental_chaos_earth
1:37.035 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, elemental_chaos_earth
1:38.273 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:39.511 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:40.749 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:41.988 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds, maelstrom_weapon(8), legacy_of_the_frost_witch, elemental_chaos_earth
1:43.227 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, elemental_chaos_earth
1:44.466 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
1:45.703 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
1:46.941 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:48.181 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:49.419 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:50.658 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:51.897 single Q elemental_blast Fluffy_Pillow 48982.4/50000: 98% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:53.136 single P stormstrike Fluffy_Pillow 49589.8/50000: 99% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:54.339 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, elemental_chaos_earth
1:55.541 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_earth
1:56.742 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_earth
1:57.944 single T ice_strike Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(7), sophic_devotion_oh, elemental_chaos_earth
1:59.146 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), maelstrom_weapon(8), ice_strike, sophic_devotion_oh, elemental_chaos_earth
2:00.349 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(10), ice_strike, sophic_devotion_oh, elemental_chaos_frost
2:01.550 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion_oh, elemental_chaos_frost
2:02.753 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(3), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds, sophic_devotion_oh, elemental_chaos_frost
2:03.991 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion_oh, elemental_chaos_frost
2:05.230 Waiting     2.248 sec 50000.0/50000: 100% mana flurry, forceful_winds(3), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(3), sophic_devotion_oh, elemental_chaos_frost
2:07.478 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(3), maelstrom_weapon, spiraling_winds(4), sophic_devotion_oh, elemental_chaos_frost
2:08.949 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(5), maelstrom_weapon(5), spiraling_winds(5), sophic_devotion_oh, elemental_chaos_frost
2:10.189 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(5), legacy_of_the_frost_witch, spiraling_winds(5), sophic_devotion_oh, elemental_chaos_frost
2:11.425 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_frost
2:12.663 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_frost
2:13.903 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_frost
2:15.142 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds(8), elemental_chaos_frost
2:16.381 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, ice_strike, spiraling_winds(8), forgestorm_ignited, elemental_chaos_frost
2:17.619 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(2), ice_strike, spiraling_winds(9), forgestorm_ignited, elemental_chaos_frost
2:18.860 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), ice_strike, spiraling_winds(9), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
2:20.097 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
2:21.336 Waiting     0.380 sec 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(4), spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
2:21.716 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(5), spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
2:22.954 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
2:24.193 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
2:25.431 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
2:26.669 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
2:27.908 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(3), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
2:29.145 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:30.384 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:31.623 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:32.862 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ice_strike, sophic_devotion, elemental_chaos_frost
2:34.099 single P stormstrike Fluffy_Pillow 48979.2/50000: 98% mana elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon, ice_strike, elemental_chaos_frost
2:35.336 single J windstrike Fluffy_Pillow 49958.4/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(4), static_accumulation, ice_strike, elemental_chaos_frost
2:36.576 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(3), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:37.815 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), forceful_winds(3), stormbringer, maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
2:39.053 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, forceful_winds(4), maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:40.292 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:41.532 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:42.734 single T ice_strike Fluffy_Pillow 49923.2/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:43.936 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:45.140 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:46.343 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:47.546 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:48.749 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:49.950 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:51.154 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(5), static_accumulation, ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:52.393 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:53.631 single V lightning_bolt Fluffy_Pillow 47980.8/50000: 96% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:54.869 default F feral_spirit Fluffy_Pillow 49461.6/50000: 99% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:56.291 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), spiraling_winds, sophic_devotion, elemental_chaos_frost
2:57.529 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), ice_strike, spiraling_winds, sophic_devotion, elemental_chaos_frost
2:58.767 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), ice_strike, spiraling_winds(2), sophic_devotion, elemental_chaos_frost
3:00.007 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, spiraling_winds(2), sophic_devotion, elemental_chaos_frost
3:00.007 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, crumbling_power(20), spiraling_winds(2), sophic_devotion, elemental_chaos_frost
3:00.007 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, crumbling_power(20), spiraling_winds(2), sophic_devotion, elemental_chaos_frost
3:01.133 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(3), sophic_devotion, elemental_chaos_frost
3:02.258 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(19), spiraling_winds(4), sophic_devotion, elemental_chaos_frost
3:03.384 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(18), spiraling_winds(4), sophic_devotion, elemental_chaos_frost
3:04.511 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(17), spiraling_winds(5), elemental_chaos_frost
3:05.638 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(16), spiraling_winds(5), elemental_chaos_frost
3:06.762 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), spiraling_winds(6), elemental_chaos_frost
3:07.890 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), spiraling_winds(6), elemental_chaos_frost
3:09.018 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(10), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(13), spiraling_winds(7), elemental_chaos_frost
3:10.145 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, crumbling_power(12), spiraling_winds(8), elemental_chaos_frost
3:11.271 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), legacy_of_the_frost_witch, crumbling_power(11), spiraling_winds(8), forgestorm_ignited, elemental_chaos_frost
3:12.397 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(10), spiraling_winds(9), forgestorm_ignited, elemental_chaos_frost
3:13.636 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, crumbling_power(9), spiraling_winds(9), forgestorm_ignited, elemental_chaos_frost
3:14.874 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, crumbling_power(8), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:16.112 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), legacy_of_the_frost_witch, crumbling_power(7), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:17.349 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(6), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:18.588 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(5), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:19.827 single T ice_strike Fluffy_Pillow 49982.4/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, crumbling_power(4), spiraling_winds(10), forgestorm_ignited, elemental_chaos_frost
3:21.065 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, forgestorm_ignited, elemental_chaos_frost
3:22.303 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), ice_strike, elemental_chaos_frost
3:23.542 single X frost_shock Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), elemental_blast_mastery, maelstrom_weapon, ice_strike, elemental_chaos_frost
3:24.781 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, maelstrom_weapon, elemental_chaos_frost
3:26.020 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), maelstrom_weapon(3), elemental_chaos_frost
3:27.258 Waiting     0.997 sec 50000.0/50000: 100% mana flurry, maelstrom_weapon(3), elemental_chaos_frost
3:28.255 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(3), elemental_chaos_frost
3:29.696 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(4), elemental_chaos_frost
3:30.933 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_weapon(4), elemental_chaos_frost
3:32.192 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana stormbringer, maelstrom_weapon(6), elemental_chaos_frost
3:33.431 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds, maelstrom_weapon(8), elemental_chaos_frost
3:34.670 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:35.908 default F feral_spirit Fluffy_Pillow 49980.8/50000: 100% mana elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:37.147 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:38.385 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:39.623 single P stormstrike Fluffy_Pillow 49980.8/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:40.860 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:42.099 single P stormstrike Fluffy_Pillow 48982.4/50000: 98% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:43.337 single R lightning_bolt Fluffy_Pillow 49963.2/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), sophic_devotion, elemental_chaos_frost
3:44.576 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:45.815 single P stormstrike Fluffy_Pillow 48982.4/50000: 98% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:47.053 single O lava_lash Fluffy_Pillow 49963.2/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:48.290 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:49.527 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(10), sophic_devotion_oh, elemental_chaos_frost
3:50.766 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
3:51.970 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
3:53.172 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
3:54.374 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
3:55.578 Waiting     0.989 sec 50000.0/50000: 100% mana flurry, elemental_blast_haste, maelstrom_weapon(3), sophic_devotion_oh, elemental_chaos_frost
3:56.567 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_frost
3:57.960 single V lightning_bolt Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(5), sophic_devotion_oh, elemental_chaos_frost
3:59.161 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(2), sophic_devotion_oh, elemental_chaos_frost
4:00.362 single X frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_weapon, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:01.600 single Z flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(3), maelstrom_weapon, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:02.839 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(3), maelstrom_weapon, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:04.079 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(3), sophic_devotion, elemental_chaos_earth
4:05.318 single J windstrike Fluffy_Pillow 49982.4/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, sophic_devotion, elemental_chaos_earth
4:06.555 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:07.794 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:09.034 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:10.274 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:11.512 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:12.752 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:13.990 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:15.228 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:16.466 single W sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, sophic_devotion, elemental_chaos_earth
4:17.703 single S stormstrike Fluffy_Pillow 48979.2/50000: 98% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), ice_strike, sophic_devotion, elemental_chaos_earth
4:18.943 single X frost_shock Fluffy_Pillow 48963.2/50000: 98% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_earth
4:20.183 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, forceful_winds(2), maelstrom_weapon(5), spiraling_winds, sophic_devotion, elemental_chaos_earth
4:21.421 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), legacy_of_the_frost_witch, spiraling_winds(2), sophic_devotion, elemental_chaos_earth
4:22.660 default F feral_spirit Fluffy_Pillow 48982.4/50000: 98% mana ascendance, flurry, elemental_blast_critical_strike, forceful_winds(4), stormbringer, maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(2), elemental_chaos_earth
4:23.898 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_earth
4:25.136 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(3), elemental_chaos_earth
4:26.375 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(4), elemental_chaos_earth
4:27.613 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth
4:28.850 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(5), elemental_chaos_earth
4:30.089 default B potion Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth
4:30.089 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:31.328 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(6), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:32.568 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, spiraling_winds(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:33.805 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:35.042 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(4), stormbringer, maelstrom_weapon(10), doom_winds_talent, legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:36.281 single J windstrike Fluffy_Pillow 49982.4/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, spiraling_winds(9), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:37.519 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:38.759 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:39.997 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:41.236 single N flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:42.475 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:43.714 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
4:44.953 default F feral_spirit Fluffy_Pillow 48982.4/50000: 98% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:46.191 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:47.428 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(4), stormbringer, maelstrom_weapon(9), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:48.667 single Q elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(8), static_accumulation, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:49.905 single S stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:51.143 single P stormstrike Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:52.383 single T ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:53.621 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(10), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:54.859 single O lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:56.098 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:57.333 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:58.573 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:59.812 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 21.51% 21.51% 3656
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 59.31% 52.07% 3246
Armor 3603 3603 3603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Gamba"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBK
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/stormstrike,if=talent.stormflurry.enabled&buff.stormbringer.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant_id=6495
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant_id=6555
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant_id=6555
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

PR_Shaman_Enhancement_Phys : 46701 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
46700.7 46700.7 49.9 / 0.107% 8608.2 / 18.4% 51.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
851.8 848.8 Mana 1.87% 52.1 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
PR_Shaman_Enhancement_Phys 46701
Ascendance 0 (352) 0.0% (0.7%) 2.0 180.42sec 52064 48096

Stats Details: Ascendance

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 1.0827 0.0000 0.00 0.00 0.00% 48096.30 48096.30

Action Details: Ascendance

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]

Action Priority List

    default
    [G]:2.00
  • if_expr:(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
    Ascendance (_damage) 352 0.7% 2.0 180.42sec 52064 0 Direct 2.0 43797 87998 52064 18.7% 0.0%

Stats Details: Ascendance Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.00 0.0000 0.0000 104128.49 104128.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.30% 1.63 0 2 43796.93 38272 56262 42147.17 0 56262 71212 71212 0.00%
crit 18.70% 0.37 0 2 87998.37 76545 112524 29605.77 0 112524 32916 32916 0.00%

Action Details: Ascendance Damage

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Doom Winds 82 0.2% 3.7 90.47sec 6582 6016 Direct 3.7 6582 0 6582 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0940 0.0000 24498.99 34999.45 30.00% 6016.45 6016.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.72 3 4 6581.65 3838 10609 6603.56 5375 8488 24499 34999 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [H]:3.72
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 6744 14.5% 24.7 11.70sec 81812 68998 Direct 24.7 67489 135576 81850 21.1% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.74 24.73 0.00 0.00 0.00 1.1857 0.0000 2023836.10 2023836.10 0.00% 68997.55 68997.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.91% 19.51 9 29 67488.90 45017 144522 67467.77 55256 80524 1316804 1316804 0.00%
crit 21.09% 5.22 0 13 135575.54 90033 265312 135042.42 0 217741 707032 707032 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [R]:24.74
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 1547 3.3% 32.5 8.94sec 14300 29218 Direct 32.5 2777 5580 3261 17.3% 0.0%
Periodic 183.1 1667 3344 1958 17.4% 0.0% 95.5%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 32.47 32.47 183.06 183.06 31.31 0.4895 1.5646 464383.51 464383.51 0.00% 1536.04 29217.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 26.87 12 42 2777.18 2342 4943 2776.74 2544 3144 74616 74616 0.00%
crit 17.27% 5.61 0 15 5580.13 4685 9668 5558.70 0 7907 31286 31286 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.62% 151.25 105 196 1666.78 2 2946 1666.42 1529 1874 252104 252104 0.00%
crit 17.38% 31.81 11 59 3343.83 12 5968 3343.77 3000 3794 106377 106377 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [O]:1.17
  • if_expr:!ticking
    single
    [a]:12.36
Flametongue Weapon 0 (1533) 0.0% (3.3%) 1.0 0.00sec 459197 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1533 3.3% 1090.2 0.68sec 421 0 Direct 1090.2 359 720 421 17.2% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1090.22 1090.22 0.00 0.00 0.00 0.0000 0.0000 459197.17 459197.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.78% 902.47 630 1200 359.10 290 614 359.22 334 406 324078 324078 0.00%
crit 17.22% 187.76 115 284 719.65 580 1218 719.97 664 809 135120 135120 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Forgestorm Ignited (_damage) 1108 2.4% 28.9 7.56sec 11525 0 Direct 28.9 9805 19713 11525 17.4% 0.0%

Stats Details: Forgestorm Ignited Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.86 28.86 0.00 0.00 0.00 0.0000 0.0000 332644.96 332644.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 23.85 1 68 9805.35 9732 10030 9806.10 9732 10030 233902 233902 0.00%
crit 17.35% 5.01 0 19 19713.38 19463 20059 19295.71 0 20059 98743 98743 0.00%

Action Details: Forgestorm Ignited Damage

  • id:381700
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8107.22
  • base_dd_max:8107.22
  • base_dd_mult:1.00

Spelldata

  • id:381700
  • name:Forgestorm Ignited
  • school:fire
  • tooltip:
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
Frost Shock 1204 2.6% 19.6 14.09sec 18455 15537 Direct 19.6 15701 31529 18455 17.4% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.59 19.59 0.00 0.00 0.00 1.1878 0.0000 361577.04 361577.04 0.00% 15537.00 15537.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.60% 16.18 5 29 15700.72 7567 31528 15738.10 12750 19318 254104 254104 0.00%
crit 17.40% 3.41 0 13 31529.35 15135 59630 30660.41 0 50112 107473 107473 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [Y]:19.59
Ice Strike 1494 3.2% 21.1 14.23sec 21257 18201 Direct 21.1 18089 36249 21257 17.4% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.08 21.08 0.00 0.00 0.00 1.1679 0.0000 448056.51 448056.51 0.00% 18201.10 18201.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 17.40 7 26 18089.43 15041 30827 18084.08 16108 20211 314773 314773 0.00%
crit 17.44% 3.68 0 12 36249.32 30081 59841 35634.59 0 53026 133284 133284 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [M]:2.38
  • if_expr:buff.doom_winds_talent.up
    single
    [U]:18.70
Lava Lash 1390 3.0% 18.9 15.09sec 22032 18589 Direct 18.9 18728 37583 22032 17.5% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.94 18.94 0.00 0.00 0.00 1.1853 0.0000 417346.46 417346.46 0.00% 18589.21 18589.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.48% 15.62 7 24 18728.15 15840 32466 18718.19 16826 21188 292584 292584 0.00%
crit 17.52% 3.32 0 12 37582.74 31680 61582 36442.66 0 52260 124762 124762 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [P]:2.67
  • if_expr:dot.flame_shock.refreshable
    single
    [V]:16.27
Lightning Bolt 2975 6.4% 17.8 15.71sec 50160 42564 Direct 17.8 41193 82593 50160 21.7% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.82 17.82 0.00 0.00 0.00 1.1785 0.0000 893968.75 893968.75 0.00% 42563.86 42563.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.34% 13.96 4 25 41193.31 28471 91404 41197.81 33139 52554 575147 575147 0.00%
crit 21.66% 3.86 0 12 82593.34 56942 174494 81135.05 0 139613 318822 318822 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [S]:3.83
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [W]:13.99
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 1467 3.2% 172.2 1.93sec 2560 1438 Direct 172.2 2531 5086 2560 17.3% 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 172.17 172.17 0.00 0.00 0.00 1.7803 0.0000 440772.20 629690.62 30.00% 1438.06 1438.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.31% 114.17 72 163 2530.53 2204 4445 2529.29 2320 2803 288900 412725 30.00%
crit 17.34% 29.86 7 56 5086.39 4408 8778 5083.84 4568 5699 151872 216966 30.00%
miss 16.35% 28.14 7 51 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
offhand 743 1.6% 173.8 2.01sec 1285 722 Direct 173.8 1270 2554 1285 17.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 173.80 173.80 0.00 0.00 0.00 1.7797 0.0000 223342.89 319069.41 30.00% 722.09 722.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 66.28% 115.20 67 164 1269.77 1102 2195 1269.27 1156 1419 146274 208969 30.00%
crit 17.36% 30.18 11 55 2553.68 2204 4344 2552.31 2266 2871 77069 110101 30.00%
miss 16.35% 28.42 11 53 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (7243) 0.0% (15.6%) 90.0 3.16sec 24200 20400

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 89.95 0.00 0.00 0.00 0.00 1.1863 0.0000 0.00 0.00 0.00% 20400.16 20400.16

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [L]:5.67
  • if_expr:buff.doom_winds_talent.up
    single
    [Q]:44.21
  • if_expr:talent.stormflurry.enabled&buff.stormbringer.up
    single
    [T]:40.08
    Stormstrike (_mh) 3921 (4829) 8.4% (10.4%) 120.0 3.16sec 12093 0 Direct 120.0 (178.8) 8354 16800 9818 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.02 120.02 0.00 0.00 0.00 0.0000 0.0000 1178383.05 1683447.28 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 99.21 52 162 8354.24 2743 21205 8366.02 7252 9817 828852 1184105 30.00%
crit 17.33% 20.81 4 47 16800.34 5486 41706 16819.54 11427 22350 349531 499342 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_mh) 908 2.0% 58.8 5.39sec 4642 0 Direct 58.8 4642 0 4642 0.0% 0.0%

Stats Details: Stormblast Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.81 58.81 0.00 0.00 0.00 0.0000 0.0000 272964.51 272964.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 58.81 24 119 4641.74 1205 18642 4650.06 3502 6162 272965 272965 0.00%

Action Details: Stormblast Stormstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Stormstrike Off-Hand 1961 (2414) 4.2% (5.2%) 120.0 3.16sec 6045 0 Direct 120.0 (178.8) 4176 8407 4908 17.3% (11.6%) 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.02 120.02 0.00 0.00 0.00 0.0000 0.0000 589107.84 841604.09 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 99.25 55 151 4176.38 1372 10602 4182.10 3591 4955 414502 592160 30.00%
crit 17.31% 20.77 4 42 8406.97 2743 20667 8417.78 4816 11567 174606 249444 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=true}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
        Stormblast (_stormstrike_offhand) 454 1.0% 58.8 5.39sec 2320 0 Direct 58.8 2320 0 2320 0.0% 0.0%

Stats Details: Stormblast Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.81 58.81 0.00 0.00 0.00 0.0000 0.0000 136404.43 136404.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 58.81 24 119 2319.58 602 9320 2324.34 1794 3107 136404 136404 0.00%

Action Details: Stormblast Stormstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
Sundering 1036 2.2% 6.5 46.92sec 47709 40818 Direct 6.5 40599 81375 47707 17.4% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.51 6.51 0.00 0.00 0.00 1.1689 0.0000 310745.97 310745.97 0.00% 40817.81 40817.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 5.38 0 9 40598.80 26739 86345 40589.88 0 57300 218335 218335 0.00%
crit 17.44% 1.14 0 6 81375.22 53478 152517 56975.08 0 143850 92410 92410 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [N]:0.79
  • if_expr:buff.doom_winds_talent.up
    single
    [X]:5.72
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (7274) 0.0% (15.6%) 1.0 0.00sec 2174364 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 7274 15.6% 410.9 2.45sec 5292 0 Direct 410.9 4522 9019 5292 17.1% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 410.85 410.85 0.00 0.00 0.00 0.0000 0.0000 2174363.94 3106313.40 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.86% 340.44 207 499 4521.58 1488 11725 4526.35 3964 5526 1539286 2199036 30.00%
crit 17.14% 70.42 33 129 9019.02 2976 23450 9026.95 7351 11729 635078 907278 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 454 1.0% 24.0 10.21sec 5603 4126 Direct 24.0 4626 9313 5603 20.8% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.99 23.99 0.00 0.00 0.00 1.3581 0.0000 134433.90 134433.90 0.00% 4125.89 4125.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.15% 18.99 9 29 4625.91 3540 6270 4626.57 4196 5502 87845 87845 0.00%
crit 20.85% 5.00 0 14 9313.48 7080 12540 9265.33 0 12010 46589 46589 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 239 0.5% 25.2 9.69sec 2805 2053 Direct 25.2 2319 4660 2804 20.7% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.21 25.21 0.00 0.00 0.00 1.3663 0.0000 70695.32 70695.32 0.00% 2052.65 2052.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.26% 19.98 9 30 2319.05 1770 3135 2319.12 2113 2733 46333 46333 0.00%
crit 20.74% 5.23 0 15 4659.85 3618 6270 4644.92 0 5886 24362 24362 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (7009) 0.0% (14.8%) 20.3 9.99sec 102283 104079

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.28 0.00 0.00 0.00 0.00 0.9828 0.0000 0.00 0.00 0.00% 104078.86 104078.86

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [K]:20.28
    Windstrike (_mh) 1936 (2370) 4.1% (5.0%) 27.1 9.99sec 25886 0 Direct 27.1 (38.7) 18123 36286 21140 16.6% (11.6%) 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.10 27.10 0.00 0.00 0.00 0.0000 0.0000 572880.88 572880.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.39% 22.60 7 38 18123.20 5341 33514 18239.87 14158 23771 409535 409535 0.00%
crit 16.61% 4.50 0 13 36286.16 10757 63942 36175.55 0 59681 163346 163346 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_mh) 435 0.9% 11.6 17.81sec 11045 0 Direct 11.6 11045 0 11045 0.0% 0.0%

Stats Details: Stormblast Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.64 11.64 0.00 0.00 0.00 0.0000 0.0000 128617.14 128617.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.64 2 20 11045.14 3392 28778 11027.54 8164 17052 128617 128617 0.00%

Action Details: Stormblast Windstrike Mh

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Windstrike Off-Hand 968 (1185) 2.1% (2.5%) 27.1 9.99sec 12942 0 Direct 27.1 (38.7) 9053 18230 10574 16.6% (11.6%) 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.10 27.10 0.00 0.00 0.00 0.0000 0.0000 286553.00 286553.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.42% 22.61 10 38 9053.00 2670 16757 9109.01 6284 12128 204658 204658 0.00%
crit 16.58% 4.49 0 14 18230.40 5475 32757 18132.97 0 32460 81895 81895 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
        Stormblast (_windstrike_offhand) 217 0.5% 11.6 17.81sec 5510 0 Direct 11.6 5510 0 5510 0.0% 0.0%

Stats Details: Stormblast Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.64 11.64 0.00 0.00 0.00 0.0000 0.0000 64168.24 64168.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 11.64 2 20 5510.48 1697 14383 5502.96 3916 8887 64168 64168 0.00%

Action Details: Stormblast Windstrike Offhand

  • id:390287
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:390287
  • name:Stormblast
  • school:nature
  • tooltip:
  • description:{$@spelldesc319930=Stormbringer now also causes your next Stormstrike to deal {$s1=25}% additional damage as Nature damage.}
    Lightning Bolt (_ti) 3454 7.3% 20.3 10.00sec 50422 0 Direct 20.3 41711 83730 50422 20.7% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.27 20.27 0.00 0.00 0.00 0.0000 0.0000 1022280.51 1022280.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.27% 16.07 6 24 41711.41 18967 60196 41706.34 35924 49376 670367 670367 0.00%
crit 20.73% 4.20 0 13 83730.14 39741 118819 82977.76 0 105925 351913 351913 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 415 / 86
melee 415 0.2% 39.4 2.41sec 651 422 Direct 39.4 555 1109 651 17.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.44 39.44 0.00 0.00 0.00 1.5445 0.0000 25677.81 36683.52 30.00% 421.54 421.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 32.60 21 58 555.05 490 816 554.43 490 683 18094 25850 30.00%
crit 17.34% 6.84 0 19 1108.85 980 1631 1107.06 0 1437 7583 10834 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 4349 / 2719
melee 4349 5.8% 343.8 1.73sec 2365 2109 Direct 343.8 2019 4028 2365 17.2% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 343.75 343.75 0.00 0.00 0.00 1.1214 0.0000 813074.35 1161564.40 30.00% 2109.25 2109.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 284.47 195 362 2018.81 1660 3306 2019.40 1874 2267 574278 820417 30.00%
crit 17.25% 59.29 32 96 4027.95 3321 6611 4029.57 3650 4606 238797 341147 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
PR_Shaman_Enhancement_Phys
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.70sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 306.32sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.15 0.00 0.00 0.00 0.00 1.0098 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [Z]:1.15
Feral Spirit 13.6 23.92sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.57 0.00 0.00 0.00 0.00 1.1412 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:13.57
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:PR_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.5 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.50
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 95.61% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 182.5s
  • trigger_min/max:180.0s / 182.5s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • ascendance_1:10.14%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 180.7sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.2s / 182.8s
  • trigger_min/max:180.2s / 182.8s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crumbling Power 2.0 0.0 180.6sec 5.5sec 18.8sec 12.74% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_crumbling_power
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:150.05

Trigger Details

  • interval_min/max:180.0s / 181.5s
  • trigger_min/max:0.0s / 164.2s
  • trigger_pct:100.00%
  • duration_min/max:17.1s / 20.0s

Stack Uptimes

  • crumbling_power_1:0.32%
  • crumbling_power_2:0.32%
  • crumbling_power_3:0.44%
  • crumbling_power_4:0.72%
  • crumbling_power_5:0.70%
  • crumbling_power_6:0.70%
  • crumbling_power_7:0.70%
  • crumbling_power_8:0.68%
  • crumbling_power_9:0.67%
  • crumbling_power_10:0.67%
  • crumbling_power_11:0.67%
  • crumbling_power_12:0.67%
  • crumbling_power_13:0.67%
  • crumbling_power_14:0.67%
  • crumbling_power_15:0.67%
  • crumbling_power_16:0.67%
  • crumbling_power_17:0.71%
  • crumbling_power_18:1.24%
  • crumbling_power_19:0.84%
  • crumbling_power_20:0.02%

Spelldata

  • id:383941
  • name:Crumbling Power
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Gain the Titans' crumbling power, increasing {$=}pri by {$=}{$s3*{$u=20}}, reduced each time you use an ability. Lasts {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Doom Winds (_talent) 3.7 0.0 90.5sec 90.5sec 7.9sec 9.85% 12.48% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_doom_winds_talent
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.5s
  • trigger_min/max:90.0s / 92.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_talent_1:9.85%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 13.6 0.0 25.8sec 22.8sec 17.4sec 62.53% 100.00% 0.0 (0.0) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.1s / 69.9s
  • trigger_min/max:6.1s / 45.4s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 54.9s

Stack Uptimes

  • earthen_weapon_2:58.46%
  • earthen_weapon_4:4.07%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.3 1.0 37.5sec 32.6sec 10.8sec 26.10% 0.00% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 259.8s
  • trigger_min/max:0.9s / 253.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.0s

Stack Uptimes

  • elemental_blast_critical_strike_1:26.10%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.3 0.9 37.4sec 32.7sec 10.7sec 25.98% 0.00% 0.9 (0.9) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 275.3s
  • trigger_min/max:0.9s / 275.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.3s

Stack Uptimes

  • elemental_blast_haste_1:25.98%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.3 1.0 37.3sec 32.5sec 10.8sec 26.20% 0.00% 1.0 (1.0) 7.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 254.2s
  • trigger_min/max:0.9s / 254.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.7s

Stack Uptimes

  • elemental_blast_mastery_1:26.20%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 125.9sec 100.1sec 57.9sec 24.59% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:24.59%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 122.2sec 97.6sec 58.8sec 25.59% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 344.7s

Stack Uptimes

  • elemental_chaos_earth_1:25.59%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 123.1sec 98.3sec 58.1sec 24.95% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 328.5s

Stack Uptimes

  • elemental_chaos_fire_1:24.95%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.9sec 98.8sec 57.8sec 24.87% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 341.7s

Stack Uptimes

  • elemental_chaos_frost_1:24.87%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 308.0sec 0.0sec 27.4sec 13.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 331.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.41%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 10.7 2.8 29.3sec 23.9sec 17.4sec 62.53% 0.00% 53.5 (53.5) 10.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 69.9s
  • trigger_min/max:6.5s / 45.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.9s

Stack Uptimes

  • feral_spirit_1:62.53%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 43.8 369.3 6.9sec 0.7sec 5.8sec 84.18% 90.48% 369.3 (875.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 61.8s
  • trigger_min/max:0.0s / 15.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.4s

Stack Uptimes

  • flurry_1:20.14%
  • flurry_2:33.24%
  • flurry_3:30.80%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.2 119.7 17.8sec 2.2sec 14.6sec 84.08% 100.00% 58.1 (58.1) 16.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 48.2s
  • trigger_min/max:0.0s / 37.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:15.22%
  • forceful_winds_2:14.30%
  • forceful_winds_3:12.72%
  • forceful_winds_4:10.56%
  • forceful_winds_5:31.28%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forgestorm Ignited 4.5 0.9 57.0sec 46.0sec 13.0sec 19.55% 0.00% 0.9 (0.9) 4.3

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_forgestorm_ignited
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:20.00
  • modifier:1.00

Trigger Details

  • interval_min/max:12.0s / 211.1s
  • trigger_min/max:0.2s / 211.1s
  • trigger_pct:98.76%
  • duration_min/max:0.0s / 54.9s

Stack Uptimes

  • forgestorm_ignited_1:19.55%

Spelldata

  • id:381699
  • name:Forgestorm Ignited
  • tooltip:Your attacks have a very high chance to explode for {$=}w1 Fire damage split between all nearby enemies.
  • description:{$@spelldesc381698=Your attacks have a chance to ignite Forgestorm for {$381699d=12 seconds}, causing your attacks to explode for {$s1=5962} Fire damage split between all nearby enemies. Damage is increased for each enemy struck, up to {$s2=5} enemies.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 20.3 0.8 14.8sec 14.2sec 7.1sec 48.31% 77.28% 0.8 (0.8) 4.8

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.9s / 63.1s
  • trigger_min/max:8.4s / 63.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.4s

Stack Uptimes

  • ice_strike_1:48.31%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=false}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 24.0 16.2 12.6sec 7.4sec 7.1sec 56.91% 0.00% 16.2 (16.2) 23.4

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 53.3s
  • trigger_min/max:0.8s / 35.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.9s

Stack Uptimes

  • legacy_of_the_frost_witch_1:56.91%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom Weapon 46.4 383.4 6.5sec 1.4sec 5.5sec 85.61% 100.00% 46.0 (50.1) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 36.3s
  • trigger_min/max:0.0s / 9.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.1s

Stack Uptimes

  • maelstrom_weapon_1:9.55%
  • maelstrom_weapon_2:11.13%
  • maelstrom_weapon_3:12.86%
  • maelstrom_weapon_4:13.56%
  • maelstrom_weapon_5:8.68%
  • maelstrom_weapon_6:7.10%
  • maelstrom_weapon_7:5.30%
  • maelstrom_weapon_8:4.36%
  • maelstrom_weapon_9:3.53%
  • maelstrom_weapon_10:9.54%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.5sec 45.9sec 16.5sec 23.42% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 204.2s
  • trigger_min/max:0.0s / 204.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.6s

Stack Uptimes

  • sophic_devotion_1:23.42%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.2 60.9sec 45.6sec 16.5sec 23.73% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:857.25

Trigger Details

  • interval_min/max:15.0s / 211.5s
  • trigger_min/max:0.0s / 208.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.0s

Stack Uptimes

  • sophic_devotion_oh_1:23.73%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Spiraling Winds 3.6 1.9 75.8sec 45.4sec 32.2sec 38.62% 0.00% 26.0 (26.0) 3.2

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_spiraling_winds
  • max_stacks:10
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:agility
  • amount:106.51

Trigger Details

  • interval_min/max:25.0s / 251.7s
  • trigger_min/max:0.0s / 204.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.7s

Stack Uptimes

  • spiraling_winds_1:2.37%
  • spiraling_winds_2:2.34%
  • spiraling_winds_3:2.32%
  • spiraling_winds_4:2.31%
  • spiraling_winds_5:2.29%
  • spiraling_winds_6:2.28%
  • spiraling_winds_7:2.26%
  • spiraling_winds_8:2.24%
  • spiraling_winds_9:2.22%
  • spiraling_winds_10:18.00%

Spelldata

  • id:383756
  • name:Spiraling Winds
  • tooltip:Agility increased by {$=}w1.
  • description:{$@spelldesc383751=Your attacks have a chance to cause spiraling winds to surround you, increasing your Agility by {$s1=81} every {$383756t2=2} sec, stacking up to {$383756u=10} times before quickly dissipating. Lasts {$383756d=25 seconds}.}
  • max_stacks:10
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Static Accumulation 2.0 0.0 180.4sec 180.4sec 15.0sec 10.14% 100.00% 28.0 (28.0) 2.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:180.0s / 182.5s
  • trigger_min/max:180.0s / 182.5s
  • trigger_pct:100.00%
  • duration_min/max:15.0s / 15.0s

Stack Uptimes

  • static_accumulation_1:10.14%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 60.4 18.9 4.9sec 3.7sec 1.1sec 22.43% 54.37% 18.9 (18.9) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 74.6s
  • trigger_min/max:0.0s / 74.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.1s

Stack Uptimes

  • stormbringer_1:22.43%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=true}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=true}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 51.3 36.0 66.0 17.9s 15.0s 53.2s
Windfury-ForcefulWinds: 2 50.7 33.0 69.0 18.1s 0.8s 71.9s
Windfury-ForcefulWinds: 3 48.7 27.0 69.0 18.8s 1.1s 82.6s
Windfury-ForcefulWinds: 4 45.2 21.0 69.0 20.3s 1.0s 108.4s
Windfury-ForcefulWinds: 5 215.0 114.0 366.0 4.7s 0.0s 92.2s
windfury_totem_extra_attack_mh 27.8 10.0 55.0 10.6s 1.2s 119.0s
windfury_totem_extra_attack_oh 28.3 10.0 52.0 10.4s 0.1s 118.1s
Windfury: Unruly Winds 137.0 85.0 196.0 2.4s 0.0s 37.9s
Maelstrom Weapon: Feral Spirit 71.6 52.0 96.0 4.2s 0.0s 30.4s
Maelstrom Weapon: Elemental Assault 110.2 74.0 149.0 2.7s 0.8s 11.0s
Maelstrom Weapon: Static Accumulation 60.0 60.0 60.0 6.7s 1.0s 168.5s
Stormflurry 36.9 12.0 71.0 10.6s 0.8s 161.9s
Flametongue: Windfury Attack 410.9 255.0 588.0 2.4s 0.0s 37.9s
Stormbringer: Windfury Attack 43.3 17.0 76.0 7.8s 0.0s 121.2s
Maelstrom Weapon: Windfury Attack 82.1 42.0 136.0 4.7s 0.0s 70.6s
Flametongue: main_hand 144.0 97.0 197.0 2.5s 1.3s 29.0s
Maelstrom Weapon: main_hand 28.8 10.0 59.0 10.2s 1.3s 131.8s
Windfury: main_hand 49.0 22.0 80.0 6.3s 1.3s 88.6s
Flametongue: Windlash 24.0 19.0 32.0 10.2s 1.2s 170.6s
Maelstrom Weapon: Windlash 4.8 0.0 13.0 43.9s 1.2s 194.3s
Windfury: Windlash 16.3 10.0 25.0 14.7s 1.2s 176.7s
Flametongue: offhand 145.4 99.0 202.0 2.5s 1.3s 27.2s
Maelstrom Weapon: offhand 29.0 10.0 52.0 10.1s 1.3s 116.4s
Flametongue: Windlash Off-Hand 25.2 20.0 33.0 9.7s 1.2s 168.5s
Maelstrom Weapon: Windlash Off-Hand 5.1 0.0 13.0 41.8s 1.2s 193.7s
Flametongue: Sundering 6.5 4.0 9.0 46.9s 40.0s 128.3s
Stormbringer: Sundering 0.7 0.0 5.0 110.0s 40.0s 326.9s
Maelstrom Weapon: Sundering 1.3 0.0 6.0 101.5s 40.0s 338.5s
Windfury: Sundering 2.6 0.0 8.0 87.7s 40.0s 347.2s
Flametongue: Windstrike 27.1 17.0 45.0 10.0s 0.8s 171.5s
Stormbringer: Windstrike 2.8 0.0 12.0 58.2s 0.8s 193.6s
Maelstrom Weapon: Windstrike 5.4 0.0 16.0 40.4s 0.8s 192.9s
Windfury: Windstrike 19.1 9.0 33.0 13.7s 0.8s 178.1s
Flametongue: Windstrike Off-Hand 27.1 17.0 45.0 10.0s 0.8s 171.5s
Stormbringer: Windstrike Off-Hand 2.8 0.0 11.0 58.8s 0.8s 194.9s
Maelstrom Weapon: Windstrike Off-Hand 5.4 0.0 16.0 40.2s 0.8s 194.7s
Flametongue: Lava Lash 18.9 12.0 26.0 15.1s 8.9s 56.7s
Stormbringer: Lava Lash 2.0 0.0 9.0 74.5s 9.1s 331.7s
Maelstrom Weapon: Lava Lash 3.8 0.0 12.0 56.9s 9.0s 318.4s
Flametongue: Ice Strike 21.1 13.0 28.0 14.2s 8.4s 63.1s
Stormbringer: Ice Strike 2.2 0.0 9.0 75.3s 8.8s 320.1s
Maelstrom Weapon: Ice Strike 4.3 0.0 13.0 54.7s 9.0s 323.3s
Windfury: Ice Strike 8.1 0.0 18.0 36.3s 8.4s 321.4s
Flametongue: Stormstrike 120.0 68.0 187.0 3.2s 0.9s 27.4s
Stormbringer: Stormstrike 12.7 1.0 33.0 21.3s 0.9s 251.3s
Maelstrom Weapon: Stormstrike 24.0 6.0 52.0 12.3s 0.9s 137.4s
Windfury: Stormstrike 41.9 16.0 77.0 7.6s 0.9s 112.7s
Flametongue: Stormstrike Off-Hand 120.0 68.0 187.0 3.2s 0.9s 27.4s
Stormbringer: Stormstrike Off-Hand 12.7 1.0 33.0 21.3s 0.9s 235.7s
Maelstrom Weapon: Stormstrike Off-Hand 24.1 8.0 46.0 12.3s 0.9s 148.6s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 23.94% 17.12% 30.48% 0.7s 0.0s 18.3s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.8050.0011.4859.4233.26716.096
Ascendance0.5450.0012.4660.4210.0002.466
Doom Winds0.5840.0012.5051.2880.2095.039
Sundering7.3290.00188.32838.2061.280112.436
Windstrike0.8940.0013.73117.7228.97225.578
Lava Lash3.3420.00144.92358.19720.977122.947
Flame Shock17.1430.001182.574212.38692.620301.944
Ice Strike2.6490.00150.80250.91811.843111.560
Frost Shock9.7020.001153.720174.25988.414259.759
Elemental Blast3.1940.00118.7742.2380.00021.118
Stormstrike1.0520.0014.95890.41546.307141.568
Earth Elemental7.0090.00431.9710.9570.00031.971

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
PR_Shaman_Enhancement_Phys
mana_regenMana672.90254655.22100.00%378.44224743.8946.88%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 848.85 851.78 224744.8 49119.3 42044.8 50000.0
Usage Type Count Total Avg RPE APR
PR_Shaman_Enhancement_Phys
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 24.7434014.431375.001375.0059.50
Flame ShockMana 13.5310148.85750.00312.5245.76
Frost ShockMana 19.599796.43500.00500.0036.91
Ice StrikeMana 21.0834778.241650.001650.0012.88
Lava LashMana 18.947576.91400.00400.0055.08
Lightning BoltMana 17.828911.35500.00500.01100.32
StormstrikeMana 120.02120019.461000.001334.2718.14
SunderingMana 6.5119540.193000.003000.0015.90

Statistics & Data Analysis

Fight Length
PR_Shaman_Enhancement_Phys Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
PR_Shaman_Enhancement_Phys Damage Per Second
Count 7499
Mean 46700.69
Minimum 39884.04
Maximum 57149.07
Spread ( max - min ) 17265.03
Range [ ( max - min ) / 2 * 100% ] 18.48%
Standard Deviation 2203.0815
5th Percentile 43240.24
95th Percentile 50519.15
( 95th Percentile - 5th Percentile ) 7278.91
Mean Distribution
Standard Deviation 25.4407
95.00% Confidence Interval ( 46650.83 - 46750.55 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 86
0.1% Error 8549
0.1 Scale Factor Error with Delta=300 41433
0.05 Scale Factor Error with Delta=300 165732
0.01 Scale Factor Error with Delta=300 4143285
Priority Target DPS
PR_Shaman_Enhancement_Phys Priority Target Damage Per Second
Count 7499
Mean 46700.69
Minimum 39884.04
Maximum 57149.07
Spread ( max - min ) 17265.03
Range [ ( max - min ) / 2 * 100% ] 18.48%
Standard Deviation 2203.0815
5th Percentile 43240.24
95th Percentile 50519.15
( 95th Percentile - 5th Percentile ) 7278.91
Mean Distribution
Standard Deviation 25.4407
95.00% Confidence Interval ( 46650.83 - 46750.55 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 86
0.1% Error 8549
0.1 Scale Factor Error with Delta=300 41433
0.05 Scale Factor Error with Delta=300 165732
0.01 Scale Factor Error with Delta=300 4143285
DPS(e)
PR_Shaman_Enhancement_Phys Damage Per Second (Effective)
Count 7499
Mean 46700.69
Minimum 39884.04
Maximum 57149.07
Spread ( max - min ) 17265.03
Range [ ( max - min ) / 2 * 100% ] 18.48%
Damage
PR_Shaman_Enhancement_Phys Damage
Count 7499
Mean 13135351.80
Minimum 9774724.82
Maximum 16875142.00
Spread ( max - min ) 7100417.18
Range [ ( max - min ) / 2 * 100% ] 27.03%
DTPS
PR_Shaman_Enhancement_Phys Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
PR_Shaman_Enhancement_Phys Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
PR_Shaman_Enhancement_Phys Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
PR_Shaman_Enhancement_Phys Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
PR_Shaman_Enhancement_Phys Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
PR_Shaman_Enhancement_Phys Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
PR_Shaman_Enhancement_PhysTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
PR_Shaman_Enhancement_Phys Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.50 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.00 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 13.57 feral_spirit
G 2.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
H 3.72 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
I 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
J 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
K 20.28 windstrike
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
L 5.67 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
M 2.38 ice_strike,if=buff.doom_winds_talent.up
N 0.79 sundering,if=buff.doom_winds_talent.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
O 1.17 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
0.00 ice_strike,if=talent.hailstorm.enabled
0.00 frost_shock,if=buff.hailstorm.up
P 2.67 lava_lash,if=dot.flame_shock.refreshable
Q 44.21 stormstrike,if=talent.stormflurry.enabled&buff.stormbringer.up
R 24.74 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
S 3.83 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
T 40.08 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
U 18.70 ice_strike
V 16.27 lava_lash
0.00 bag_of_tricks
W 13.99 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
X 5.72 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
Y 19.59 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
Z 1.15 earth_elemental
a 12.36 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ABCDFGEHKKKKKKMKKFKKKKKKORTUQRTFQVWXYQRQUWYVTQWTQQRTUQFVWTYZaRQUYVWTQWYXaTURTVYaTYFRUTVYaHLLRLLLQQQQFRTPQQSTQQRTUVQWQQQFQQRTUVWTXYRaTQUQRTQQQFVWTURTYWQWTQVUQRTQFDWGEHKKMKKNKFKPKKRTUQRTYVaTRUQYaVFTQRTQUQQSTVXYaRTQQFQRQQUVWYTWTQQRTUVYaTWYaFHLLLLMNRTVYaRTQQURTFQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana
Pre precombat 1 food PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 2 augmentation PR_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_earth
0:00.000 default B potion Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_earth
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:00.000 default F feral_spirit Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, crumbling_power(20), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:00.952 default G ascendance Fluffy_Pillow 40773.2/50000: 82% mana bloodlust, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon, crumbling_power(19), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:01.904 default E berserking Fluffy_Pillow 42296.4/50000: 85% mana bloodlust, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, crumbling_power(18), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:01.904 default H doom_winds Fluffy_Pillow 42296.4/50000: 85% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(2), static_accumulation, crumbling_power(18), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:02.772 single K windstrike Fluffy_Pillow 43685.2/50000: 87% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(4), static_accumulation, doom_winds_talent, crumbling_power(18), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:03.640 single K windstrike Fluffy_Pillow 45074.0/50000: 90% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, doom_winds_talent, crumbling_power(17), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:04.506 single K windstrike Fluffy_Pillow 46459.6/50000: 93% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds_talent, crumbling_power(16), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:05.375 single K windstrike Fluffy_Pillow 47850.0/50000: 96% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(15), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:06.242 single K windstrike Fluffy_Pillow 49237.2/50000: 98% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(14), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.110 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:07.977 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:08.844 single K windstrike Fluffy_Pillow 49737.2/50000: 99% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:09.711 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:10.579 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:11.443 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:12.310 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(6), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:13.178 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(6), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:14.046 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), maelstrom_weapon(8), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(5), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.000 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(7), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(4), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:15.951 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(3), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:16.906 single O flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, crumbling_power(2), forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:17.861 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, crumbling_power, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:18.814 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:19.769 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:20.722 single Q stormstrike Fluffy_Pillow 49874.8/50000: 100% mana bloodlust, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:21.675 single R elemental_blast Fluffy_Pillow 49399.6/50000: 99% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:22.628 single T stormstrike Fluffy_Pillow 49549.4/50000: 99% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:23.581 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:24.536 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(4), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:25.489 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(4), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:26.442 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:27.395 single X sundering Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, ice_strike, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:28.346 single Y frost_shock Fluffy_Pillow 48521.6/50000: 97% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, elemental_chaos_earth, elemental_potion_of_ultimate_power
0:29.299 single Q stormstrike Fluffy_Pillow 49546.4/50000: 99% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), elemental_chaos_earth, elemental_potion_of_ultimate_power
0:30.253 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_earth
0:31.205 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, legacy_of_the_frost_witch, elemental_chaos_earth
0:32.131 single U ice_strike Fluffy_Pillow 49481.6/50000: 99% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_earth
0:33.056 single W lightning_bolt Fluffy_Pillow 49311.6/50000: 99% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:33.981 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
0:34.909 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
0:35.834 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_earth
0:36.761 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(8), elemental_chaos_earth
0:37.688 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), elemental_chaos_earth
0:38.613 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, forceful_winds(2), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_earth
0:39.540 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
0:40.465 single Q stormstrike Fluffy_Pillow 49480.0/50000: 99% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_earth
0:41.703 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_earth
0:43.101 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:44.339 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:45.577 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:46.816 default F feral_spirit Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), elemental_blast_critical_strike, forceful_winds(3), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:48.055 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), ice_strike, sophic_devotion, elemental_chaos_earth
0:49.294 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(8), ice_strike, sophic_devotion, elemental_chaos_earth
0:50.532 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:51.772 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:53.010 single Z earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:54.249 single a flame_shock Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
0:55.489 Waiting     0.389 sec 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
0:55.878 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), sophic_devotion, elemental_chaos_earth
0:57.116 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(2), sophic_devotion, elemental_chaos_earth
0:58.319 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_earth
0:59.522 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, elemental_chaos_earth
1:00.726 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_earth
1:01.929 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, maelstrom_weapon(6), elemental_chaos_earth
1:03.132 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds, legacy_of_the_frost_witch, elemental_chaos_earth
1:04.334 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_earth
1:05.536 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_earth
1:06.740 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(3), legacy_of_the_frost_witch, elemental_chaos_earth
1:07.979 single X sundering Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(3), elemental_chaos_earth
1:09.219 single a flame_shock Fluffy_Pillow 48984.0/50000: 98% mana flurry(2), forceful_winds(3), elemental_chaos_earth
1:10.459 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(3), elemental_chaos_earth
1:11.698 single U ice_strike Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), forceful_winds(5), maelstrom_weapon(4), elemental_chaos_earth
1:12.937 single R elemental_blast Fluffy_Pillow 49314.8/50000: 99% mana flurry(3), forceful_winds(2), maelstrom_weapon(5), ice_strike, elemental_chaos_earth
1:14.176 single T stormstrike Fluffy_Pillow 49922.2/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:15.377 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:16.580 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
1:17.780 single a flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_earth
1:18.980 Waiting     0.982 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(2), elemental_chaos_earth
1:19.962 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(4), maelstrom_weapon(2), elemental_chaos_earth
1:21.371 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(4), elemental_chaos_earth
1:22.576 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), maelstrom_weapon(4), elemental_chaos_earth
1:24.019 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_earth
1:25.256 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), sophic_devotion, elemental_chaos_earth
1:26.495 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, sophic_devotion, elemental_chaos_earth
1:27.734 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), ice_strike, sophic_devotion, elemental_chaos_earth
1:28.972 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), ice_strike, sophic_devotion, elemental_chaos_earth
1:30.210 single a flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
1:31.448 Waiting     0.223 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
1:31.671 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), sophic_devotion, elemental_chaos_earth
1:33.144 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), doom_winds_talent, sophic_devotion, elemental_chaos_earth
1:34.383 single L stormstrike Fluffy_Pillow 48982.4/50000: 98% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds_talent, sophic_devotion, elemental_chaos_earth
1:35.622 single R elemental_blast Fluffy_Pillow 49964.8/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, sophic_devotion, elemental_chaos_earth
1:36.858 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, doom_winds_talent, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
1:38.097 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(4), doom_winds_talent, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
1:39.336 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(9), doom_winds_talent, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
1:40.576 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_chaos_earth
1:41.813 single Q stormstrike Fluffy_Pillow 49979.2/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:43.053 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:44.291 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:45.528 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:46.766 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:48.003 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:49.207 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:50.410 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:51.614 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(9), legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:52.817 single S lightning_bolt Fluffy_Pillow 48924.8/50000: 98% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:54.019 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:55.220 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
1:56.423 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
1:57.626 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
1:58.865 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
2:00.105 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
2:01.343 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
2:02.583 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds(5), stormbringer, maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
2:03.821 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, maelstrom_weapon(5), ice_strike, sophic_devotion, elemental_chaos_earth
2:05.061 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon, ice_strike, sophic_devotion, elemental_chaos_earth
2:06.299 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), stormbringer, maelstrom_weapon(3), ice_strike, elemental_chaos_earth
2:07.538 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(4), ice_strike, sophic_devotion_oh, elemental_chaos_earth
2:08.776 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), forceful_winds(5), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion_oh, elemental_chaos_earth
2:10.014 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion_oh, elemental_chaos_earth
2:11.253 single Q stormstrike Fluffy_Pillow 49982.4/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion_oh, elemental_chaos_earth
2:12.492 single R elemental_blast Fluffy_Pillow 49964.8/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), sophic_devotion_oh, elemental_chaos_earth
2:13.729 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
2:14.968 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
2:16.205 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
2:17.445 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
2:18.684 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
2:19.920 single X sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
2:21.157 single Y frost_shock Fluffy_Pillow 48979.2/50000: 98% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
2:22.395 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
2:23.633 single a flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), sophic_devotion_oh, elemental_chaos_earth
2:24.870 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(3), maelstrom_weapon, sophic_devotion_oh, elemental_chaos_earth
2:26.108 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(4), stormbringer, maelstrom_weapon(2), spiraling_winds, forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:27.346 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(4), spiraling_winds(2), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:28.585 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(2), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:29.823 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(7), ice_strike, spiraling_winds(3), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:31.101 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:32.306 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, forceful_winds(5), stormbringer, maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(4), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:33.509 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:34.712 single Q stormstrike Fluffy_Pillow 49924.8/50000: 100% mana flurry(2), elemental_blast_haste, stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(5), forgestorm_ignited, sophic_devotion_oh, elemental_chaos_earth
2:35.913 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_weapon(8), ice_strike, spiraling_winds(6), forgestorm_ignited, elemental_chaos_earth
2:37.116 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(9), ice_strike, spiraling_winds(7), elemental_chaos_earth
2:38.317 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(9), ice_strike, spiraling_winds(7), elemental_chaos_earth
2:39.518 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, spiraling_winds(8), elemental_chaos_earth
2:40.720 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
2:41.960 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, spiraling_winds(9), elemental_chaos_earth
2:43.199 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:44.436 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:45.673 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:46.911 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:48.149 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), spiraling_winds(10), elemental_chaos_earth
2:49.390 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:50.626 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:51.864 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:53.103 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(5), maelstrom_weapon(5), legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:54.341 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana stormbringer, maelstrom_weapon(5), ice_strike, spiraling_winds(10), elemental_chaos_earth
2:55.579 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds, maelstrom_weapon(6), ice_strike, spiraling_winds(10), elemental_chaos_earth
2:56.816 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:58.019 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(3), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
2:59.222 default F feral_spirit Fluffy_Pillow 49924.8/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(5), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_earth
3:00.424 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, spiraling_winds(10), elemental_chaos_frost
3:00.424 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(9), ice_strike, legacy_of_the_frost_witch, crumbling_power(20), spiraling_winds(10), elemental_chaos_frost
3:01.628 default G ascendance Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, crumbling_power(19), spiraling_winds(10), elemental_chaos_frost
3:02.832 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, ice_strike, crumbling_power(18), spiraling_winds(10), elemental_chaos_frost
3:02.832 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(5), static_accumulation, ice_strike, crumbling_power(18), spiraling_winds(10), elemental_chaos_frost
3:03.926 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), static_accumulation, doom_winds_talent, ice_strike, crumbling_power(18), spiraling_winds(10), elemental_chaos_frost
3:05.017 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(7), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(17), spiraling_winds(10), elemental_chaos_frost
3:06.110 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, crumbling_power(16), spiraling_winds(10), elemental_chaos_frost
3:07.237 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(15), spiraling_winds(10), elemental_chaos_frost
3:08.363 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(14), spiraling_winds(10), elemental_chaos_frost
3:09.489 single N sundering Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(8), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(13), elemental_chaos_frost
3:10.614 single K windstrike Fluffy_Pillow 48800.0/50000: 98% mana berserking, ascendance, flurry(2), feral_spirit, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, doom_winds_talent, ice_strike, legacy_of_the_frost_witch, crumbling_power(12), elemental_chaos_frost
3:11.739 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(11), elemental_chaos_frost
3:12.866 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(10), elemental_chaos_frost
3:13.993 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds, earthen_weapon(4), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(9), elemental_chaos_frost
3:15.121 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(8), elemental_chaos_frost
3:16.359 single K windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(9), static_accumulation, ice_strike, legacy_of_the_frost_witch, crumbling_power(7), elemental_chaos_frost
3:17.596 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, crumbling_power(6), elemental_chaos_frost
3:18.836 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon, legacy_of_the_frost_witch, crumbling_power(5), elemental_chaos_frost
3:20.074 single U ice_strike Fluffy_Pillow 49980.8/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, crumbling_power(4), elemental_chaos_frost
3:21.313 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
3:22.552 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
3:23.790 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
3:25.028 single Y frost_shock Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
3:26.266 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
3:27.507 single a flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_frost
3:28.743 Waiting     1.001 sec 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(4), elemental_chaos_frost
3:29.744 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(4), elemental_chaos_frost
3:31.201 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_weapon(6), elemental_chaos_frost
3:32.441 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds, elemental_chaos_frost
3:33.643 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), stormbringer, maelstrom_weapon, ice_strike, elemental_chaos_frost
3:34.846 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(2), ice_strike, elemental_chaos_frost
3:36.048 single a flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), maelstrom_weapon(2), elemental_chaos_frost
3:37.252 Waiting     0.927 sec 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), maelstrom_weapon(2), elemental_chaos_frost
3:38.179 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_frost
3:39.599 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), maelstrom_weapon(2), forgestorm_ignited, elemental_chaos_frost
3:40.941 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), forgestorm_ignited, elemental_chaos_frost
3:42.142 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(5), forgestorm_ignited, elemental_chaos_frost
3:43.380 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), maelstrom_weapon(7), forgestorm_ignited, elemental_chaos_frost
3:44.618 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:45.857 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:47.094 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_weapon(7), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:48.332 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_frost
3:49.570 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_chaos_frost
3:50.808 single S lightning_bolt Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_frost
3:52.048 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:53.286 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:54.524 single X sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(2), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:55.762 single Y frost_shock Fluffy_Pillow 48980.8/50000: 98% mana flurry(3), forceful_winds(5), maelstrom_weapon(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
3:57.000 single a flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(4), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
3:58.238 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(5), maelstrom_weapon(5), forgestorm_ignited, sophic_devotion, elemental_chaos_frost
3:59.478 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds(5), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_frost
4:00.715 single Q stormstrike Fluffy_Pillow 49979.2/50000: 100% mana flurry, elemental_blast_critical_strike, stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_earth
4:01.954 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_earth
4:03.193 default F feral_spirit Fluffy_Pillow 48982.4/50000: 98% mana flurry(3), elemental_blast_critical_strike, forceful_winds(3), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, forgestorm_ignited, sophic_devotion, elemental_chaos_earth
4:04.431 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), forgestorm_ignited, sophic_devotion, elemental_chaos_earth
4:05.669 single R elemental_blast Fluffy_Pillow 49980.8/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), forgestorm_ignited, elemental_chaos_earth
4:07.101 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, forgestorm_ignited, elemental_chaos_earth
4:08.339 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_earth
4:09.578 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_chaos_earth
4:10.816 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
4:12.053 single W lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(6), ice_strike, sophic_devotion_oh, elemental_chaos_earth
4:13.293 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, sophic_devotion_oh, elemental_chaos_earth
4:14.531 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, sophic_devotion_oh, elemental_chaos_earth
4:15.770 single W lightning_bolt Fluffy_Pillow 49982.4/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(7), sophic_devotion_oh, elemental_chaos_earth
4:17.008 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
4:18.246 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
4:19.482 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
4:20.720 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
4:21.958 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(2), legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
4:23.159 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
4:24.361 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
4:25.562 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:26.765 single a flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), elemental_chaos_earth
4:27.969 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(3), maelstrom_weapon(3), elemental_chaos_earth
4:29.171 single W lightning_bolt Fluffy_Pillow 49923.2/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_weapon(6), elemental_chaos_earth
4:30.373 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, forceful_winds(4), maelstrom_weapon, sophic_devotion, elemental_chaos_earth
4:31.574 single a flame_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(4), maelstrom_weapon, sophic_devotion, elemental_chaos_earth
4:32.823 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana maelstrom_weapon(2), sophic_devotion, elemental_chaos_earth
4:34.060 default H doom_winds Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, earthen_weapon(2), maelstrom_weapon(3), sophic_devotion, elemental_chaos_earth
4:35.299 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon(3), doom_winds_talent, sophic_devotion, elemental_chaos_earth
4:36.538 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(6), doom_winds_talent, sophic_devotion, elemental_chaos_earth
4:37.775 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(9), doom_winds_talent, sophic_devotion, elemental_chaos_earth
4:39.014 single L stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), doom_winds_talent, sophic_devotion, elemental_chaos_earth
4:40.252 single M ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, sophic_devotion, elemental_chaos_earth
4:41.491 single N sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, sophic_devotion, elemental_chaos_earth
4:42.730 single R elemental_blast Fluffy_Pillow 48982.4/50000: 98% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_earth
4:43.969 single T stormstrike Fluffy_Pillow 49589.8/50000: 99% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon, ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:45.206 single V lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:46.443 single Y frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, elemental_chaos_earth
4:47.681 single a flame_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:48.921 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(5), sophic_devotion, elemental_chaos_earth
4:50.159 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:51.396 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds, stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:52.636 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:53.873 single U ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, forceful_winds(3), maelstrom_weapon(6), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:55.111 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), maelstrom_weapon(9), ice_strike, sophic_devotion, elemental_chaos_earth
4:56.350 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(4), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:57.588 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(3), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth
4:58.827 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_earth

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 5181 5012 2683 (2070)
Stamina 3463 0 10710 10200 6737
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 214200 204000 0
Mana 50000 50000 0
Spell Power 6635 6149 0
Crit 15.63% 15.63% 1013
Haste 25.34% 21.51% 3656
Versatility 3.93% 0.93% 191
Mana Regen 1600 1600 0
Attack Power 5440 5012 0
Mastery 52.07% 52.07% 3246
Armor 3603 3603 3603
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 372.00
Local Head Collar of Honorable Exultation
ilevel: 372, stats: { 463 Armor, +687 Sta, +168 Haste, +420 Mastery, +315 AgiInt }
Local Neck Wolfstride Pendant
ilevel: 372, stats: { +386 Sta, +226 Haste, +564 Mastery }
Local Shoulders Neverdare Shoulders
ilevel: 372, stats: { 425 Armor, +515 Sta, +204 Haste, +231 Mastery, +237 AgiInt }
Local Chest Thunderfused Val'kyr Hauberk
ilevel: 372, stats: { 618 Armor, +687 Sta, +181 Haste, +407 Mastery, +315 AgiInt }, enchant: { +127 StrAgiInt }
Local Waist Morningscale Waistguard
ilevel: 372, stats: { 347 Armor, +515 Sta, +234 Haste, +199 Mastery, +237 AgiInt }
Local Legs Stasis-Freed Leggings
ilevel: 372, stats: { 540 Armor, +687 Sta, +206 Crit, +382 Haste, +315 AgiInt }, enchant: { +120 BonusArmor, +151 StrAgi }
Local Feet Lightning-Charged Striders
ilevel: 372, stats: { 386 Armor, +515 Sta, +154 Haste, +287 Mastery, +237 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 372, stats: { 309 Armor, +386 Sta, +123 Haste, +208 Mastery, +177 AgiInt }
Local Hands Sharpeye Gauntlets
ilevel: 372, stats: { 347 Armor, +515 Sta, +210 Haste, +227 Mastery, +237 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 372, stats: { +386 Sta, +361 Crit, +429 Haste }, enchant: { +73 Haste }
item effects: { equip: Signet of Melandrus }
Local Finger2 Unstable Arcane Loop
ilevel: 372, stats: { +386 Sta, +305 Crit, +485 Haste }, enchant: { +73 Haste }
Local Trinket1 Irideus Fragment
ilevel: 372, stats: { +420 Mastery }
item effects: { use: Crumbling Power }
Local Trinket2 Bottle of Spiraling Winds
ilevel: 372, stats: { +420 Haste }
item effects: { equip: Bottle of Spiraling Winds }
Local Back Cloak of Violent Harmony
ilevel: 372, stats: { 168 Armor, +177 Agi, +386 Sta, +141 Haste, +180 Mastery }
Local Main Hand Forgestorm
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +343 Sta, +141 Crit, +153 Haste }, enchant: sophic_devotion_2
item effects: { equip: Forgestorm }
Local Off Hand Bouldersplitter
ilevel: 372, weapon: { 407 - 525, 2.6 }, stats: { +158 Agi, +343 Sta, +191 Vers, +103 Mastery }, enchant: sophic_devotion_2

Profile

shaman="PR_Shaman_Enhancement_Phys"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJHAkcARSSSQSiECAAAAAAAAAAAAAlIJRIJSRASJJJFAlEJBa
class_talents=lava_burst:1/chain_lightning:1/earth_elemental:1/frost_shock:1/maelstrom_weapon:1/fire_and_ice:1/natures_fury:2/improved_lightning_bolt:2

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/stormstrike,if=talent.stormflurry.enabled&buff.stormbringer.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=collar_of_honorable_exultation,id=136777,bonus_id=1795/3251/657/7977
neck=wolfstride_pendant,id=133633,bonus_id=1795/3251/657/7977
shoulders=neverdare_shoulders,id=143970,bonus_id=1795/3262/657/7977
back=cloak_of_violent_harmony,id=109906,bonus_id=1795/3257/657/7977
chest=thunderfused_valkyr_hauberk,id=133622,bonus_id=1795/3251/657/7977,enchant=waking_stats_2
wrists=shikaar_ranger_bracers,id=193693,bonus_id=1594/657/7977
hands=sharpeye_gauntlets,id=109853,bonus_id=1795/3257/657/7977
waist=morningscale_waistguard,id=109843,bonus_id=1795/3257/657/7977
legs=stasisfreed_leggings,id=193643,bonus_id=1594/657/7977,enchant_id=6495
feet=lightningcharged_striders,id=193685,bonus_id=1594/657/7977
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/3251/657/7977,enchant_id=6555
finger2=unstable_arcane_loop,id=193633,bonus_id=1594/657/7977,enchant_id=6555
trinket1=irideus_fragment,id=193743,bonus_id=1594/657/7977
trinket2=bottle_of_spiraling_winds,id=193697,bonus_id=1594/657/7977
main_hand=forgestorm,id=193785,bonus_id=1594/657/7977,enchant=sophic_devotion_2
off_hand=bouldersplitter,id=193797,bonus_id=1594/657/7977,enchant=sophic_devotion_2

# Gear Summary
# gear_ilvl=372.00
# gear_agility=2683
# gear_stamina=6737
# gear_crit_rating=1013
# gear_haste_rating=3656
# gear_mastery_rating=3246
# gear_versatility_rating=191
# gear_armor=3603

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 312313751
Max Event Queue: 413
Sim Seconds: 2250297
CPU Seconds: 435.3919
Physical Seconds: 219.5914
Speed Up: 5168

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.53sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost abomination_limb_damage 383313 172943 576 7.65 3583 7194 38.2 38.2 26.0% 0.0% 0.0% 0.0% 6.91sec 172943 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 137.94sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_mh 0 811259 2704 37.87 3885 7780 189.4 189.4 26.5% 16.3% 0.0% 0.0% 1.85sec 1158971 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost auto_attack_oh 1 395590 1319 37.02 1942 3889 185.1 185.1 26.6% 16.7% 0.0% 0.0% 1.85sec 565143 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.64sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost breath_of_sindragosa_tick 155166 3512183 11707 39.34 14107 28205 196.7 196.7 26.6% 0.0% 0.0% 0.0% 1.43sec 3512183 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost burnout_wave 389710 187006 623 0.56 52972 106445 2.9 2.8 26.8% 0.0% 0.0% 0.0% 119.58sec 187006 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost death_and_decay 43265 6522 22 2.32 445 890 1.1 11.6 26.4% 0.0% 0.0% 0.0% 115.34sec 6522 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost dragon_games_equipment 386708 290840 969 1.38 33171 66341 6.9 6.9 27.2% 0.0% 0.0% 0.0% 47.12sec 415496 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 85.50sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_fever ticks -55095 596147 1987 19.75 4766 9539 66.3 98.7 26.6% 0.0% 0.0% 0.0% 4.51sec 596147 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike 49143 266188 887 4.92 8552 17104 24.6 24.6 26.6% 0.0% 0.0% 0.0% 7.17sec 266188 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost frost_strike_offhand 66196 133036 443 4.92 4276 8554 24.6 24.6 26.5% 0.0% 0.0% 0.0% 7.17sec 133036 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 62.58sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost howling_blast 49184 2063113 6877 13.25 24602 49173 66.3 66.3 26.6% 0.0% 0.0% 0.0% 4.51sec 2063113 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost avalanche 207150 432092 1440 13.22 5167 10327 66.1 66.1 26.5% 0.0% 0.0% 0.0% 4.52sec 432092 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate 49020 496350 1655 12.90 6078 12177 64.5 64.5 26.5% 0.0% 0.0% 0.0% 4.60sec 709089 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand 66198 248335 828 12.90 3040 6083 64.5 64.5 26.6% 0.0% 0.0% 0.0% 4.60sec 354773 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_km 222024 1237882 4126 8.36 0 29610 41.8 41.8 100.0% 0.0% 0.0% 0.0% 7.07sec 1237882 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost obliterate_offhand_km 66198 618941 2063 8.36 0 14805 41.8 41.8 100.0% 0.0% 0.0% 0.0% 7.07sec 618941 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 7.9 0.0 0.0% 0.0% 0.0% 0.0% 40.09sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 307.21sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.69sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 20.59sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost remorseless_winter_damage 196771 1656790 5523 48.68 5373 10782 243.4 243.4 26.5% 0.0% 0.0% 0.0% 1.23sec 1656790 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice 384177 58382 195 4.02 2296 4593 20.1 20.1 26.4% 0.0% 0.0% 0.0% 14.47sec 83405 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost strike_twice_oh 384177 58463 195 4.02 2296 4593 20.1 20.1 26.5% 0.0% 0.0% 0.0% 14.48sec 83521 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 20.2 0.0 0.0% 0.0% 0.0% 0.0% 14.48sec 0 300.00sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul claw 91776 104785 640 19.15 1583 3169 52.3 52.3 26.6% 0.0% 0.0% 0.0% 5.39sec 149696 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul gnaw 91800 212 1 1.07 57 115 2.9 2.9 26.1% 0.0% 0.0% 0.0% 120.69sec 302 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul main_hand 0 212826 1299 34.65 1777 3555 94.6 94.6 26.6% 0.0% 0.0% 0.0% 2.93sec 304045 163.79sec
PR_Death_Knight_Frost PR_Death_Knight_Frost_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.69sec 0 163.79sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy apocalypse 275699 66381 221 1.39 8256 16519 7.0 7.0 15.4% 0.0% 0.0% 0.0% 45.48sec 66381 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy auto_attack_mh 0 857359 2858 29.61 5018 10039 148.0 148.0 15.4% 0.0% 0.0% 0.0% 2.44sec 1224829 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.66sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dark_transformation 63560 59631 199 1.40 7402 14788 7.0 7.0 15.3% 0.0% 0.0% 0.0% 45.67sec 59631 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy death_coil 47541 1257922 4193 19.14 11388 22769 95.8 95.7 15.4% 0.0% 0.0% 0.0% 3.09sec 1257922 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy coil_of_devastation ticks -390271 372329 1241 26.42 2819 0 0.0 132.1 0.0% 0.0% 0.0% 0.0% 0.00sec 372329 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy dragon_games_equipment 386708 315449 1051 1.64 33373 66746 8.2 8.2 15.4% 0.0% 0.0% 0.0% 29.10sec 450653 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 166.88sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_strike 85948 353072 1177 5.29 11577 23101 26.5 26.5 15.3% 0.0% 0.0% 0.0% 11.40sec 504401 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy festering_wound 194311 556170 1854 20.69 4662 9324 103.4 103.4 15.3% 0.0% 0.0% 0.0% 3.52sec 556170 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy outbreak 77575 25122 84 2.37 1839 3680 11.9 11.9 15.1% 0.0% 0.0% 0.0% 26.31sec 25122 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 305.39sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike 55090 290010 967 15.35 3274 6557 76.8 76.8 15.4% 0.0% 0.0% 0.0% 3.76sec 414311 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy scourge_strike_shadow 70890 380774 1269 15.35 4300 8592 0.0 76.8 15.4% 0.0% 0.0% 0.0% 0.00sec 380774 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy solved_the_puzzle 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.59sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper 343294 132997 443 3.14 7360 14711 15.7 15.7 15.3% 0.0% 0.0% 0.0% 6.86sec 132997 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy soul_reaper_execute 343295 638267 2128 3.13 35312 70651 15.7 15.7 15.4% 0.0% 0.0% 0.0% 6.86sec 638267 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.17sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_assault 207289 63041 210 0.73 14965 29902 3.7 3.7 15.2% 0.0% 0.0% 0.0% 91.03sec 63041 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_pact 319236 399844 1333 24.57 2822 5644 122.8 122.8 15.3% 0.0% 0.0% 0.0% 2.64sec 399844 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 21.4 0.0 0.0% 0.0% 0.0% 0.0% 13.65sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy virulent_plague ticks -191587 264599 882 19.83 2314 4630 11.9 99.2 15.3% 0.0% 0.0% 0.0% 26.31sec 264599 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul claw 91776 93446 311 7.54 2145 4292 37.7 37.7 15.5% 0.0% 0.0% 0.0% 7.90sec 133498 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul gnaw 91800 314 1 0.74 73 147 3.7 3.7 15.3% 0.0% 0.0% 0.0% 90.06sec 449 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul main_hand 0 1287219 4291 38.34 5822 11642 191.7 191.7 15.4% 0.0% 0.0% 0.0% 1.55sec 1838931 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul spawn_travel 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_ghoul sweeping_claws 91778 409017 1363 13.60 5218 10438 68.0 68.0 15.3% 0.0% 0.0% 0.0% 4.29sec 409017 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 1551435 31037 47.43 34056 68191 39.5 39.5 15.3% 0.0% 0.0% 0.0% 5.36sec 1551435 49.99sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_gargoyle spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.18sec 0 49.99sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_risen_skulker skulker_shot 212423 354796 1183 30.76 1999 3999 153.9 153.8 15.4% 0.0% 0.0% 0.0% 1.94sec 506865 300.00sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 297649 3640 25.33 7467 14967 34.5 34.5 15.4% 0.0% 0.0% 0.0% 8.52sec 297649 81.78sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 703423 8601 60.28 7422 14826 82.2 82.2 15.4% 0.0% 0.0% 0.0% 3.51sec 703423 81.78sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul claw 199373 268181 4471 212.45 1094 2189 212.4 212.4 15.4% 0.0% 0.0% 0.0% 1.02sec 383126 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul main_hand 0 1372172 22876 348.21 3417 6834 348.1 348.1 15.3% 0.0% 0.0% 0.0% 0.62sec 1960296 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.12sec 0 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.92sec 0 59.98sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.73sec 0 59.97sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.34sec 0 59.96sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.92sec 0 59.96sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.57sec 0 59.95sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.24sec 0 59.95sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.89sec 0 59.94sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul claw 199373 170891 1758 93.99 973 1945 152.3 152.3 15.3% 0.0% 0.0% 0.0% 1.83sec 244137 97.23sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul main_hand 0 627565 6454 111.78 3002 6004 181.1 181.1 15.4% 0.0% 0.0% 0.0% 1.53sec 896544 97.23sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 47.71sec 0 97.23sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 47.10sec 0 98.52sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 46.96sec 0 98.55sec
PR_Death_Knight_Unholy PR_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 47.81sec 0 97.09sec
PR_Priest_Shadow PR_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.47sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow dark_ascension 391109 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.87sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague 335467 1184825 3949 10.15 19167 41007 50.7 50.7 19.2% 0.0% 0.0% 0.0% 5.89sec 2766305 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague ticks -335467 1581480 5272 25.72 10366 21165 50.7 128.6 17.9% 0.0% 0.0% 0.0% 5.89sec 2766305 300.00sec
PR_Priest_Shadow PR_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 179.3 0.0 0.0% 0.0% 0.0% 0.0% 1.66sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo 120644 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 62.99sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_heal 390971 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 62.99sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow halo_damage 390964 130164 434 0.97 22021 47757 4.9 4.9 18.2% 0.0% 0.0% 0.0% 62.99sec 130164 300.00sec
PR_Priest_Shadow PR_Priest_Shadow idol_of_cthun 377349 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_void_tendril mind_flay ticks -193473 965348 3218 32.98 5011 10160 22.0 164.9 16.4% 0.0% 0.0% 0.0% 12.62sec 965348 30.82sec
PR_Priest_Shadow PR_Priest_Shadow mental_fortitude 377065 153296 511 69.55 441 0 336.0 347.8 0.0% 0.0% 0.0% 0.0% 0.88sec 7078120 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_blast 8092 1213737 4046 12.59 15797 34618 62.9 62.9 18.5% 0.0% 0.0% 0.0% 4.76sec 1213737 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay ticks -15407 175908 586 8.09 3749 7695 6.8 40.4 15.3% 0.0% 0.0% 0.0% 39.18sec 175908 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_flay_insanity ticks -391403 1662013 5540 32.34 8695 17764 40.6 161.7 17.5% 0.0% 0.0% 0.0% 7.28sec 1662013 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mind_spike 73510 254000 847 2.02 21198 45964 10.1 10.1 16.2% 0.0% 0.0% 0.0% 25.37sec 254000 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.64sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames 375901 416270 1388 1.55 43568 95300 7.7 7.7 19.6% 0.0% 0.0% 0.0% 40.43sec 416270 300.00sec
PR_Priest_Shadow PR_Priest_Shadow mindgames_damage_reversal 323706 0 0 0.00 0 0 7.7 0.0 0.0% 0.0% 0.0% 0.0% 40.43sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 309.40sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow power_infusion 10060 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.67sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.89sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_damage 205386 357063 1190 1.92 30816 65998 9.6 9.6 18.3% 0.0% 0.0% 0.0% 32.83sec 357063 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_crash_dots 391286 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.89sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_weaving 346111 197696 659 26.07 1517 0 131.4 130.4 0.0% 0.0% 0.0% 0.0% 2.22sec 197696 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death 32379 371116 1237 2.55 24230 50544 12.8 12.8 18.5% 0.0% 0.0% 0.0% 24.31sec 371116 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_death_self_damage ticks -32409 89140 297 2.54 4635 17800 12.8 12.7 18.2% 0.0% 0.0% 0.0% 24.31sec 250208 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadow_word_pain ticks -589 835244 2784 50.82 2774 5677 9.6 254.1 17.7% 0.0% 0.0% 0.0% 32.83sec 835244 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparitions 341491 0 0 0.00 0 0 113.7 0.0 0.0% 0.0% 0.0% 0.0% 2.63sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow shadowy_apparition 148859 364583 1215 22.02 3311 0 111.9 110.1 0.0% 0.0% 0.0% 0.0% 2.62sec 364583 300.00sec
PR_Priest_Shadow PR_Priest_Shadow soulseeker_arrow ticks -388755 343883 1146 17.37 3959 0 7.3 86.9 0.0% 0.0% 0.0% 0.0% 36.94sec 343883 300.00sec
PR_Priest_Shadow PR_Priest_Shadow spoils_of_neltharus 381768 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.67sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch ticks -34914 1001863 3340 33.41 5062 10358 9.6 167.0 17.7% 0.0% 0.0% 0.0% 32.83sec 1001863 300.00sec
PR_Priest_Shadow PR_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 167.0 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 300.00sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment 373427 0 0 0.00 0 0 41.9 0.0 0.0% 0.0% 0.0% 0.0% 6.98sec 0 138.70sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender inescapable_torment_damage 373442 849283 6123 18.13 16162 33968 41.9 41.9 23.0% 0.0% 0.0% 0.0% 6.98sec 849283 138.70sec
PR_Priest_Shadow PR_Priest_Shadow_mindbender melee 0 723112 5214 56.83 4470 9089 131.4 131.4 22.4% 0.0% 0.0% 0.0% 2.22sec 723112 138.70sec
PR_Shaman_Enhancement PR_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 310.83sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement elemental_blast 117014 2433228 8111 4.42 90894 182455 22.1 22.1 21.0% 0.0% 0.0% 0.0% 13.50sec 2433228 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 10.7 0.0 0.0% 0.0% 0.0% 0.0% 30.04sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock 188389 613561 2045 16.47 6338 12737 82.4 82.4 17.4% 0.0% 0.0% 0.0% 3.64sec 1458134 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flame_shock ticks -188389 844573 2815 38.44 3736 7513 82.4 192.2 17.4% 0.0% 0.0% 0.0% 3.64sec 1458134 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flametongue_attack 10444 284041 947 132.26 365 734 661.3 661.3 17.4% 0.0% 0.0% 0.0% 0.73sec 284041 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement forgestorm_ignited_damage 381700 326349 1088 5.66 9807 19715 28.3 28.3 17.5% 0.0% 0.0% 0.0% 7.68sec 326349 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement frost_shock 196840 1662676 5542 8.63 32795 65590 43.2 43.2 17.5% 0.0% 0.0% 0.0% 6.92sec 1662676 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement ice_strike 342240 597240 1991 4.94 20562 41353 24.7 24.7 17.5% 0.0% 0.0% 0.0% 12.26sec 597240 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lava_lash 60103 2865077 9550 13.33 36554 73466 66.6 66.6 17.5% 0.0% 0.0% 0.0% 4.43sec 2865077 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt 188196 1175766 3919 3.71 52189 104907 18.5 18.5 21.3% 0.0% 0.0% 0.0% 16.36sec 1175766 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement main_hand 0 510568 1702 38.62 2612 5250 193.1 193.1 17.4% 16.4% 0.0% 0.0% 1.81sec 729402 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement offhand 1 255603 852 38.64 1308 2629 193.2 193.2 17.4% 16.4% 0.0% 0.0% 1.80sec 365156 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.66sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement primordial_wave 375982 49212 164 1.41 5984 11989 7.0 7.0 17.0% 0.0% 0.0% 0.0% 45.72sec 49212 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement lightning_bolt_pw 188196 844932 2816 1.40 99551 199772 7.0 7.0 21.2% 0.0% 0.0% 0.0% 45.90sec 844932 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 46.4 0.0 0.0% 0.0% 0.0% 0.0% 6.37sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_mh 32175 367458 1225 9.27 6740 13554 46.4 46.4 17.4% 0.0% 0.0% 0.0% 6.37sec 524954 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement stormstrike_offhand 32176 183696 612 9.27 3370 6778 46.4 46.4 17.4% 0.0% 0.0% 0.0% 6.37sec 262430 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement sundering 197214 241899 806 1.14 36064 72803 5.7 5.7 17.7% 0.0% 0.0% 0.0% 54.09sec 241899 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement windfury_attack 25504 219602 732 29.69 1259 2531 148.4 148.4 17.3% 0.0% 0.0% 0.0% 4.16sec 313725 300.00sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_greater_earth_elemental melee 0 26383 427 38.74 564 1128 39.9 39.9 17.3% 0.0% 0.0% 0.0% 2.24sec 37691 61.74sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_frost_wolf melee 0 211376 4525 114.75 2014 4022 89.3 89.3 17.5% 0.0% 0.0% 0.0% 3.41sec 301973 46.71sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_lightning_wolf melee 0 210390 5860 149.40 2003 4001 89.4 89.4 17.5% 0.0% 0.0% 0.0% 3.41sec 300564 35.90sec
PR_Shaman_Enhancement PR_Shaman_Enhancement_fiery_wolf melee 0 211702 6763 171.79 2011 4017 89.6 89.6 17.5% 0.0% 0.0% 0.0% 3.42sec 302439 31.30sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_dre 114051 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 30.97sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ascendance_damage_dre 344548 315668 1052 1.65 32021 64343 8.3 8.3 19.2% 0.0% 0.0% 0.0% 30.97sec 315668 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba doom_winds 384352 24893 83 0.75 6670 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.41sec 35562 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba earth_elemental 198103 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 308.91sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba elemental_blast 117014 2113534 7045 5.03 69366 139256 25.2 25.2 21.0% 0.0% 0.0% 0.0% 11.74sec 2113534 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba feral_spirit 51533 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.57sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock 188389 100118 334 6.08 2805 5627 30.4 30.4 17.3% 0.0% 0.0% 0.0% 9.71sec 465923 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flame_shock ticks -188389 365804 1219 37.38 1666 3347 30.4 186.9 17.3% 0.0% 0.0% 0.0% 9.71sec 465923 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flametongue_attack 10444 464885 1550 224.58 353 708 1122.9 1122.9 17.3% 0.0% 0.0% 0.0% 0.67sec 464885 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba forgestorm_ignited_damage 381700 332367 1108 5.76 9806 19715 28.8 28.8 17.5% 0.0% 0.0% 0.0% 7.60sec 332367 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba frost_shock 196840 322067 1074 3.41 16041 32295 17.1 17.1 17.4% 0.0% 0.0% 0.0% 16.46sec 322067 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba ice_strike 342240 437222 1457 4.09 18188 36474 20.5 20.5 17.4% 0.0% 0.0% 0.0% 14.76sec 437222 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lava_lash 60103 415422 1385 3.73 18909 37998 18.7 18.7 17.5% 0.0% 0.0% 0.0% 15.66sec 415422 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt 188196 880153 2934 3.42 42389 84871 17.1 17.1 21.4% 0.0% 0.0% 0.0% 16.45sec 880153 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba main_hand 0 428367 1428 32.66 2592 5209 163.3 163.3 17.4% 16.3% 0.0% 0.0% 2.14sec 611969 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba offhand 1 219094 730 33.37 1298 2608 166.9 166.9 17.4% 16.4% 0.0% 0.0% 2.09sec 313000 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike 17364 0 0 0.00 0 0 90.5 0.0 0.0% 0.0% 0.0% 0.0% 3.30sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_mh 32175 1246669 4156 24.14 8796 17666 120.7 120.7 17.3% 0.0% 0.0% 0.0% 3.30sec 1781001 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_mh 390287 298557 995 12.12 4926 0 60.6 60.6 0.0% 0.0% 0.0% 0.0% 5.53sec 298557 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormstrike_offhand 32176 623580 2079 24.14 4398 8838 120.7 120.7 17.3% 0.0% 0.0% 0.0% 3.30sec 890852 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_stormstrike_offhand 390287 149396 498 12.12 2465 0 60.6 60.6 0.0% 0.0% 0.0% 0.0% 5.53sec 149396 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba sundering 197214 316501 1055 1.29 41903 84221 6.4 6.4 17.0% 0.0% 0.0% 0.0% 48.81sec 316501 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windfury_attack 25504 2123166 7077 83.05 4360 8740 415.2 415.2 17.2% 0.0% 0.0% 0.0% 2.41sec 3033171 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash 114089 149858 500 6.67 3705 7445 33.3 33.3 21.1% 0.0% 0.0% 0.0% 8.51sec 149858 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windlash_offhand 114093 86544 288 7.71 1853 3721 38.5 38.5 21.0% 0.0% 0.0% 0.0% 7.38sec 86544 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike 115356 0 0 0.00 0 0 27.3 0.0 0.0% 0.0% 0.0% 0.0% 8.66sec 0 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_mh 115357 570402 1901 7.26 13389 26875 36.3 36.3 17.2% 0.0% 0.0% 0.0% 8.66sec 570402 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_mh 390287 103730 346 2.49 8340 0 12.4 12.4 0.0% 0.0% 0.0% 0.0% 18.32sec 103730 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba windstrike_offhand 115360 285127 950 7.26 6694 13440 36.3 36.3 17.1% 0.0% 0.0% 0.0% 8.66sec 285127 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba stormblast_windstrike_offhand 390287 51852 173 2.49 4169 0 12.4 12.4 0.0% 0.0% 0.0% 0.0% 18.32sec 51852 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba lightning_bolt_ti 188196 1089775 3633 5.44 33054 66195 27.2 27.2 21.2% 0.0% 0.0% 0.0% 8.68sec 1089775 300.00sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_greater_earth_elemental melee 0 26509 425 39.38 552 1103 41.0 41.0 17.3% 0.0% 0.0% 0.0% 2.40sec 37871 62.39sec
PR_Shaman_Enhancement_Gamba PR_Shaman_Enhancement_Gamba_spirit_wolf melee 0 837116 7875 205.31 1963 3921 363.7 363.7 17.3% 0.0% 0.0% 0.0% 1.64sec 1195910 106.30sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.42sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ascendance_damage 344548 104128 347 0.40 43797 87998 2.0 2.0 18.7% 0.0% 0.0% 0.0% 180.42sec 104128 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.70sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys doom_winds 384352 24499 82 0.74 6582 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.47sec 34999 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 306.32sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys elemental_blast 117014 2023836 6746 4.95 67489 135576 24.7 24.7 21.1% 0.0% 0.0% 0.0% 11.70sec 2023836 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys feral_spirit 51533 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 23.92sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock 188389 105902 353 6.49 2777 5580 32.5 32.5 17.3% 0.0% 0.0% 0.0% 8.94sec 464384 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flame_shock ticks -188389 358481 1195 36.61 1667 3344 32.5 183.1 17.4% 0.0% 0.0% 0.0% 8.94sec 464384 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flametongue_attack 10444 459197 1531 218.04 359 720 1090.2 1090.2 17.2% 0.0% 0.0% 0.0% 0.68sec 459197 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys forgestorm_ignited_damage 381700 332645 1109 5.77 9805 19713 28.9 28.9 17.4% 0.0% 0.0% 0.0% 7.56sec 332645 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys frost_shock 196840 361577 1205 3.92 15701 31529 19.6 19.6 17.4% 0.0% 0.0% 0.0% 14.09sec 361577 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys ice_strike 342240 448057 1494 4.22 18089 36249 21.1 21.1 17.4% 0.0% 0.0% 0.0% 14.23sec 448057 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lava_lash 60103 417346 1391 3.79 18728 37583 18.9 18.9 17.5% 0.0% 0.0% 0.0% 15.09sec 417346 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt 188196 893969 2980 3.56 41193 82593 17.8 17.8 21.7% 0.0% 0.0% 0.0% 15.71sec 893969 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys main_hand 0 440772 1469 34.43 2531 5086 172.2 172.2 17.3% 16.3% 0.0% 0.0% 1.93sec 629691 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys offhand 1 223343 744 34.76 1270 2554 173.8 173.8 17.4% 16.4% 0.0% 0.0% 2.01sec 319069 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike 17364 0 0 0.00 0 0 90.0 0.0 0.0% 0.0% 0.0% 0.0% 3.16sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_mh 32175 1178383 3928 24.00 8354 16800 120.0 120.0 17.3% 0.0% 0.0% 0.0% 3.16sec 1683447 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_mh 390287 272965 910 11.76 4642 0 58.8 58.8 0.0% 0.0% 0.0% 0.0% 5.39sec 272965 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormstrike_offhand 32176 589108 1964 24.00 4176 8407 120.0 120.0 17.3% 0.0% 0.0% 0.0% 3.16sec 841604 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_stormstrike_offhand 390287 136404 455 11.76 2320 0 58.8 58.8 0.0% 0.0% 0.0% 0.0% 5.39sec 136404 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys sundering 197214 310746 1036 1.30 40599 81375 6.5 6.5 17.4% 0.0% 0.0% 0.0% 46.92sec 310746 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windfury_attack 25504 2174364 7248 82.17 4522 9019 410.9 410.9 17.1% 0.0% 0.0% 0.0% 2.45sec 3106313 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash 114089 134434 448 4.80 4626 9313 24.0 24.0 20.8% 0.0% 0.0% 0.0% 10.21sec 134434 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windlash_offhand 114093 70695 236 5.04 2319 4660 25.2 25.2 20.7% 0.0% 0.0% 0.0% 9.69sec 70695 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike 115356 0 0 0.00 0 0 20.3 0.0 0.0% 0.0% 0.0% 0.0% 9.99sec 0 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_mh 115357 572881 1910 5.42 18123 36286 27.1 27.1 16.6% 0.0% 0.0% 0.0% 9.99sec 572881 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_mh 390287 128617 429 2.33 11045 0 11.6 11.6 0.0% 0.0% 0.0% 0.0% 17.81sec 128617 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys windstrike_offhand 115360 286553 955 5.42 9053 18230 27.1 27.1 16.6% 0.0% 0.0% 0.0% 9.99sec 286553 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys stormblast_windstrike_offhand 390287 64168 214 2.33 5510 0 11.6 11.6 0.0% 0.0% 0.0% 0.0% 17.81sec 64168 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys lightning_bolt_ti 188196 1022281 3408 4.05 41711 83730 20.3 20.3 20.7% 0.0% 0.0% 0.0% 10.00sec 1022281 300.00sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_greater_earth_elemental melee 0 25678 415 38.25 555 1109 39.4 39.4 17.3% 0.0% 0.0% 0.0% 2.41sec 36684 61.86sec
PR_Shaman_Enhancement_Phys PR_Shaman_Enhancement_Phys_spirit_wolf melee 0 813074 12797 324.62 2019 4028 343.8 343.8 17.2% 0.0% 0.0% 0.0% 1.73sec 1161564 63.54sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
269363.4 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.7 2.2 22.2sec 18.7sec 5.5sec 23.10% 23.27% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.1s / 216.0s
  • trigger_min/max:1.6s / 216.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • brittle_1:23.10%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3sec 18.8sec 5.5sec 23.17% 23.44% 2.2 (2.2) 12.5

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 183.0s
  • trigger_min/max:3.0s / 183.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.17%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_death_check) 10.1 2.7 31.3sec 24.3sec 7.2sec 24.27% 0.00% 2.7 (2.7) 9.7

Buff Details

  • buff initial source:PR_Priest_Shadow
  • cooldown name:buff_death_and_madness_death_check
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.6s / 68.1s
  • trigger_min/max:0.9s / 68.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.7s

Stack Uptimes

  • death_and_madness_death_check_1:24.27%

Spelldata

  • id:322098
  • name:Death and Madness
  • tooltip:If the target dies within {$d=7 seconds}, the Priest gains {$321291m2=20} Insanity.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 2.1 114.0 133.5sec 2.5sec 139.9sec 97.82% 0.00% 95.7 (95.7) 1.1

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.1s / 330.6s
  • trigger_min/max:0.0s / 17.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.8s

Stack Uptimes

  • death_rot_1:1.47%
  • death_rot_2:1.04%
  • death_rot_3:1.17%
  • death_rot_4:1.28%
  • death_rot_5:1.07%
  • death_rot_6:1.22%
  • death_rot_7:1.21%
  • death_rot_8:1.23%
  • death_rot_9:1.31%
  • death_rot_10:86.83%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 4.7 238.7 69.2sec 1.2sec 62.4sec 97.93% 98.04% 197.1 (197.1) 3.7

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 345.8s
  • trigger_min/max:0.0s / 18.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 344.2s

Stack Uptimes

  • everfrost_1:1.57%
  • everfrost_2:1.57%
  • everfrost_3:1.56%
  • everfrost_4:1.55%
  • everfrost_5:1.55%
  • everfrost_6:1.54%
  • everfrost_7:1.53%
  • everfrost_8:1.53%
  • everfrost_9:1.52%
  • everfrost_10:84.01%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 24.3 37.5 12.4sec 4.8sec 10.3sec 82.95% 100.00% 5.9 (7.0) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 84.1s
  • trigger_min/max:0.0s / 29.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.1s

Stack Uptimes

  • festering_wound_1:18.73%
  • festering_wound_2:23.73%
  • festering_wound_3:18.54%
  • festering_wound_4:8.20%
  • festering_wound_5:6.06%
  • festering_wound_6:7.69%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 65.6 5.8sec 4.4sec 295.0sec 98.32% 97.94% 65.6 (65.6) 0.0

Buff Details

  • buff initial source:PR_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.8s / 5.9s
  • trigger_min/max:0.8s / 15.5s
  • trigger_pct:100.00%
  • duration_min/max:230.4s / 359.1s

Stack Uptimes

  • lashing_flames_1:98.32%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 65.1 188.6sec 4.5sec 287.5sec 99.20% 0.00% 60.9 (60.9) 0.0

Buff Details

  • buff initial source:PR_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 355.1s
  • trigger_min/max:0.9s / 43.2s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 357.9s

Stack Uptimes

  • razorice_1:1.01%
  • razorice_2:0.83%
  • razorice_3:0.92%
  • razorice_4:0.86%
  • razorice_5:95.57%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 273305.98
Minimum 248900.50
Maximum 299523.56
Spread ( max - min ) 50623.07
Range [ ( max - min ) / 2 * 100% ] 9.26%
Standard Deviation 6819.1338
5th Percentile 262292.34
95th Percentile 284693.95
( 95th Percentile - 5th Percentile ) 22401.60
Mean Distribution
Standard Deviation 78.7458
95.00% Confidence Interval ( 273151.64 - 273460.32 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2392
0.1 Scale Factor Error with Delta=300 396956
0.05 Scale Factor Error with Delta=300 1587823
0.01 Scale Factor Error with Delta=300 39695575
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3811
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 99639325 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.